GenomeNet

Database: RefSeq
Entry: NC_006686
LinkDB: NC_006686
Original site: NC_006686 
LOCUS       NC_006686            1783081 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 4
            sequence.
ACCESSION   NC_006686
VERSION     NC_006686.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1783081)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1783081)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1783081)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1783081)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017344.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1783081
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="4"
                     /note="MAT-alpha"
     gene            <1076..>2305
                     /locus_tag="CND00010"
                     /db_xref="GeneID:3257263"
     mRNA            <1076..>2305
                     /locus_tag="CND00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_570349.1"
                     /db_xref="GeneID:3257263"
     CDS             1076..2305
                     /locus_tag="CND00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570349.1"
                     /db_xref="GeneID:3257263"
                     /translation="MAENGFKMLGTMVGPKKAREEFLKSKMESEVKKIARLKDLPNQH
                     ALLLLRFCIQQNLRHLQRSLKSDDLKDYWEKMDQELWDEVQRMRTRQTEGTEAENALG
                     KKLSHLPARFGGLGLLSFTDVAPLAYKAAAAQADKHLANIFGLDLPDEAPTPSQRELC
                     SSMWEHQQTTILEGLNDPARKRLIENASKIGKRWLNVIPYFQPLRLSNQEVATGLHDR
                     TLVGSSIAICSFCGSDSPLGHDELCRSRNSWAQRRHDSINRIIHRGLQSVEGAVVSLE
                     PRTLEGQRRNDLRVRGRCGLHATDYDLKVYCLNDRDARSTLSAKLPSTPVATHVLNRC
                     LSWLDKVSEIATKKAPATHAGVFKAVVMSTGGLMSRETADEMRKWRREMGHMAFEGMM
                     RKMSLELVRARARTFAM"
     gene            3682..6115
                     /locus_tag="CND00020"
                     /db_xref="GeneID:3257239"
     mRNA            join(3682..3846,3906..4005,4053..4236,4287..4546,
                     4595..5010,5059..5164,5216..5548,5598..6115)
                     /locus_tag="CND00020"
                     /product="myo-inositol transporter, putative"
                     /transcript_id="XM_570347.2"
                     /db_xref="GeneID:3257239"
     CDS             join(3700..3846,3906..4005,4053..4236,4287..4546,
                     4595..5010,5059..5164,5216..5548,5598..5719)
                     /locus_tag="CND00020"
                     /codon_start=1
                     /product="myo-inositol transporter, putative"
                     /protein_id="XP_570347.2"
                     /db_xref="GeneID:3257239"
                     /translation="MSPTLDTITPMPEGGNNQTSVNISKEDLKVETEHYENVAYIAST
                     HDGLIDENLVRAENEDKVTPYFMFLISVAAIAGFLFGYDTGIVGAALPMVDTALGHTL
                     SATESEIITAGTTIGAIFGASILGTMADKLGRKWAMVISDFAFTAGAIIIAASYSVPQ
                     IIVGRLVLGVGVGGAAVIAPLYIAELAPTAVRGRCVGVNAFCIPFGQVIASAIGAGFQ
                     AGVPYHIGWRVLFALGVVPSVVQLCLMHFLPESPRVLVLRGKEQEARVCLKKIYGAAT
                     DDIIDLKLRIVKQYVAATTAMQRDLSFTERAKKYWTHKPYRRAIISISGVQAFGQLTG
                     FNTLLYYSGTIFGLLGIKNGSAAGLIPSCLNALFVFIGMSIVDKVGRRKLMVTFIPGM
                     MIAFTWTIISFHYLTKPTGGLLLKDYQYSTPLVGSVLGSIVLFVIPYGLTYSHIIWYQ
                     SEFLPLEIRAAGSAISTTACWLANLVVSVAYLTQLEKLGATGTYGLYLGFITIGYVFV
                     YFCYPETKGLSIDETAEIFIDGFGIEKAHQMLREKRAFAAELHANRA"
     gene            8313..9185
                     /locus_tag="CND00030"
                     /db_xref="GeneID:3257272"
     mRNA            join(8313..8587,8626..8695,8767..9185)
                     /locus_tag="CND00030"
                     /product="maltose O-acetyltransferase, putative"
                     /transcript_id="XM_570355.2"
                     /db_xref="GeneID:3257272"
     CDS             join(8330..8587,8626..8695,8767..9074)
                     /locus_tag="CND00030"
                     /codon_start=1
                     /product="maltose O-acetyltransferase, putative"
                     /protein_id="XP_570355.1"
                     /db_xref="GeneID:3257272"
                     /translation="MILPHQSNSRISPPSEDENPEELSQMLAGRPYHSWDSYIGRIRD
                     AQAREVWEINQIIDMEPRMKAMRDFIYMGDQVWIAQGFFCEYGFNITIGEEVFIGANC
                     TLLDVCPIKIGSRTMLGPNVQILTPAHPVSPEERNGLKGKEWAKPVTIGNDCWLGAGV
                     TVCPGVTIGDGVTLGAASVVTKDVPSRSLVVGNPGRVIKEIKADGTLEPAC"
     gene            9430..12508
                     /locus_tag="CND00040"
                     /db_xref="GeneID:3257266"
     mRNA            join(9430..9672,9751..9864,9929..10011,10109..10537,
                     10596..10820,10881..11138,11196..11288,11348..11467,
                     11516..11597,11656..11669,11771..12128,12178..12227,
                     12286..12508)
                     /locus_tag="CND00040"
                     /product="transketolase, putative"
                     /transcript_id="XM_024656923.1"
                     /db_xref="GeneID:3257266"
     CDS             join(9661..9672,9751..9864,9929..10011,10109..10537,
                     10596..10820,10881..11138,11196..11288,11348..11467,
                     11516..11597,11656..11669,11771..12128,12178..12227,
                     12286..12388)
                     /locus_tag="CND00040"
                     /codon_start=1
                     /product="transketolase, putative"
                     /protein_id="XP_024512703.1"
                     /db_xref="GeneID:3257266"
                     /translation="MSVNKVQDWDFEKFPIDLKKYKPFPLDPTKDKKLSQEQKDGLIA
                     NISLLRDVIVFFTATGAARGLAGHTGGAFDTIPEVVILLSFLLADQDKSKYVDILFDE
                     AGHRVATQYLLSALDGHIPVEHLLHYREANSKLPGHPELGLTPGVKFSSGRLGHMWPL
                     VNGVALAEKNKAVFILGSDGSQQEGDDAEAARLAVAQGLNVKLFVDDNDVTIAGHPSE
                     YLKGYSVARTLEGHGLKVVEANGEDLDSLYSAIVEVMNHKGPAAVVTHRPMAPKIKGI
                     EGSPHAHDAIKVEPAIEYLDARHPKCAAILRAIQPSNYAELLSGSTKERGACRVQFGE
                     AVSAVLDKTSKEQNKAKVLVIDSDLEGSTGLSVIHKKHPEVFLSSGIMERGNFSAAAG
                     WGAFNADRQGVFSTFSAFSEMIISELTMARLNFANVLTHFSHSGVDEMADNTCHFGIN
                     QFFLDNGLEDGYETRLYFAADCSQMDAIVDRVFYDKGLRFVFSTRSKVPWILKEDGSR
                     FFDSDYKFVPGKDEVIRKGTKGYVVAYGEILYRALDAVDRLRKEGLDVGLINKSTLNV
                     VDEDMIKEIGSTEFVFVAESLNRKTGLGSKFGTWLLERDLRPRYNYIGTSKEGCGGLG
                     EQIGHQNLGSSDIALKVKQMIK"
     gene            complement(14544..17533)
                     /locus_tag="CND00060"
                     /pseudo
                     /db_xref="GeneID:3257320"
     gene            14558..17569
                     /locus_tag="CND00050"
                     /db_xref="GeneID:3257477"
     mRNA            join(14558..17009,17071..17569)
                     /locus_tag="CND00050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570675.1"
                     /db_xref="GeneID:3257477"
     CDS             14578..16320
                     /locus_tag="CND00050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570675.1"
                     /db_xref="GeneID:3257477"
                     /translation="MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFD
                     EGNLHAMEGSDSSEVSNIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDE
                     CKGAVQAYAASQGFAAVIRRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGDSFKDV
                     RIRTIQTVKNGCPFAAVAWEMAEAEVKEHGGDKCWTWKVVNASHNHPPVANIGIALLR
                     RASRTPEAKELINTLIDSRTPFPSIISTMSQRFPTVMLTSEDLHRLAFRRRADLRAGS
                     SASAACIRQLVSNDELHRPFVNTRDELIGLVYTKRTARALIHRFPEVLFFDCTYKTNL
                     YRMPMLHIVGSTSTGMTYTAGVILMLRETTNWYTQALNSFFELVGKPDVKVVITDRDP
                     ALINALMSVLPKAYRFSCFWHLQENVKSNIRPCFVDEENIVMAVSNFCKAWVRYCVHA
                     KSDEQLEEGYRKMEELYPGQKYARAISYIRGLDEIKERFVHAYINKQLHFGQTGNSRL
                     EGQHATLKKSIDTKYGDLLLVIGSLSTYFDQQWLKILKRIELERTRCATHIPSTFVRV
                     CSFLLSVLFVIVLI"
     gene            18103..20919
                     /locus_tag="CND00070"
                     /db_xref="GeneID:3257274"
     mRNA            join(18103..18690,18746..18814,18873..19090,19143..19307,
                     19360..19445,19496..19980,20036..20072,20126..20458,
                     20524..20919)
                     /locus_tag="CND00070"
                     /product="myo-inositol transporter, putative"
                     /transcript_id="XM_570359.2"
                     /db_xref="GeneID:3257274"
     CDS             join(18553..18690,18746..18814,18873..19090,19143..19307,
                     19360..19445,19496..19980,20036..20072,20126..20458,
                     20524..20768)
                     /locus_tag="CND00070"
                     /codon_start=1
                     /product="myo-inositol transporter, putative"
                     /protein_id="XP_570359.2"
                     /db_xref="GeneID:3257274"
                     /translation="MMSATHIENRDDNFLENKHFDHTERLENIKGWQEPPSPSGFGGH
                     LIDENLVRVEGEDKVTWYLCFLISASAIAGFLFGYDTGVVGVALPLVGTDLGGSALNS
                     SQQEIITAGTTIGAIFGSAILGGWGDRLGRKKAILISDVFFTIGAVIIASSYSVPQII
                     VGRIVLGIGVGGAAVIAPLFITETAPTAVRGRCIGINAFFIPFGQVVSDAIGAGVQNM
                     HNGWRLLFALGAVPSLLQLLLFHYLPESPRILILKGDTEGARTVFQRIYPTATSEMIE
                     YKFRVAQEYVAATTALQSGTTFWERAKKVWRTGSYRRSIIAVSVLQAAGQLCGFNTLL
                     YYAGTLFSLLGLSNPALGGLIPAGTNAVFLLIGMTTVDKIGRRGLLLIGVPIMLLGHV
                     WNIVAFYYLCKPTGGFLDTSYTYDTTNVGIVIGGIVFFVAGFGLTYSHLVWYQAEYLA
                     LEVRSMGSGIATTICWIANLVVSVSYLSELETMTPSGTYGFYFGISVVAFVFVVFCFP
                     ETKQLSIDETSLLFENDWGVKRSAQMRKERRETQKRFQDAEVAEAATAHLEARQQKST
                     SVSPAELSKFMAGLKSGKRKPSVSV"
     gene            complement(20889..23304)
                     /locus_tag="CND00080"
                     /pseudo
                     /db_xref="GeneID:3257457"
     gene            23771..29354
                     /locus_tag="CND00090"
                     /db_xref="GeneID:3257245"
     mRNA            join(23771..24233,24299..24535,24583..24840,24889..25587,
                     25638..25720,25772..25946,25997..26479,26532..26848,
                     26905..27217,27276..27934,27989..28069,28117..28267,
                     28318..28549,28603..28908,28961..29042,29099..29354)
                     /locus_tag="CND00090"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_024656924.1"
                     /db_xref="GeneID:3257245"
     CDS             join(23846..24233,24299..24535,24583..24840,24889..25587,
                     25638..25720,25772..25946,25997..26479,26532..26848,
                     26905..27217,27276..27934,27989..28069,28117..28267,
                     28318..28549,28603..28908,28961..29042,29099..29224)
                     /locus_tag="CND00090"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_024512701.1"
                     /db_xref="GeneID:3257245"
                     /translation="MAFSGVGQGIGTYDRTEQTSGASLGRVTSRAHFTDVHPNDNLPA
                     QTGEHCARDVGHLARQLTRQSVAAADDSAAIFSYQEGSDLDPFSEKFNAKKWTKLMFE
                     ASQSSGPGRKAGLSFRNLDVHGFGSDADYQKTVGNLPLVGIGALRDLIGNRKRKVQIL
                     NSMDGVLEAGEMLVVLGPPGSGCTTMLKTIAGEMNGIYLDESSSLNYRGITPKQIYGQ
                     FRGEAIYTAEVDVHFPNLTVGQTLSFAAEARAPRKPPGGISKKEYAKHMRDVVMSVFG
                     ISHTLNTIVGNDFIRGVSGGERKRVTIAEASLAGAPLQCWDNSTRGLDSANAIEFCKN
                     LRLNSDYIGISSAVAIYQAPQAAYDCFDKVSVLYEGEQIFFGKATEAKQFFVDMGFHC
                     PSQQTVPDFLTSLTSASERTPREGFEGKIPTTPQEFATRWKQSDKYQELLAQIAEFEN
                     KYPVHGEKYQEFLQSRRAQQSKRLRPKSPYTLSYGGQVELCLRRGFDRLRADPSLTLT
                     QLFGNFIMALIIGSVFYNLPATTSSFYSRGALLFFAILMSAFGSALEILILYAQRGIV
                     EKHSRYAFYHPSAEAVASALTDIPYKVVNCIIFSLTLYFMTNLRREPGPFFFFMLISF
                     TLTMVMSMLFRSIASLSRSLTQALAPAALLILALVMYTGFAVNVANMRGWARWMNWLD
                     PIAYGFESLMINEFHGREYECAAFIPMGPGYEGATGQQLVCSTAGAVAGSSVVNGDDY
                     INLSYEYYHAHKWRNFGILIGFFLFFSAIYISATEFITAKKSKGEILVFPRGKIPRAL
                     LAQSTHSHGSSDDVEGGKFAGGSKMKKEITGADRADAGIIQRQTAIFSWKDVVYDIKI
                     KKEPRRILDHVDGWVKPGTLTALMGVSGAGKTTLLDVLATRVTMGVVTGEMLVDGRQR
                     DISFQRKTGYVQQQDLHLETSTVREALRFSAVLRQSNTISIKEKYEYVEEVLKLLEME
                     SYADAVVGVPGTGLNVEQRKRLTIGVELVAKPALLLFLDEPTSGLDSQTSWNILLLLR
                     KLTEHGQAILCTIHQPSAMLFEQFDRLLFLARGGKTVYFGEVGKGSHILIDYFEQNGA
                     PKCPEGENPAEWMLAAIGAAPGSHSDVDWHQAWINSPERVEVRRELARIKETQGGKGE
                     AALQNKDQEKSKSEVKAEYAEFASPLWKQFIVVLTRVWQQHWRTPSYIWSKAALCALS
                     ALFIGFSFFKAGTSQQGLQNQLFSVFMMFTIFGQLTQQIMPNFTTQRSLYEVRERPSK
                     AYSWKIFILSNIVAEIPWAILMGAVIYFTWYYPIGYYRNAIPTDAVHLRGALMFLYIE
                     MFLIFNATFAIMIVAGIATAETAGNIANLLFSMCLIFCGVLAPPSSLPGFWMFMYRVS
                     PFTYLVEGMLSTAVADTNVVCSDIELLTMNPPSGQSCGDYMSTYISNYGGYLVNENAT
                     TACEFCSMSSTNTFLAQFSIYYSNKWRDFGLLWAYVVFNIIAAVGIYWLARVPKNTGK
                     EQASEPEDVQEKLVPAQSTEKKPESVSRGSQSTAA"
     gene            31270..32259
                     /locus_tag="CND00095"
                     /db_xref="GeneID:36392821"
     mRNA            join(31270..31893,31975..32000,32080..32259)
                     /locus_tag="CND00095"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658474.1"
                     /db_xref="GeneID:36392821"
     CDS             join(31336..31893,31975..32000,32080..32110)
                     /locus_tag="CND00095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514328.1"
                     /db_xref="GeneID:36392821"
                     /translation="MPSRNDIKPSISDPVSVTSTTGFGLGFTPSNTSTDNSITGSSIR
                     GQKISHPFNVASSTGFVLTSNNTANPPPVASQGLPFSRSAQSDVNSAISDTSREVVFH
                     LYNPTTPPPHQTDNKCGHTQASAWSSPSSSYGAGSPPDQSAWSPDSSVQGGNSIRLPP
                     SQSSNTIDSVVLGSAVPSLSGSVSGLSTETFQTAPERMERSQQL"
     gene            complement(32252..35885)
                     /locus_tag="CND00100"
                     /db_xref="GeneID:3257164"
     mRNA            complement(join(32252..33727,33815..34216,34280..34866,
                     34941..35125,35418..35729,35791..35885))
                     /locus_tag="CND00100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656925.1"
                     /db_xref="GeneID:3257164"
     CDS             complement(join(33216..33727,33815..34216,34280..34866,
                     34941..35125,35418..35588))
                     /locus_tag="CND00100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512705.1"
                     /db_xref="GeneID:3257164"
                     /translation="MPPKRPTPSRSYAPNKLQRRATLPAAARAIKEVSELSEEDDDVD
                     DEMKAKLARKEARTIRNRESAQRSRNQRKAHLAWLESRVLELEAENQALRAGPPNAKP
                     KAKKESTENVTEISGPSTLRTSSSTSVSASESPSPSVHPNPISAAVSTWTKRSFHPNT
                     SYSCTRTHSREPSPAQSVFSLATDLGLPTELVNGGAGVRLASVTPPSKEMLSEMGVDD
                     DDDDREATHGDRIGVGNFFHTHLGHIQPSSNSFDEEEARLKEENAHLRERVGLLENLV
                     KQVVILFDLNPNSTSLRIPVSMPNMSAPVPAPPSPMLLGQNSMSISIPTHTLPYSTSD
                     GAGGMQEARRGSEIATNRAAVENFWAQESTHSGQQPDFGASRTQPSHPHQFYTSDGHT
                     KHSAHPSHLPSPRPLLSSQLGQHPNQMEQMEQRRQCAHSGYVRSTTGATVTSAALEDS
                     NPRSYSNSNAGLHLNSNMHADNSPSTLQQFHSGTGRNGESASFVPLPQGPMTSTSEIP
                     SAMSTTSFLSTFISTSLSNPTATPTPLSTSLFSDSPSISICSNDEKQAKHTPVACHSA
                     VVATSSLISSASLPFAPANPQAYERMRRWHEALQRARGVWCLVSGWKRQKVW"
     STS             33342..34113
                     /standard_name="Sal9"
                     /db_xref="UniSTS:470726"
     gene            37802..41759
                     /locus_tag="CND00110"
                     /db_xref="GeneID:3257217"
     mRNA            join(37802..38085,38145..38573,38623..38712,38766..38780,
                     38839..38908,38963..38977,39027..39059,39119..39189,
                     39247..39322,39388..39523,39595..39631,39712..39765,
                     39839..39915,39976..40040,40101..40108,40171..40318,
                     40379..40440,40502..40876,40939..41759)
                     /locus_tag="CND00110"
                     /product="ATP-dependent DNA helicase, putative"
                     /transcript_id="XM_024656926.1"
                     /db_xref="GeneID:3257217"
     CDS             join(37879..38085,38145..38573,38623..38712,38766..38780,
                     38839..38908,38963..38977,39027..39059,39119..39189,
                     39247..39322,39388..39523,39595..39631,39712..39765,
                     39839..39915,39976..40040,40101..40108,40171..40318,
                     40379..40440,40502..40876,40939..41652)
                     /locus_tag="CND00110"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase, putative"
                     /protein_id="XP_024512700.1"
                     /db_xref="GeneID:3257217"
                     /translation="MPSSSTTPIVVSDDSDADDFFPRKDVSANRSGESKERISEEFVK
                     GEKGGDLNLDARDAIKTTLAKLDTEIAEVVAQLEPLQALHASLTAERRALEFQLSSIS
                     RNPCPSDSLFSTAANTIDYQSSCFPFSSAIAATLRNTFNLNKFRLCQEGVINAAVDDR
                     DIVCVMPTGGGKSLTYQLPAVMGRGLTVVVSPLLALIWDQVRALKEIGIECVMLTGST
                     STQEQNEIYKRLRDGPSHGEKEIRLCYVTPEKVSKSKRFMSVLEKMNQSGRLRRFVID
                     EAHCCSQLGHDFRPDYKKLSMLKTLFPRVPIQAVTATLSSKTLPDLLKILRLGPITDG
                     RSSKTTGTVFFSSPLFRPNLHYKVLPKASNAKTAIAEMGRWIQDKHPGESGIVYCLSK
                     KDAETVAEELKGWSNGSIKTGVYHAGIDDTEKETIHVKWREGKINCICATIAFGLGID
                     KGDVRYVIHHSMSKSLEGYYQETGRAGRDGKDSDCVLFYRGQDATRLAGLIYTDVDGT
                     GKLHEMLRFAQDLRTCRKVAFAKYFSASAHLSTASWDNPTSLSSSDSDSTSTSPCEIC
                     DNCLRPPSSISTRDVTLESWKILRIAQEVVKQSGRVTLPNLASLTRGLGGGSFGVVGG
                     GEGKKGKKQKSTGERGYIDIEEFGGKVAMSADDVEVLIIHLLLIGYLQDSYHATAFSV
                     NVYVIPSPAAVRLTRMEREEIEAGRGVRVECTFAVPQRKEKKAPGNGSNKVAVKRKKG
                     EEDDEFDQAGGSSGRKLGGNMDFVGTGGRKPGNAKKARTQTHPQDENREEEEYEYFSD
                     VYGGLYSDGDIDQEADQQHGGDGDDWNGDGDEMEEDDEPKDDWDEMIGDGWRDEGGWK
                     VLNAGSGSGSGTGTGRAKGQGANGGGKQRAAIVTDSD"
     gene            complement(41771..44668)
                     /locus_tag="CND00120"
                     /db_xref="GeneID:3257243"
     mRNA            complement(join(41771..42300,42407..42894,42992..43411,
                     43493..44047,44113..44668))
                     /locus_tag="CND00120"
                     /product="expressed protein"
                     /transcript_id="XM_024656927.1"
                     /db_xref="GeneID:3257243"
     CDS             complement(join(42018..42300,42407..42894,42992..43411,
                     43493..44047,44113..44469))
                     /locus_tag="CND00120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512704.1"
                     /db_xref="GeneID:3257243"
                     /translation="MKPPTKLHIPISEKSSPFFSSPYPPHQPSSSQLSPIPDSSPSSA
                     AFTNSRSPLLPMSPKVLESGYPFPATAHTNASGRWARMRMVLRQGVVPQGVLRRALML
                     FMVLGLAVLVLHRSGTALQLAEKYNPASTQTKSRPASTQTEAHPASTHTESHVPYIPP
                     TSSPHGVREIDISSEPLPLDATLRERLDAWKNAPGGRGEVEGEVEAGGFVAWNLEQCS
                     TISEQHNTHMIQHSANTWASLNRTLLHKYRMELVDHMEGVLKRREHEKYGKGRGIVTV
                     AGNADTLQRVKWSLQMLRSYGSELPVEIYHFPSEAPPADDPIRTELAELGARLVEAKG
                     QTRDKGKNKSYHLKALAVVQCPWQEVLYIDSDSVPTRDPLYMFDAPNYKRLGIWATPD
                     YWKTSANNPIWAIMGVKCRNEWEMETGQMFIDKKRHLDVFLLVQYMLENHHFWFAFSD
                     GDKDTFRWALLALRKRWAVPGRWVGAGALPSGTASGDFCAHTMLQHDSWGEPLFVHYN
                     LLKQIPSGVGRGYSWGRTKQLPLFNTWPATPATARLGEPERKPEDGDKRGLGDVDCDM
                     LADAGEDGRARGEAKEMVMRRAARERGVKVKYHGGVTSALCIDLEYIDPRPTERQEED
                     AARRAALSASAALTPQSTSADGDGADDTPAPEWVGVVEPDWSQSPIEIVHWRDDEHLK
                     SFEKTIYDFGFKPSGKGF"
     gene            45732..48564
                     /locus_tag="CND00130"
                     /db_xref="GeneID:3257290"
     mRNA            join(45732..45828,45875..45979,46032..47119,47170..47496,
                     47546..47651,47699..48102,48158..48564)
                     /locus_tag="CND00130"
                     /product="tRNA (cytosine-5-)-methyltransferase, putative"
                     /transcript_id="XM_024656928.1"
                     /db_xref="GeneID:3257290"
     CDS             join(45796..45828,45875..45979,46032..47119,47170..47496,
                     47546..47651,47699..48102,48158..48386)
                     /locus_tag="CND00130"
                     /codon_start=1
                     /product="tRNA (cytosine-5-)-methyltransferase, putative"
                     /protein_id="XP_024512706.1"
                     /db_xref="GeneID:3257290"
                     /translation="MGRPRGKKHGGRGGGRAPQTRDNGAGEWKVFSPADYKNEAFEAY
                     YKEQNIMTPEEWPEFMSSLKQELPLTFRVTGSRAHAETINDIIKDTYVPNMQNVEFEG
                     KKYNPPTQLAWYPGQLAWQVNAPKRVVRKTEPFKNFQRFLVGETEVGNLSRQEAVSMI
                     PPLFLDVQPHHHCLDMCAAPGSKTAQIIEALNPHHTTSTGLLIANDSDYKRTHMLVHQ
                     TGRMPSKGLMVTNFDASMFPAIKLEEGKNLQFDRILADVPCSGDGTLRKNMEIWAKWG
                     VADGNSLHSLQLRILERAMNMLKPGGRLVYSTCSLNPSEDESVIAAALLKHTQFSLVD
                     VSSDLPELKRRPGMDKWKVATQEGKDGEIHWYETFDEYRKAVDEGKEKEKGEKGKGLP
                     SSLWAPENVESLNLNRCMRLLPHDQDTGGFFVAVLERAGASQTSSLKRQASPVEGEAE
                     IKRAREKSPAPAASAEAEAAPAAAAAAAESAVKAEKPVTTKKEKRDNSFKEDPYSYVD
                     PSHAEVKAIIEKFQFKDTFPRDNLLVRNEYGDPLRTMYLTNDIVKQIILNNDYTRMRL
                     ISAGIKSFTRQDSATSKNSELICKWRPPIDGILELLPHLGDGVLIEGTLSELRTLLED
                     HYPALEKFKRSEWKEEMEKREMGAAVVKFNAGNCDGGELKLPMYLPIWKAKMSLSLMI
                     DKREKSILSLRTFGEDICKPPPIQSDQKVASASTDPTPASTDPTPAEKEAQKMEDLVA
                     GDAEGEGKPGVALATEGGEEVVA"
     gene            48566..49850
                     /locus_tag="CND00140"
                     /db_xref="GeneID:3257250"
     mRNA            join(48566..49202,49271..49339,49393..49850)
                     /locus_tag="CND00140"
                     /product="GTPase, putative"
                     /transcript_id="XM_570363.2"
                     /db_xref="GeneID:3257250"
     CDS             join(48914..49202,49271..49339,49393..49736)
                     /locus_tag="CND00140"
                     /codon_start=1
                     /product="GTPase, putative"
                     /protein_id="XP_570363.1"
                     /db_xref="GeneID:3257250"
                     /translation="MGSLQWDYILKYVLIGDSSVGKSSLLVRLTDDRFDLTEPTLGVE
                     FGSRILTVGEQGKRVKVQCWDTAGTESFRSITRSYFRGAAGALLVYDVTRRDSFEHVT
                     SWLDDLRRHADENVSIILVANKTDLCSPTPPSLPTASYGQAIPPPSPTPPSSSPQFSF
                     KPRAVTSQEGMLFAKSNNLLYVETSAKEGWNVENAFEWTAREILKRVTEEELERKKGG
                     NGVKLGEGKKAGGCC"
     gene            50395..52811
                     /locus_tag="CND00150"
                     /db_xref="GeneID:3257132"
     mRNA            join(50395..50539,50599..50782,50859..51093,51154..51355,
                     51417..51750,51814..52129,52207..52506,52586..52811)
                     /locus_tag="CND00150"
                     /product="ferric-chelate reductase, putative"
                     /transcript_id="XM_570365.2"
                     /db_xref="GeneID:3257132"
     CDS             join(50466..50539,50599..50782,50859..51093,51154..51355,
                     51417..51750,51814..52129,52207..52506,52586..52710)
                     /locus_tag="CND00150"
                     /codon_start=1
                     /product="ferric-chelate reductase, putative"
                     /protein_id="XP_570365.1"
                     /db_xref="GeneID:3257132"
                     /translation="MTICLIEDCPTSAQRMAASANADSWYKAMHWARTTAIGCLVLIA
                     LLAILNWSRWHFRYRPRKLTAALRGLGYPHLAFIDLSLGITLGLFTLFMSLFIWCFQM
                     KPYYRPGVEWGNPPLGIRAGWIAQALLPFVFVMGSRINPLAWITRVEASRWMIWHQYG
                     ARVLLFFSVIHTFIILYAPYRQGGISWTRAYWTTYNKPSNFFNSHGRMVNGTFALAAL
                     SWIVFSSFAKIRNWNYEFFIVQHILSIVAFLISLWPHVKVSIPDALYYIYASVAVWGF
                     SILVRFFWETVEFAGLGKWKGKAILQGFGGDEMSGKGGVTRLVVETKRGSWETGQYVY
                     LRVPSVNPFQSHPFTIASSPPTNSDIDTPSPLTILISSRSGITKRIARSALSNPSKSI
                     PVIVQGPFGGFGEKLERFDKVLVICGGVGAAMGWPVASKLVREGRKVKMIWSVRNIDC
                     LEWFNDDRSFDRTDVTIHLTGPNPDQTSTFSAPMKPSSSKIESSQPVEAETTASTPGV
                     EEKLFDIASGTVVNSGRCDITKVLREYTEGMDQGERLAVIVCGPTSMLADTANAVAKL
                     QWDIVRGKSVLGEVWMHKERFGW"
     STS             51893..52719
                     /locus_tag="CND00150"
                     /standard_name="EcoV1"
                     /db_xref="UniSTS:470727"
     gene            complement(52935..54919)
                     /locus_tag="CND00160"
                     /db_xref="GeneID:3257177"
     mRNA            complement(join(52935..53246,53490..53549,53616..53672,
                     53799..53917,53986..54052,54120..54191,54252..54316,
                     54379..54491,54542..54558,54627..54919))
                     /locus_tag="CND00160"
                     /product="adenylate kinase, putative"
                     /transcript_id="XM_024656929.1"
                     /db_xref="GeneID:3257177"
     CDS             complement(join(53076..53246,53490..53549,53616..53672,
                     53799..53917,53986..54052,54120..54191,54252..54316,
                     54379..54491,54542..54558,54627..54890))
                     /locus_tag="CND00160"
                     /codon_start=1
                     /product="adenylate kinase, putative"
                     /protein_id="XP_024512698.1"
                     /db_xref="GeneID:3257177"
                     /translation="MSMLVRPRAIPRIAPILAPQRPSKRFNSSSTASTSSPVSHVASA
                     VADTAHSLADKFREAARFINSPSYDGVEEKGLRMLVFGKPGSGKGTLSSRLVKEYDIS
                     FVSTGDVLRKEIAAKSEVGRKAEAVVASGGLVSDELMLEIVKAELDRLKGKSWIIDGF
                     PRTLHQGELIDTVLNQENRPLNMVVHLNVPDSVIMARIAARWVHLPSGRVYNTTYSAP
                     KVPGKDDVTGEPLTKRPDDTPETFSKRLQAYYESTAPLLKYFEETYPESLHSISGSSS
                     DELWPQLVELIEPFNLRRRQTPAEKGRVDAEKVRKQADDLRDSREVDVPGEGKKVVAR
                     "
     gene            55035..56097
                     /locus_tag="CND00170"
                     /db_xref="GeneID:3257315"
     mRNA            join(55035..55384,55436..55686,55751..56097)
                     /locus_tag="CND00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656930.1"
                     /db_xref="GeneID:3257315"
     CDS             join(55519..55686,55751..56026)
                     /locus_tag="CND00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512803.1"
                     /db_xref="GeneID:3257315"
                     /translation="MTTQHDIPPTVELRALVSKGKLRVWNRVRVLNGGDSIRVSRMDT
                     AEEDRRCASFVSYMVSIDRNRRHPTRHVEFEDHLCYGELLNLITIDLPHHPKSYNTPP
                     VTLAFAHIKPALSHKHRIGSHEWSYYKECQAEEGSGLCQSAGWKG"
     gene            complement(56601..60967)
                     /locus_tag="CND00180"
                     /db_xref="GeneID:3257314"
     mRNA            complement(join(56601..56870,56936..57216,57277..57636,
                     57687..58233,58283..58374,58424..58858,58911..59066,
                     59115..59800,59841..60078,60395..60525,60583..60692,
                     60750..60778,60944..60967))
                     /locus_tag="CND00180"
                     /product="glutamate dehydrogenase, putative"
                     /transcript_id="XM_024656931.1"
                     /db_xref="GeneID:3257314"
     CDS             complement(join(56760..56870,56936..57216,57277..57636,
                     57687..58233,58283..58374,58424..58858,58911..59066,
                     59115..59800,59841..60078,60395..60525,60583..60692,
                     60750..60773))
                     /locus_tag="CND00180"
                     /codon_start=1
                     /product="glutamate dehydrogenase, putative"
                     /protein_id="XP_024512711.1"
                     /db_xref="GeneID:3257314"
                     /translation="MSTPTQGTLQTPLPAQLSKVLAESGAHISRPGSDLSTNRIRKDT
                     IGYKSSPFPLKADQQAAVTRILSESGFMPQELVPGEVDWFYNHLGIENSYFLWEKPEA
                     IADNVLSLYSAKLLAYTKHDPEQLVIDLEKIIPEGVDKSREGAVWIHSSKAGVSSSEG
                     PGAKVEKKIDSLYLDDSSPEKAYRLETYRSSGAISSTVSQQLRCYFISRCSFPTSGPV
                     KTAEGTTDIRSVSDASFLEKASENTLEVYQRIMNEVERRYGPVIEMFEVEDSRERRLV
                     IGYKIGGTRKFFSALSDLYHFYGLYSARKYVEQFSNGITIISMYLNPVPNTRAPPIEH
                     SIHQVVREASLLYVLPDNPFFSVTENEDTNHAVQEATYAYVGWIFAQHFCNRLGQAYI
                     ALKDALDESNPDHAEVLNKIKTRFREETFTRESIREVIQSHPGLVRMLYINFAMTHYP
                     VADEASQLTPTLSFQRLKTEQPLSDEDLHALIRKTAANQHAVQILEALLIFNRQVIKC
                     NFYQPTKVALSFRLNPSFLPEVEYPKAPFGMFFIVGAEFRGFHVRFRDVARGGIRIIR
                     SRGKENYNTNVRTLFDENYALAATQNLKNKDIPEGGAKGTILPILGANIQHCFEKYVD
                     SIIDLLIPGKTPGIKGKIVDVSNRPDPEILFFGPDENTADLMDWAAEHARSRNAPWWK
                     SFTTGKSAEKLGGIPHDTYGMTSTSVRQYIVGVLKAHGLNEKDVTKFQTGGPDGDLGS
                     NEILLSKDKTVAIIDGSGVLYDPAGLDRSELVRLAKARSPISGFDPAKLGEGGYKVLV
                     DDKDYRLPTGEVIPDGTSFRNTFHFRVKADLFVPCGGRPEAVNISNVNQLVDSEGKPH
                     FKYVVEGANLFFTQQARLWLEKKGVVLFKDSSTNKGGVTSSSLEVLAGLGLSDEEYID
                     LMIFKDGKPSTFYQNYVKDIQQKICENAAQEYTCITKEWLRNKGTKPRTTISDQLSST
                     LNQLQAELEQSDLYENIGSRKTVLNKAFPKTLVDKIGLETLMQRLPEQYQRATWSAWV
                     SSHYIYECGMTASNVDFFHFFSKLSA"
     gene            64207..66206
                     /locus_tag="CND00190"
                     /db_xref="GeneID:3257182"
     mRNA            join(64207..64467,64515..64677,64731..65859,65914..65992,
                     66042..66206)
                     /locus_tag="CND00190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570339.2"
                     /db_xref="GeneID:3257182"
     CDS             join(64264..64467,64515..64677,64731..65859,65914..65992,
                     66042..66191)
                     /locus_tag="CND00190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570339.1"
                     /db_xref="GeneID:3257182"
                     /translation="MADGSEAYNIDAFPNADFSARELPRPSFSRTQDVRGLVKHVRTV
                     AWSCDGKKAATGGEYKEIQVWDESLDSKTTTPLPSASKPSPHNHHVSSIAWSPVDPNI
                     LVSADKTFSVGSVIAVWDVTSPSAPIATFKTPGDVINLAWHPSGQHFAAVYPVKSRDL
                     VDFFRLSFSESGEPKWEKREDITLGGLSHGIGSEEINSLRFINSGQLVCAVSNDGSVS
                     AWVYPVESVRVDLVEEQVEPEPEQEREQEREQEQEQEHEQEQEQEQEQEQEQEQEQEQ
                     EEKEAEVVTEEKEDEVVTEEKEDELATEEKEDEVIAEEKEDEVATEENEEKEDREDKE
                     EDQNEENKQDVEDGPATPELPAIETPTERPLGDVKPAENNGDVEMTETENADAKANEE
                     SKGEEAPETNKPEFQDVEMVDAAQSNTQPSSVQPSRQSSPPPPTKTSPKPRAQPLKRY
                     RHDVCYAASLLSLAYDPRGRYFVVGGQDALLSLFDTKEWICEKSFDVCTAAIRHTAFS
                     YDGEFVAIGGDDLFIAIVSVYTGQTVAKIPIPAAVNALSWNPNKNSLAYCHQGKGGVP
                     LWHIVHQE"
     gene            complement(66231..69248)
                     /locus_tag="CND00200"
                     /db_xref="GeneID:3257311"
     mRNA            complement(join(66231..66942,67005..67229,67293..67665,
                     67730..67822,67871..68682,68731..68746,68799..69248))
                     /locus_tag="CND00200"
                     /product="transcription factor, putative"
                     /transcript_id="XM_570377.2"
                     /db_xref="GeneID:3257311"
     CDS             complement(join(66303..66942,67005..67229,67293..67665,
                     67730..67822,67871..68682,68731..68746,68799..68961))
                     /locus_tag="CND00200"
                     /codon_start=1
                     /product="transcription factor, putative"
                     /protein_id="XP_570377.1"
                     /db_xref="GeneID:3257311"
                     /translation="MTAMQHGNGHENTNPPGFSVLEESQGHESEEGGGNEPTRRVRRR
                     TGPFKRSRTGCGTCKRRGKKCDEEWTPQGHCQRCIIGQFECSGRTNIQSKSAARRAQQ
                     QQRTKNMSENNLQRESSESQWSSTDAQPSGSVSATHNHSHVDQSSMQAATGQQFLSNS
                     TPASSNHNHQTPPNPLGTTSSSTQQQANVPFAWYNPTHAPPTAPHHDPTTFLTIDHSQ
                     SLLDWASMFGNQPSTFLASSTECGALGLESIMPWSGGSNGDATTTASGGGSGSTGGSG
                     VQVGDGLWNDGVFGVPNQPGSNGPNQGGVGQVVNGISPNTADKHMRDGVSLSDLYVRV
                     LESWLVGIPSSTRENAQSRLRTYNENSGVMQFSRHALARAYMTLFSSSMSQVYPLSQF
                     ADLFPKSPRNMNNLQDFPIPDLISEFNVHLPRDPKGKGKEKTYEAGQLERRMREYEQK
                     VVTRLNADEEGLKWIEDETTLLREVIVTNPSHLAELLWGVMNLRHVEYIRSGASQSYN
                     VLALGDRLIRSALGSNHPPITLSQLRTAETWSVRMFATADIGRCIVERGRKTIFNFWS
                     DIPTDPNPPSPSQEEPWSFHLGLPDSILILLAEIINLSSSVSSLSSLSVKTQADELEK
                     AIRGWQSHQVDMSEGMESGVRMERIVVGELWRLSALVLLYESVHKVGGLHPVLRNARY
                     ELLNLLDSLTPLTQDRPPNHTALPAFLAATLSTSCQDRHRSMMHLLRVGPEKVWMDNV
                     AVVEKVWEESDTSGVLPDWWDKMKREGMSVAFF"
     STS             69491..69683
                     /standard_name="CTG8"
                     /db_xref="UniSTS:470725"
     gene            70002..73808
                     /locus_tag="CND00210"
                     /db_xref="GeneID:3257270"
     mRNA            join(70002..70250,70303..70466,70519..70588,70635..71092,
                     71152..71285,71331..71508,71567..71893,71944..72395,
                     72450..72527,72586..72821,72877..73087,73143..73205,
                     73258..73808)
                     /locus_tag="CND00210"
                     /product="exocyst complex component protein, putative"
                     /transcript_id="XM_024656932.1"
                     /db_xref="GeneID:3257270"
     CDS             join(70055..70250,70303..70466,70519..70588,70635..71092,
                     71152..71285,71331..71508,71567..71893,71944..72395,
                     72450..72527,72586..72821,72877..73087,73143..73205,
                     73258..73744)
                     /locus_tag="CND00210"
                     /codon_start=1
                     /product="exocyst complex component protein, putative"
                     /protein_id="XP_024512708.1"
                     /db_xref="GeneID:3257270"
                     /translation="MSAQDAPPRRPAKRNASTAVRSSKPRDPAIERALQLSTFESNYS
                     TEEFIGTLSEKLIAESKANPGPFNPTPFLQTFSPALDTLLELRKQVTERTKKMETDVR
                     RAEREYGKRLRELDGGFEAIGKSFSNLESKVTDVGRTAVRIGEQLENLHQTRSTAQNT
                     SLLLSYYLSLTHQTATTGENTSPLEQLFATRTSRQGREKLAVVLRRLMAISKDVADNA
                     ATLLSDAEAGAVPKEVTNGDGESQEPIVNQKVISKRRMEKEKAEKVRDEIEGYCERFE
                     KELLKLFDRSYRKGDPRMMAHCAKTLQEFNGGASCIQIYVNQHDFFIKDHSQIEKDEQ
                     DGVRVDIWATIGNPDEPPPTTEPGLEALCKSIRSTISQESQIMKAVFYPNSSAVMEGF
                     LQRIFAQVIQQHLEGLVQRASSISTLAILRILHLTHSICSSLVEDLKTYDSTLTTPPA
                     SSSRAPAPAGSGGSFSAFLDRALEEMYVPWLEGTRYLECESKNLVELYAGLLSRFTRY
                     HETVLQAKPNSLLNKVVHQLASSSSAATTSSTAQTAAAAISKYANLFTSSTNNPKTGT
                     ATPVLPPSFQKPGLAGQMRGANGADTATWGTGTSTPVIRSVTGQELKGDLVNKGLEDK
                     VWSTDGILAPTMAERMLKWHAEAVGRAVELSNSGDVGKNALALLKVLSEAIGRSFIET
                     ALDSTLARLEQQDNKTEPDLQPLAVLKPADQICHLWQRYTTTALFPLAGSNVPIRREM
                     TTLNTHNVVRMEGKANNVIQKAIDNVIGWLSYLLTKQKKNDYKPKNDELSFARTITEP
                     CELCCEFLATVRDAVNEGLSGKNAEAFLTEIGVSFHTLLLDHYKKFPVNPTGGLMLTK
                     DLASYQDVMASYSVPAINDRFDMLRQLGNSFIVQPNVLKSYLTESHLGRIDARLLRPY
                     LAQRSDYSQFSRSLQLDDGLSAGAASDDTFTTSHAPGHGHGLFKGTRLSTMSGVAGAG
                     MGKLKDMLKELDTLSPEEVSDERKARANAARASAAYQPMPMFYMH"
     gene            complement(74195..75265)
                     /locus_tag="CND00220"
                     /db_xref="GeneID:3257427"
     mRNA            complement(74195..75265)
                     /locus_tag="CND00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656933.1"
                     /db_xref="GeneID:3257427"
     CDS             complement(74276..74788)
                     /locus_tag="CND00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512805.1"
                     /db_xref="GeneID:3257427"
                     /translation="MLPSTQGKSEMSAQTWDSSDPRSYNERRAAQALDILEQEDIEYD
                     CNTRQPSTARSYVISSSVFNPATRKVERAFFTSLAPTDPAVTDDERTRRISIANQLSC
                     KITEGLKQSSEQWLPSCVRDGSTFELQRKERELYNKFLSEDTGNKEAGLTFYPYEDMA
                     ESMPWDPLVC"
     STS             75218..75995
                     /standard_name="Xba1"
                     /db_xref="UniSTS:470728"
     gene            complement(75422..75509)
                     /locus_tag="CND00230"
                     /db_xref="GeneID:3257149"
     tRNA            complement(75422..75509)
                     /locus_tag="CND00230"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:3257149"
     gene            75862..77990
                     /locus_tag="CND00240"
                     /db_xref="GeneID:3256918"
     mRNA            join(75862..75902,76071..76225,76278..76561,76611..77058,
                     77107..77282,77332..77552,77609..77990)
                     /locus_tag="CND00240"
                     /product="adenosylhomocysteinase, putative"
                     /transcript_id="XM_570337.1"
                     /db_xref="GeneID:3256918"
     CDS             join(75900..75902,76071..76225,76278..76561,76611..77058,
                     77107..77282,77332..77552,77609..77617)
                     /locus_tag="CND00240"
                     /codon_start=1
                     /product="adenosylhomocysteinase, putative"
                     /protein_id="XP_570337.1"
                     /db_xref="GeneID:3256918"
                     /translation="MSNYKVADISLAAFGRKEIELAEHEMPGLMYLREKYAQSQPLKG
                     ARIAGCLHMTIQTAVLIETLTALGAQVTWSSCNIFSTQDHAAAAIAATGVPVFAWKGE
                     TEEEYLWCIDQTLKAFPGGQALNMILDDGGDLTSLVHEKYPELLGDVKGVSEETTTGV
                     HHLYKMFKDGKLKVPAINVNDSVTKSKFDNYYGCRESLVDGIKRATDVMLAGKVAVVA
                     GFGDVGKGCAESLRSYGARVIVTEIDPINALQAAMAGYEVTTMEEAAPRGNVFVTTTG
                     CRDIITGAHFEAMPEDAIVSNIGHFDVEIDVAWLKANAAECVNIKPQVDRFTMKSGRH
                     VILLAEGRLVNLGCGTGHPSFVMSCSFANQVLAQIALWTNPEAYPLGVHMLPKSLDEE
                     VARAHLAQLGIKLTTMTKVQADYLGLPVQGPYKPDHYRY"
     gene            78134..80501
                     /locus_tag="CND00250"
                     /db_xref="GeneID:3257181"
     mRNA            join(78134..78372,78429..78530,78593..80501)
                     /locus_tag="CND00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656934.1"
                     /db_xref="GeneID:3257181"
     CDS             join(78187..78372,78429..78530,78593..80269)
                     /locus_tag="CND00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512696.1"
                     /db_xref="GeneID:3257181"
                     /translation="MPIPIFLQSLLCRTDAAPRIDPLPAGYSSTPLARSVLGPTFVPL
                     QLPPDGHMDPDTFKDITEAKLKTDLVLSHMRLVLAAQTQGGRRTTDTNDWNLIYNCIR
                     DYSEQILTRWLNTYANHTAALRQLQQAGLYPPQHVASGPHRVGDQTMYAPVKSRSSQY
                     VPPPLIRQSPLSVVSRDITPENAIAAPGTSRMQPISAQSKGGIPPPLPEKTKPFPSSR
                     PTSSQFPLADKPLAPLKYGDPRPRPASWQAMPETTGALFKALKRLSESEGLIPQEYAQ
                     LLERASRQEVSPTENQPATGDSIPSSPLQSYTPAGSVSAVKITDEHKKTIRRIRPPSR
                     DTASRHGADDGNNTYNHLNKTSPTTSNTPISYSGNSTPRLTPTAETFSQGKVNDQPIF
                     KCLPTPPPKMDIISLAPTNSVLETPGLTPLSQKEPFPIREPHPTPTELTQRDSKTSRT
                     PPPKSPARVAANLVREKAALNTAPEAISLQPPDHDLPLYANVNPGHTLLAENESVNVR
                     APYTATSEETKPEIHIEVPTPNSVTSGLTPLSETEPISIREPHPTPIDAERRDLQNAL
                     TPPPPKALSAASTPCGGYKTPDGSPVKAAISGFKKLVEKAKSSREPVSERTEENAKAR
                     RVVQEVVGSPQLADVVDCDGKSSDQSRGEL"
     gene            complement(79716..81833)
                     /locus_tag="CND00260"
                     /db_xref="GeneID:3257029"
     mRNA            complement(join(79716..80302,80364..80860,80926..80985,
                     81039..81094,81149..81243,81303..81388,81445..81595,
                     81686..81833))
                     /locus_tag="CND00260"
                     /product="calcium-dependent protein serine/threonine
                     phosphatase, putative"
                     /transcript_id="XM_024656935.1"
                     /db_xref="GeneID:3257029"
     CDS             complement(join(80833..80860,80926..80985,81039..81094,
                     81149..81243,81303..81388,81445..81595,81686..81737))
                     /locus_tag="CND00260"
                     /codon_start=1
                     /product="calcium-dependent protein serine/threonine
                     phosphatase, putative"
                     /protein_id="XP_024512695.1"
                     /db_xref="GeneID:3257029"
                     /translation="MGAAESSMFNSLEKNSNFSGPELMRLKKRFMKLDKDGSGSIDKD
                     EFLQIPQIANNPLAHRMIAIFDEDGSGTVDFQEFVGGLSAFSSKGGRDEKLRFAFKVY
                     DMDRDGYISNGELYLVLKQMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMV
                     ASTDIVKQMTLEDLF"
     gene            82130..82234
                     /locus_tag="CND00270"
                     /db_xref="GeneID:3257156"
     tRNA            82130..82234
                     /locus_tag="CND00270"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3257156"
     gene            complement(82503..85244)
                     /locus_tag="CND00280"
                     /db_xref="GeneID:3257426"
     mRNA            complement(join(82503..83202,83251..84441,84491..84942,
                     84996..85244))
                     /locus_tag="CND00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656936.1"
                     /db_xref="GeneID:3257426"
     CDS             complement(join(82633..83202,83251..84441,84491..84508))
                     /locus_tag="CND00280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512804.1"
                     /db_xref="GeneID:3257426"
                     /translation="MFPWVKKIKQAFDHHDSQANRKIPPLAPYGAYVDPFYASPATTV
                     RLSRSSEDNPAFPAEFQLSTPPRRPYSHGKSYSSPPGSQTSPTAPLLPYSRLPDLTST
                     KSAGPYQTYTATRNHPSGYELVDEPISTTFNISALSPTETVTSIPETPLLTPTTDAPF
                     FAPLNIDWVRSIVEQAKETSAGIPPGSSKDASLHLKNRSFTVPEITITDDNKPGTQQS
                     IYTLYDFGWLLDYIGIDRPLSHFPPSVSTKASLDPSQVKAVELFIKSARNTLARSGSK
                     MGIDNPPLTTADGVHIIDKLKKLEQFFRHDSSICTDGETTLRDDTKYNKLPPHDGPID
                     VPVSMFGNTICMSATLSSQTREKYKQPAYADSTMSPPQYKAERDITEKGDTRCIENED
                     EFVEIVLDSDKIQSAEWSIIDETTIVNDSNDTVALSESYERLVKRPRPPVPVQSIRVS
                     QWPRVFDSQYLARPTEWKPYQMEVAPLPRSSESDIAREHPRPARRQSPLLITCFILGF
                     FMPFIWIIGGWFINPSKPRPKPAFIDFETGVSFVLPSTNVEETKLPWYTHSHPMIRAC
                     RYAVIIGAPSITLMVVTFIIMFTVVH"
     gene            85410..88952
                     /locus_tag="CND00290"
                     /db_xref="GeneID:3257297"
     mRNA            join(85410..85605,85660..85790,85841..85914,85976..88952)
                     /locus_tag="CND00290"
                     /product="expressed protein"
                     /transcript_id="XM_570497.2"
                     /db_xref="GeneID:3257297"
     CDS             85983..88742
                     /locus_tag="CND00290"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570497.1"
                     /db_xref="GeneID:3257297"
                     /translation="MSAMSFDPLPSSTSSNSLRRFSLPTTLFTPIPATLFEPSRQPRS
                     SGMPQSVQLFQEKHATEFAHLYEYDDEAERERRLQQEQQVLEEARRVGRLMRESLKAK
                     TKEQLEVRVDTPFQQSNKKGRRPLSLLSDRQLEFRSPELVRVSECVTPRPVERTRLIP
                     PLKDDMEHLTPDLSTPILSDTYSPDPTIVTPDQRGLGLEFQQSSTRESIHEEPSSSLA
                     NTSFRHSTYSWASSFSGETEELRVAAHYVPPQTPQEEEQDKDHGEEVIDTPEKTKRRR
                     KRIIAIAHTVRQLEGIGSREVEDPTLYQKLAKAWNERPGFMPQEPVWAPDEQSAEERA
                     PKVSTNSGAWLAPSLANDLTQIQSHSSSNPSTLNDSQISSPFRYSFASSAHDLVDDGG
                     IERGAQILSEKAWLKTPLYGHDAFFGAHSPSNPYPNSSFQPKPRARNSGNSFEGAGSI
                     RSHDEKSEEEVKIERAEPKRTLKRIQTDISKLRAEGTFVPLKPEAEAGPSVPPIFGLG
                     FIGNYMVSVDNGRRPLEIKPEESGFQQGEDGVEIREAKKGCKQQGSIHSLSGIIPQST
                     RPVEDDSMETIDLTLAASRPASFYTTSDGRRQQRQQLTPGKTDYPFSNHSQQPDCWTP
                     STISLPQHIEYTLGPPIDLGAPVSIPDRLTMGIWQKEEAEGPETEEGEWLEDLDSYRS
                     SAICSSPSISHPSPRQSRLQVRPKSIPPTTPVKEQKHPIFPDMLNTPARRKERRNGEE
                     SEDEHRSSAKRRRQSYDRFYYRGMSAEGGEDIAAVGEDTGSVAAGITDRSEAMRAEVE
                     KGHTQSEAVAPVTQPHPTTNSDLEKGTLSPSSLPRSRTPLVFFILGFFLPLLWLVGGW
                     LLPHSSTQTPETETIPQTITHYLPQWLYHSNYTVLACRIASLASLSFLLIAGITLAIV
                     LPLTL"
     gene            complement(89050..91493)
                     /locus_tag="CND00300"
                     /db_xref="GeneID:3257308"
     mRNA            complement(join(89050..89330,89387..89500,89554..89626,
                     89677..90314,90362..91050,91098..91216,91269..91493))
                     /locus_tag="CND00300"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_570375.2"
                     /db_xref="GeneID:3257308"
     CDS             complement(join(89269..89330,89387..89500,89554..89626,
                     89677..90314,90362..91050,91098..91216,91269..91451))
                     /locus_tag="CND00300"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_570375.1"
                     /db_xref="GeneID:3257308"
                     /translation="MAPSASKQKRLAEKAAKAASKTGSSKSSVTGASTPLTSVSDDPT
                     DAAEQMKKLNLATDRSASGVLVSDPKGRDIKIDQYMLSFHGRLLIEGAEIALNYGQRY
                     GLLGENGSGKSTFLQSIADRDIEIPDHIDIYLVSGAVDPSDVNALDYIVSSAREKVER
                     LEKLAEDMSTADDVDELALDAIYEELEEMDPSTFEAKAGAILNGLGFSQQMMAKPTKD
                     MSGGWRMRVALARALFIKPHVLLLDEPTSHLDLGAVVWLEAYLSTYNHILILTSHSAD
                     FMDTVCTNIMDLTTKKKLVYYGGNYTTYVRTKSENEVNQMKAYAKQQEEIAHIKKFIA
                     SAGTYANLVKQAKSKQKIIDKMEAAGLIEKVEQPRQLRFNFEDVKKLPPPIIAFSDVA
                     FSYSGKKEDYLYQDLSFGIDMDSRIAIVGDNGTGKSTLLNLITGALQPVEGTINKHTQ
                     LKLAKYSQHSADQLPYDKSPVEHIASLYSEKFPDKDIQFWRQQIGRFGITGAHQTSPI
                     NQLSDGLRNRVVFAILAMEHPHIILLDEPTNHLDMASIDALAAAIKEFEGGVVIVSHD
                     FRLISQVAEDLWEVKDKKVINLTKQDISIVDYKKALAKRSQAQIEKARLISKSATKGV
                     A"
     gene            95077..96033
                     /locus_tag="CND00310"
                     /db_xref="GeneID:3256995"
     mRNA            join(95077..95734,95797..96033)
                     /locus_tag="CND00310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570331.2"
                     /db_xref="GeneID:3256995"
     CDS             join(95120..95734,95797..96003)
                     /locus_tag="CND00310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570331.2"
                     /db_xref="GeneID:3256995"
                     /translation="MSQDIPEEDVSRILFHLQLPPSDFLPLPPLQFLRAYLHLLPPSL
                     LEPFAIIPPKTRTLIPSIKRRRLIHSTTHPSFLTASQGRLRWPLLWERMGGDPFAPIS
                     ESAEEEAAWAESSFMKGTAGNQQVRKLGGFLRLMEEEREAEDVRAAKRMERRLDQEGE
                     EFEEESDEEEERFGANQRPQMAEDQQEVELAFEKRLLELFLDGLDTIDYSPIDFVDPP
                     GGDPIAQRDAEDRYFDDEEPSQTPNGTTQGEGLRGREMMVDEDKTAQNGQGDYDY"
     gene            complement(96291..97544)
                     /locus_tag="CND00320"
                     /db_xref="GeneID:3257306"
     mRNA            complement(join(96291..96631,96708..96774,96854..96936,
                     97042..97544))
                     /locus_tag="CND00320"
                     /product="expressed protein"
                     /transcript_id="XM_570372.2"
                     /db_xref="GeneID:3257306"
     CDS             complement(join(96449..96631,96708..96774,96854..96936,
                     97042..97419))
                     /locus_tag="CND00320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570372.1"
                     /db_xref="GeneID:3257306"
                     /translation="MLSPKLRTITAGFLLLATVGSSTFAMLQPEAYNRSSTSSDSIDN
                     RKDHSQVSFSGNGDKVRGEGNAGGLTREEGSLVDVILGSGGSRDHDVNVGVDVTTGPT
                     VADMLTTERTASLWWSYARDSVEIAKRLESKLKSSTVLVPVDKAILALEKKPHQSPGQ
                     TPEDAALKFISAHIIDGTPREGTLPTLLPNFSVEFVKDESAKGGWRVRPGDVEVLAEK
                     DGVNGRVMYLAEVLPFLN"
     gene            complement(97632..97719)
                     /locus_tag="CND00330"
                     /db_xref="GeneID:3257150"
     tRNA            complement(97632..97719)
                     /locus_tag="CND00330"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:3257150"
     gene            97871..99913
                     /locus_tag="CND00340"
                     /db_xref="GeneID:3257304"
     mRNA            join(97871..97960,98096..98191,98305..99913)
                     /locus_tag="CND00340"
                     /product="expressed protein"
                     /transcript_id="XM_570369.2"
                     /db_xref="GeneID:3257304"
     CDS             join(97932..97960,98096..98191,98305..98401)
                     /locus_tag="CND00340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570369.1"
                     /db_xref="GeneID:3257304"
                     /translation="MSSTWREFMSWNKYTSIASRALRQALNETDRVAAEKRAIIGVRY
                     QLWENGQSGESNYVVPPPKEAKTSGKPSV"
     gene            complement(100573..102186)
                     /locus_tag="CND00350"
                     /db_xref="GeneID:3257342"
     mRNA            complement(join(100573..101142,101198..101483,
                     101538..101646,101704..101818,101878..102186))
                     /locus_tag="CND00350"
                     /product="low-affinity zinc ion transporter, putative"
                     /transcript_id="XM_570392.2"
                     /db_xref="GeneID:3257342"
     CDS             complement(join(100710..101142,101198..101483,
                     101538..101646,101704..101818,101878..102044))
                     /locus_tag="CND00350"
                     /codon_start=1
                     /product="low-affinity zinc ion transporter, putative"
                     /protein_id="XP_570392.1"
                     /db_xref="GeneID:3257342"
                     /translation="MSDDAADVDACAIDNSESHFGLRIGSIFIILVTSVIGTVLPIIL
                     RQSSFVPRPVFDFAKYFGSGVIIATAFIHLLAPAWEELTSECLSGAWEDYDWAPAIVM
                     AAVYFIFFAEVAAYRAGTRRLQRLGINYSSHAHDETDAHAHTHDHEPPLGVDVTAPAP
                     DHHIHPDHSNITSHPHGHHRTSSGEKGKDAESASDVSTVNQLPSQAEAAAQLIAVAVL
                     EFGVVLHSVIIGLTLAVDESFVTLFIVIIFHQMFEGLGLGSRLSILTLPENLWWTRYA
                     AAIFYSLCTPVGVAIGLGVRSTYNGNGAKANIISGVLDATSAGILLYTGLVELLAHEV
                     LLNPRMMKSSNSKLAYVFCCMLLGSGLMALLGRWA"
     gene            106390..109418
                     /locus_tag="CND00370"
                     /db_xref="GeneID:3257317"
     mRNA            join(106390..106541,106597..106863,106924..107128,
                     107184..107269,107325..107775,107835..107924,
                     107981..108037,108094..108208,108274..108469,
                     108517..109085,109142..109418)
                     /locus_tag="CND00370"
                     /product="transcription factor, putative"
                     /transcript_id="XM_570381.2"
                     /db_xref="GeneID:3257317"
     CDS             join(106498..106541,106597..106863,106924..107128,
                     107184..107269,107325..107775,107835..107924,
                     107981..108037,108094..108208,108274..108469,
                     108517..109085,109142..109143)
                     /locus_tag="CND00370"
                     /codon_start=1
                     /product="transcription factor, putative"
                     /protein_id="XP_570381.1"
                     /db_xref="GeneID:3257317"
                     /translation="MYTTACEACRKVRMKCIRPSRGYDMSEICERCRSTGIECITVKR
                     RVGRQPGVKNRKRKADSISEQTGASSASNSEAQIPRDVDHLPNPLHVLASEAIRRHFT
                     PEAEEATAQDSYHIRSSKSIFHRYSDWAEKIQPEGGKEAIMRRLDSLLSKKPIEMSSD
                     VDEPSVFCGRIDMARPDASPEHDVISLQIVSLAEAQHLFDSFMELITNGSMYFDPRLH
                     TLAFVRSRSSFLLAVILAIASTYKSICPSARLHTLLMNHAHRLEAVVRNNHLKSIEII
                     QGLLLLASWMEIPSTLARDKTWMFVSYALALVVELRLDTALPYCVQTDPLYDKSNHDL
                     LVRNAHRVCFLMYIHDRNMAMVAGRHPIFRDSALVSPDSLAKWGKHPLAHRFDAAICA
                     SVSLRKLVTSAHARLSTQNYPDFASGEEYIDRSMAEWRRRWSYEIQSTHEYDIIARFS
                     AFVLALTLVKKRQLTGQIEREARRACEVLAFDVVCAAIHHYKTWKGLLNSATFDTSMV
                     AFCAIYTIQSINHSASPYLSDLSLLRLATVHELIGELETQAEARHTVDIPGYFSVVDA
                     MARQLSRNMRLLLSKKEIYQAPHSETSETHSSTYNPHTNFIHTHPHLHHLQDPHHYTN
                     NQFPQFDEVAQFMFTADDGGLPFMGDWGLEGLLPDMDFGIDTGYSGSESGGTSHEMTQ
                     GVNMQHMLNLG"
     gene            110375..113034
                     /locus_tag="CND00380"
                     /db_xref="GeneID:3257323"
     mRNA            join(110375..111176,111217..111483,111535..111996,
                     112048..112198,112258..112275,112350..112467,
                     112545..112622,112686..113034)
                     /locus_tag="CND00380"
                     /product="glucosidase, putative"
                     /transcript_id="XM_024656937.1"
                     /db_xref="GeneID:3257323"
     CDS             join(110440..111176,111217..111483,111535..111996,
                     112048..112198,112258..112275,112350..112467,
                     112545..112622,112686..112726)
                     /locus_tag="CND00380"
                     /codon_start=1
                     /product="glucosidase, putative"
                     /protein_id="XP_024512712.1"
                     /db_xref="GeneID:3257323"
                     /translation="MRSSQRQGREPLLQSAENPGQSQRLSDSSFTSFDHPGMSHRGSH
                     NDASVNSYGSSSSNRFGPTASLASANSAAVVAGNTGGFSDELPRQASPQAQMGNWHDV
                     DDLDDHLHTFTSQDHKDLGSPFDITSVRGWANALTLGILAGGGVMLFAGYPIISFYYG
                     DSNSSGANTSGYNLGGINSSGQYPEIPGLPTLIDADTPEWAYKRTGFDGDEWTLVFSD
                     EFNKDGRTFFEGDDPFWTGMDIHYWPTGDFEWLDPSAVTTADGHLVITMTQEPIHDLN
                     FKSGMLQTWNKLCFNKHAYFEFSASMPGQTMNGGFWPGIWTMGNLGRPGYGASTEGMW
                     PYTYDSCDVGTLPNQTYVNGTGPIATLTTGADDSPLSYLPGQRCSACTCPGEDHPGPV
                     HTKGRAAPEIDIVEAQIIISESRGEVSQSFQVAPYDDYYQSDNSSKNFKHYDTDLTYW
                     NTYLGGHFQQAVSSLTRLPRNIYWDQPGDSKQFTVFAMEYQAFPEARDQGYITWWADN
                     KTSWTMYADAVAENPRTGIGRRIIPEEPMAMIVNLHMSNNFQAVDFANLKWPNYFRID
                     YVRVYQKPDQISIGCDPEDYPTADYIARHAEVYSNPNLTTWGAAGYTFPKSSMKGDC"
     gene            114499..117205
                     /locus_tag="CND00390"
                     /db_xref="GeneID:3257030"
     mRNA            join(114499..115496,115550..115731,115785..116313,
                     116367..116437,116490..116675,116750..116849,
                     116908..117205)
                     /locus_tag="CND00390"
                     /product="multidrug efflux pump, putative"
                     /transcript_id="XM_570327.2"
                     /db_xref="GeneID:3257030"
     CDS             join(114802..115496,115550..115731,115785..116313,
                     116367..116437,116490..116675,116750..116849,
                     116908..117109)
                     /locus_tag="CND00390"
                     /codon_start=1
                     /product="multidrug efflux pump, putative"
                     /protein_id="XP_570327.1"
                     /db_xref="GeneID:3257030"
                     /translation="MSTHHTNQIHDHSPSSPSNQPVLEEGEDEYRPLPHAWSGATLYE
                     PYTLSRDKLKNVNSVEFCSQVNERESEESGEVQGNVGLTREVPNSVFVEPQEDYIPYS
                     SGKGPNKRSDLPHLYYDSPWPESANDSSPGPAHNARDGDQNEKLGGLNASTIPNFSSS
                     GNASLPPLTSSQSYLQSRSSFFRLVFLLTTCATQLIVQAQLGMVMMPLHATAEWLGKA
                     NNSGEMSWMAASYGLTVGMFLVMAGRLGDIYGPRLIWAVGCTFMIVCNIGSGFATTAI
                     GFDIARAVAGIGSALALPNALAILGRTYPPGQTRNMVFSILGALAPVGFWIGGVLGGL
                     FAQFAHIKWVWWFTAILTALFLGVGFYVLPPDSLCPSVSKPHFDTVGAILLSLTLGLF
                     NFVWNQAPLVSWSAAYIPAMLGVSLIFGGIFVWWERRVGKGALIPMEVLSKQSLLVYL
                     SLWLGWMSYGTFLLYTMFFIYGIRGYTEPLTMAFQLAPLLPAGVIAALIVPLLIRHLP
                     NHFIFLLSMFAFIACNIIAATASSSTANGEYWKGTFWSLIIGTFGPDLSFSTGQLIVS
                     NSVSHEFQGIAAGVVSMITNYSIAIGLGLTGTLEYYIRGSGDTIDDVLRGYRASFWFA
                     TGLAGIAGIVVALFVRVPKQTGGLQVIHPV"
     gene            117679..120453
                     /locus_tag="CND00400"
                     /db_xref="GeneID:3257185"
     mRNA            join(117679..118020,118067..118255,118306..118919,
                     118968..119051,119104..119405,119452..119681,
                     119744..120453)
                     /locus_tag="CND00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656938.1"
                     /db_xref="GeneID:3257185"
     CDS             join(117727..118020,118067..118255,118306..118919,
                     118968..119051,119104..119405,119452..119681,
                     119744..120397)
                     /locus_tag="CND00400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512694.1"
                     /db_xref="GeneID:3257185"
                     /translation="MAEQTQVIPLLSSLQFTHPSFVPLLESHKPLARPSISSQSQLNK
                     LISRLNTVLLAKDDSREKRAACIVAKEMINQDEEGWVLAGWGKGWLGGCLGWIASTSS
                     PIPSIPPYISLLSTLVLTSSHFPSFERQNVHPIMGKLSVSLGRLLQRCLAEPQPDWDV
                     MLDILDSYQSLLLHSPANFRPSTATLKPILLALLLMIPTPTSPNPSIPAEIRTASAKL
                     LACCHVTAGKAQSPASWTADVKDLLGGIGKAAAGITADAWEADPVAVNPPPSPNTPEL
                     PIDPLQRVPVALDWLEGLTEAVLEMLRFPTNRPVHVPVAGIVSAGLRFLSLTLDTPTV
                     SYISPQHHALLVASLPRIWSIGMQLLGGIALAVEDHLFPHLSNILDHSVWLLERIPSS
                     MSECRTQLLKFHTLLLTLFPPSLVPTDYPTRLLRFCISTFSPLLERKDVSASAAASQN
                     ESGGGKRGKKRARNAEDGLVGDLEGKGRQSLGAGEVKVILQALKLSPILHTTPLISPS
                     LLTLSIRLHLSLYLALPSLFSSVFPSINAKSETLEAVQKVLESVLSVGEGWSKGYESV
                     IISVLSHKSQSSIDKIIHPKLPPMLRAQPALRELHFFTKEGDEEKKERKLARLGIDDE
                     DIEVEKEEEEEAVRPPPTQVTSTTGFASFALPATREVPSSMPLAASAPLVPIAAPVAA
                     PSVAPAPSAAFVLDSTSAPATATAPVVAPIPSQPEQTTSTIPSSSFISFTSNLASATT
                     NSKTNETVVKQTTHVEKMEVDDEDEGIPELDSGSDDDLLEDDDGEEDD"
     gene            complement(120644..122305)
                     /locus_tag="CND00410"
                     /db_xref="GeneID:3257321"
     mRNA            complement(join(120644..121418,121492..122305))
                     /locus_tag="CND00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656939.1"
                     /db_xref="GeneID:3257321"
     CDS             complement(121496..122293)
                     /locus_tag="CND00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512806.1"
                     /db_xref="GeneID:3257321"
                     /translation="MAMPLPASHTKHLELLFHPLPQDPSVILPLKQISSSGSTSIGTT
                     GTTLWLSAQVLSSYLSSLPSSMSEKALRVIELGAGIGYTSLVLASLGYQVTSTDIEPV
                     FSSVLAPNLETGKDRLVRSRLPCNVYARKLDWTDISRLQQGEKSVKELEWVAEGWDMV
                     VMTDTFYAPQILEPLWDTLIYLSSNSKSPPSPPKEEKEKEKRPPIYIALEARDPVFIS
                     RALEIGRQKGFELKKIAVRRVARDVERWGWSREDWEGIDVWKGRWKG"
     gene            122446..124337
                     /locus_tag="CND00420"
                     /db_xref="GeneID:3257325"
     mRNA            join(122446..122813,122861..122960,123002..123311,
                     123360..124009,124073..124337)
                     /locus_tag="CND00420"
                     /product="expressed protein"
                     /transcript_id="XM_570383.1"
                     /db_xref="GeneID:3257325"
     CDS             join(122451..122813,122861..122960,123002..123311,
                     123360..124009,124073..124281)
                     /locus_tag="CND00420"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570383.1"
                     /db_xref="GeneID:3257325"
                     /translation="MSVPSYIALSLPPSAIHIPSPSATNISASATSSNAKPHLPFPPS
                     SAPRGKPTGSTLGMSLPSLSTNVSDMLLSSLLPPNLPKLPSGGARGIDGGGPRQLTTQ
                     REGLTVPLLSNNFRRFVTRVGPVFWLQDRIEEVLYWRKPVWTWGWMLTWVFICFQPRV
                     LLLLPSLALIVLLLHIHERTHPVPSLIGIISPPPLATARVHPESSTGDSSPDRSYTAT
                     TTRDESGETVGVPVVPPKEAESGVDYFMNIQAIQNLMGLVSDAYDYLAPILSNLQSPN
                     TSSPTCFPLTHTHIILLLLPPTLFLPLVPSWLIPYVILPLGLLPPLGFHPNLTPWLLS
                     LPRHPSIRKTKSVLEKWILTDKLPDKYSGHKISQVYVWENERLDPKLASSSSSFTGPI
                     PTTSWSARFLRQGDRRAWIKISDVAEGEECLWKSVDDTGLPNGDDESEVEAKVLALKD
                     GWEWLPEDWKVDVNGLWSENGVDEEGWLYTDDSWQNPSPTPYTEPDLPANSASIPGQL
                     VQSVQTGKEKDMPGLGLRRVTRRRRWWKRVYKVDS"
     gene            complement(123285..125255)
                     /locus_tag="CND00430"
                     /db_xref="GeneID:3256857"
     mRNA            complement(join(123285..124535,124625..124699,
                     124786..124825,124901..124943,125021..125255))
                     /locus_tag="CND00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_570323.2"
                     /db_xref="GeneID:3256857"
     CDS             complement(join(124483..124535,124625..124699,
                     124786..124825,124901..124943,125021..125121))
                     /locus_tag="CND00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570323.1"
                     /db_xref="GeneID:3256857"
                     /translation="MASSSDYLGYAYASLLTIGGVMGGIRKGSVISAVAGVGSGIAAA
                     YGANRVSKDPLDVIPSLSVSAVLLTLMSWRLYKTRKFMPAGLVVTLSLLMTVRYALLL
                     A"
     gene            complement(125326..127806)
                     /locus_tag="CND00440"
                     /db_xref="GeneID:3256883"
     mRNA            complement(join(125326..125967,126021..126364,
                     126410..126472,126524..126946,127001..127261,
                     127309..127396,127450..127806))
                     /locus_tag="CND00440"
                     /product="aflatoxin efflux pump AFLT, putative"
                     /transcript_id="XM_570321.1"
                     /db_xref="GeneID:3256883"
     CDS             complement(join(125540..125967,126021..126364,
                     126410..126472,126524..126946,127001..127261,
                     127309..127396,127450..127741))
                     /locus_tag="CND00440"
                     /codon_start=1
                     /product="aflatoxin efflux pump AFLT, putative"
                     /protein_id="XP_570321.1"
                     /db_xref="GeneID:3256883"
                     /translation="MALSEHSAMVSPTTTISVDGDREKRFSVEEDPLPTASAAIPSSA
                     VANTPDDQSSVQGTGGQTPPKGHSGFTAPLEIPKWRFMAIFGSLMISVFLFALDQLIV
                     ATAIPKITAEFNSLTQLSWLTSGFFLTLLSFNLLYSQLMNIFPSKHVIVFAVFIFEMG
                     SLACGVAPNMNVLIFGRALAGAGAAGIFSGGMVIIAELTPLHSRAQYFALFGVCFAIA
                     SVIGPLIGGAFSDHVSWRWCFYINLPLGGVAIGCLLFFQPSRPPLGRESSYKGYSKAM
                     LKQLLMCDWVGVVLSMAWAVCFILATQWGGVTRSWDSASVIVTLVFAGVLPIAFCVYE
                     YFIKESISYFRIRLFKRRTVAGAAIVSFCVFGIFMILVYYLSLTFQAVHGTSATSAGV
                     KLLPLILVQVFILILTSRIIPRIGRFKPVICVGPVFLAIASGLFYSTDYSTPIANLYG
                     YQVILAVGIGCCLQNVMVAVQHDLKKEPWLISLGTGLVVFTGFAGRIVALSMSGSVFE
                     NMIQRHLKSMVPGISEEIISAVVNDATAVWTSVPEDLREPVLRAYTKTLSQVFIIGLP
                     LSIIALVGALVMKNDKMATKEEEEKGIADARAAQQAKKDEEAGVNGVNERSEEGARGS
                     AEDEEGRA"
     gene            complement(128688..131261)
                     /locus_tag="CND00450"
                     /db_xref="GeneID:3257261"
     mRNA            complement(join(128688..128973,129022..129121,
                     129174..129421,129473..129835,129889..130054,
                     130109..130239,130285..130335,130382..131261))
                     /locus_tag="CND00450"
                     /product="MFS transporter, putative"
                     /transcript_id="XM_024656940.1"
                     /db_xref="GeneID:3257261"
     CDS             complement(join(128760..128973,129022..129121,
                     129174..129421,129473..129835,129889..130054,
                     130109..130239,130285..130335,130382..131028))
                     /locus_tag="CND00450"
                     /codon_start=1
                     /product="MFS transporter, putative"
                     /protein_id="XP_024512692.1"
                     /db_xref="GeneID:3257261"
                     /translation="MADPFESHLCSYVSLISTTYTMNVRETRSSSASPPPMIQSPITQ
                     NEPRQDTVDSATETANVDQYKRVESEQTLCDKSGTVSPKTEKFFSYHQKSSGDMREHR
                     IEEDTGPQFLGAYEQEQPSTPEHDRQASSDILHCQLSRPQGDDIELGPEPEREAVQWI
                     EGQSSFVRFCFITCCCTTQLIVQGQLGMVMIPLHYIGDYLGTTDNGQLNWMVASYGLT
                     IGMFLVASGRLGDLYGPKLIWVLGFIVLMSANIGTGFCKSPIPFDICRALTGVGSAMC
                     LPNALAILGRTYPPGKVRNVTFAILGALAPAGWCISGGVASLFAQFVDVRWIWWFVAI
                     FIAAFLAIGLYILPPDQNLPPRSERHFDIPGAVLLALALGLFNFCWNQASVVGWETVY
                     VYVLLIVSIVTFVAFFLWERRIGRKALVPLEILTRKNLLVYLSLWLGWMSFGTFLLYT
                     TLFIHDIRGYTLPLTMTAQTTPFVFGGVTAALSVPFLIHRLPGHVIFFIAMCAFMIGN
                     ILAATAPVDGTYWGNTFFSILIGVFGPDLSFATGQLIVSNSVDVEFQGIAAGLVSMIT
                     NYSNSIGLGLTGTVERYVRGPENLSQSDLLYGYRVSFYFGTALAAMAVIVVGLFVRMP
                     TEGKRLDDERKKAEH"
     gene            complement(131369..137974)
                     /locus_tag="CND00460"
                     /db_xref="GeneID:3257299"
     mRNA            complement(join(131369..131753,131804..132116,
                     132166..132261,132310..132615,132666..133292,
                     133345..133493,133543..134335,134387..134511,
                     134565..134930,134985..135611,135662..136536,
                     136585..137384,137432..137575,137624..137772,
                     137818..137974))
                     /locus_tag="CND00460"
                     /product="nucleolus protein, putative"
                     /transcript_id="XM_570368.2"
                     /db_xref="GeneID:3257299"
     CDS             complement(join(131431..131753,131804..132116,
                     132166..132261,132310..132615,132666..133292,
                     133345..133493,133543..134335,134387..134511,
                     134565..134930,134985..135611,135662..136536,
                     136585..137384,137432..137575,137624..137772,
                     137818..137950))
                     /locus_tag="CND00460"
                     /codon_start=1
                     /product="nucleolus protein, putative"
                     /protein_id="XP_570368.1"
                     /db_xref="GeneID:3257299"
                     /translation="MAPKRKWQEGQEDALPTIIRAKPGTKAFASGKSVKDALATGSPQ
                     AFVSFRQQIVTPYSELPLSINHPTVIILQHYLDISPACDEIFRAWQVGEQTKSEQQVH
                     AAVELLSEIIQVLTPVPFFRSIVIGLVNKVISPSEPYHDHINHLIQSGKRDDVYHGLL
                     LSAVSMSVDPPSTSSMSGRLGMKFWNTLVEGGSVRGFGKQMGMRRRNKEGMVGYGDRD
                     PLDKPDIRHLILRIILPLFPSPSFQPHAKIILPPLYSNLAADPPITVLRILTALWAAI
                     SSPSFGLNRRVSLVLFQERSIEALWGQLGRDDVEGKSGKKVGELVRAFLEGITATPGK
                     GVCFPDEGWYPRRMDDSKEGDNKVGDGGDTWRKGLHNRILGNVVRKVGNKVVDDEGIV
                     GEWMIEVFRACPELVSGYWAHSALSLEPRLNVRWMATMSYVGRIISLPIPPLQTFRQP
                     VPAGTDPSFSPFRTAPPQASTIVESVLPAPFTKSHLMKGLQHTEGIVQHMTAVTLSRA
                     LAKLGQVQELFSFIESELYPNGQPDNPWARRQRELEMEVRKRLPELAVIVAFAQKSAQ
                     LAPAEPDPDSEEDRALVTKSAMLTELALRIFSLCNRTLPSMASELKFDVGRLLVSSSS
                     AKQEKKEKQQAREGSVIGDDVQSVKSIGTVGSKGTIGMRGGFGQSRGEVEGFEALSQV
                     HVLELLGEVRDWNWSNKAAGSQYTYLYHILLLHLSTPQSVTYSKTTALLSHLLLPTLL
                     FEHDPEELPIWLDAMPKKVREAGPMLFAQQIQLLAFLDDCFRRCLKTPYRYIEDTLAL
                     SPSSTPDLQSNSKEMVSPLMMTILEQLSAKLMGQLISTEAACIIVNYLRRVVLGLVGK
                     QRELSWLLAVLNRLEECVKKAKEAGQERKGLEECVQVIKGDFDVIRGKSEPTDEQDPS
                     LPQLLDHREWSSSSFEYQALFIGRPSTLSSLIFLIERKDASILLHVNFLIHLNILQPS
                     STSAIKNQDSTQAVLILFARSLENLEGASKWQDQIKRNVFGDLGSRKLLFSEDGHEFR
                     DSLNTLIRHLIFGKSTDEEIAQGFVDGCVELLDNDKEGKKVDQNLSLLAPWVRFLTPS
                     QASQISQILFRYKNPVLFSHALLLSDIITSTKSPAFAVEHLGKLGELGVVGAVIRLVD
                     DAVKDRKSSEELTSLKIKRETIQLLLNLASNDSISLLVRLIQANSSAAEVTSSALQED
                     EALTNDRRLLPVAEALFVLGLDVGKASIIGGVALETIASEQDEKVQGAAIEVLVRLAE
                     SASNEIVEILSTVQLSSFNSTFMRFMERLAHICGTKIELLESICHLIGLGLQYAVRLC
                     SNLKDMNEESATALKSLEQSIEVVDQDRLQLQVALVEPVITAVIQDRLEIAEAVGLAT
                     LLAVRVELKASFLRQQLQAIYASTTYTRCTNSSCPPHIRLHFIRLLHRLFASSTYVSC
                     QPPFIEPLILLYRGTTSEVDRRVLHMLQLFEGYRKISLASVMRYWNASGVLGIGGKSL
                     DALTSLDPQKTFATCQAYPLHRKLRGWGKIATDPEEGEELYDPVFVMGLFIASMHEGM
                     RGLDWVEVLRSNVLGLTVCGLSSRDREVRSVASYALAKTMSLIETTGFFERAQLIYTL
                     RLLRHALPTSTSRLPVLSTLFFAYALRSLANPSHFFYPLSSRFLLQRSVFDSEDTPLL
                     YGMLYANGEGWKRERSWMVRFLKEGVRSEADWRVIRRRKVWSLMATLFIESLDPVFRR
                     SILQTMSSILLIPAAASSLVLRDGLFVWLDMQWTTISAYHASLPISSKSGVRGQRAQA
                     WEQEEKNLLLEIAERACKAIASAEKERVKEGKDLRGWTKQLEAFLTTVLSDADGEKLE
                     VASKILYSVSQIPVDTTTTELLPLFVDRLSSTGPVASALPNIISCLFAAGLNVKPTDV
                     REKDDLAKALGEVRWRVEQGDAGNYLKGWVRRERQLTERMN"
     gene            138150..141653
                     /locus_tag="CND00470"
                     /db_xref="GeneID:3257102"
     mRNA            join(138150..138519,138568..138631,138685..138884,
                     138948..139109,139158..141653)
                     /locus_tag="CND00470"
                     /product="expressed protein"
                     /transcript_id="XM_024656941.1"
                     /db_xref="GeneID:3257102"
     CDS             join(138702..138884,138948..139109,139158..141413)
                     /locus_tag="CND00470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512707.1"
                     /db_xref="GeneID:3257102"
                     /translation="MSPSFAGYLQPLGSNGYNAPVPSPPQVTGHFNSASSEDKENIPS
                     QPTFRARDWQEKRNNLQEAGFATLKIETLVPSNIGRKKKDIANVKRKPVSSVYEEGKN
                     GGVTSVSSSNPLNAATFSSAINSSTPSLLTVAPQNQLEMIQLTDSAVFPRQVVPSYSP
                     INNDMPFVAPLPDSCSETTLTSILNACVFSSDDEFSEENIPARDALPGGLGSGLVNES
                     IQSLDAMIEQQYQESGVTRESHNSFDTEANNSDRSKELDSPKEKAKRNKHHSKICSNR
                     SYNSSILARRSSLKSSMYTGIEFNQEAASPTNENTEGNGCYTTESDTCSNNKTVLFAT
                     PAYQFDYFQWSRKQPLKMNEILKGDETVTDHQSYPTTSDDDVYYAALTSEKRSAMIHE
                     ITTQLATKLTSDGANTNVNMAEPFNPPCHSSIQALNPENSSPMSSFYASNHHTASAAT
                     VPPSHHQSAIRRNFDGRSLAVRYAQRHPFLLEGDNVPHDDDDSSSADIRPSANSNSDV
                     ENGRPHKRTKERWLSVCLVMGFVMPLAWVVGGWFISGVDKETEKQLVGRAALELDDDP
                     SSQQSDLNGPHTDDVPRNNRNSHNNESIDSQATRLGPSDEPELDLWTPRINLTTSAAN
                     VTASFPAQYRPFTSMPNLFMPSPPTAITRNSISSPNLLGLYEPPQPPMPVSESGTLES
                     SILPVPVHSFTSKDMSATPSPTPTLVNLSPTNFTRHWNPNYGHRPTPYPVTLSGSNLT
                     CVPAGPGHPVLPSHYLYHLSVNDPASSKLAPPAPTGRPSFVSNPAWLLDRCASMRTEY
                     PNGKNTARFWKNSLARKKMRAWLPGAHPHPLVRANRWMMAFAFLLGCLTAICFMLVGI
                     KSKMNQARVG"
     gene            complement(141599..143516)
                     /locus_tag="CND00480"
                     /db_xref="GeneID:3257341"
     mRNA            complement(join(141599..142207,142327..142501,
                     142578..142667,142734..142772,142840..143001,
                     143087..143354,143425..143516))
                     /locus_tag="CND00480"
                     /product="protein phosphatase inhibitor, putative"
                     /transcript_id="XM_024656942.1"
                     /db_xref="GeneID:3257341"
     CDS             complement(join(141765..142207,142327..142501,
                     142578..142667,142734..142772,142840..143001,
                     143087..143284))
                     /locus_tag="CND00480"
                     /codon_start=1
                     /product="protein phosphatase inhibitor, putative"
                     /protein_id="XP_024512717.1"
                     /db_xref="GeneID:3257341"
                     /translation="MSSTSQTTNARLSRLPRKPPRPFISAHHRPPTRNHTTTDNIFRV
                     LLISSGSVASIKIPNIVEELVKVGNIDIQIIATKASTHFYSQEDVDKSVQSALNLSDE
                     EMQDDVGVRIWTDEDEWSDWKKVGDPILHIELRRWADIVVVAPCSADLLAKISCGLCD
                     TLASSFLRALSSSTPVVICPAMNTHMYQHRLTAKHLAVVQDELGYLVSGPQGAGRLAC
                     GDDGPGKMTDWHDIVSLIQGFATMHQTQVSLASLTFPSLSMPYPSASASPSDTFIDTP
                     SPPPASADTSTYNLPHRFPCGASSNLPQQREKEKGIGEHPTMVVPLPDPHPLSTEAAL
                     NGEKMPASVYAKNVDWEKLANDGGLWHRKWWLGV"
     gene            144044..147372
                     /locus_tag="CND00490"
                     /db_xref="GeneID:3256950"
     mRNA            join(144044..144141,144569..144736,145778..146117,
                     146179..146463,146524..147372)
                     /locus_tag="CND00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656943.1"
                     /db_xref="GeneID:3256950"
     CDS             join(144089..144141,144569..144736,145778..146117,
                     146179..146463,146524..147300)
                     /locus_tag="CND00490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512690.1"
                     /db_xref="GeneID:3256950"
                     /translation="MATDNSRFPPVTGSTVHPTSSMRDLPKGATGSPDADGDRDRETA
                     EAVSVHDQQQLPTPVTANSSRGKSRRRKDVQEADDGEHKDKRRRLTKSKPLPLAVPQT
                     TSPSKEPGSGSGSGPSTGESSQSQTSNKKVGHPASSANAAANPPVGFAASREARREEG
                     YDIYGAVPSPVVMGFDFKTIDGEQLKTVRDTLSIKEQQQALIAARRREAAGSSAVPPG
                     TPKESSREPSTYKAWKPSEAPSLSGAVLPTSGGVGRRREKIKDKVEKMSIMTGVSDKD
                     VVPASKSAPLDQRLITQQANFEPPSGSQTALPPKVLPSFSSSFHYLSDPRTAPISHSR
                     TGADAGAPGGGERERSDGHEFARQQQQGYYWRTESRGGPPMGSGRNFTVPGAFPPRFD
                     GPLSPPPPPPLTRPSTQPHSHTHTHTHTHSHTGSPPSSPLQPLSIPSREAFLHPFNAL
                     YDSLSSSTTLQHHLSDLVSRVSNLHAEQGVAVQEFRNTAGAAERLLTSLQQSADSLRE
                     MVRYEIERKAREDRREMEELKERLRRLEEREK"
     gene            complement(147850..149514)
                     /locus_tag="CND00500"
                     /db_xref="GeneID:3257340"
     mRNA            complement(join(147850..148030,148080..148473,
                     148533..148650,148706..149150,149214..149366,
                     149425..149514))
                     /locus_tag="CND00500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656944.1"
                     /db_xref="GeneID:3257340"
     CDS             complement(join(147915..148030,148080..148473,
                     148533..148650,148706..149121))
                     /locus_tag="CND00500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512716.1"
                     /db_xref="GeneID:3257340"
                     /translation="MYIKKWICKQASSYYLAHLHSFQTLQFIILYTMTKPASLTYLEA
                     STPLEEIYKVIERDGGVIIRNFLSSELLQEAMSSIEPHFAVRGNYESKSTHQELGEDF
                     FPSGSLRIYGLLGKIPQVITKIVRLPTWQGVMARFLNDEYSSYTGEKLIPQKSGYMLA
                     STAALRLVPGAQKQPLHRDQIAYQIRPDPTNPLFTPMVGCLIAGSKCTKKNGATAVIP
                     GSHLWGPDRAPHVEECTYAEMEAGDALFTLGSCYHGAGENQCEKSDPDALRTLFAVFG
                     QRDYFRQDQEEILSTPLELARTFPEDILRIAGYYKAVGGVGYVEDHQDPVEFLKAGSS
                     LGQFAPIPSKSYV"
     gene            149604..152792
                     /locus_tag="CND00510"
                     /db_xref="GeneID:3257326"
     mRNA            join(149604..150364,150422..150466,150520..150623,
                     150678..150837,150901..150988,151063..151326,
                     151382..151423,151492..151665,151727..151852,
                     151915..152134,152202..152592,152647..152792)
                     /locus_tag="CND00510"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_024656945.1"
                     /db_xref="GeneID:3257326"
     CDS             join(150106..150364,150422..150466,150520..150623,
                     150678..150837,150901..150988,151063..151326,
                     151382..151423,151492..151665,151727..151852,
                     151915..152134,152202..152390)
                     /locus_tag="CND00510"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_024512713.1"
                     /db_xref="GeneID:3257326"
                     /translation="MGSDSPKAYEMEDYDPKVAGSVDQTEIHINETGEGDIMRARVLD
                     SVNHRKLNARQIQLSSIAGAIGAALFVAIGSGVTAGPVALLIGFIFWATVVYSIAQCQ
                     LEIVSLFPLDGSFIRLAGRMVDPALGTMVGYNHFFAQTSFVIFEATVVNTLVSYWGYS
                     ESPAILISVSLLLYLAINVYRADLFGEAEFWLALGKVLLAIGLILYTLITMVGGNPLK
                     DRFGFRYWKDPGPWAGDSPSTRLESFINAVNTAGFCIGGPEYISMIAGEATDPRKTVP
                     RAFKTIMARLVVFFIGGALCVGILVPYNDPTLVAGDGTYAGGSPYVISMNRLKIPVLP
                     SIVTAALLTCIVSGGNAYTFNASRSLHALALDGKAPAVLRRLNKKGVPYLAVIVVMLF
                     SCLAYLALGSTSAKVLNWILNFCTAATMLNWCVMAFTYVRFYSAMKVQNIDRKEFLPV
                     YSKFQPFAGYWALCWACLFIWLQGYSVFLKGNWNVATFIFNYGIIALAGAIGLFFKIY
                     ERTPFHKSKDVDLHSDLDFFDALNQYYQQKKDDSPPANVKDKIMAKLF"
     gene            complement(153574..156518)
                     /locus_tag="CND00520"
                     /pseudo
                     /db_xref="GeneID:3257180"
     gene            154014..156624
                     /locus_tag="CND00530"
                     /db_xref="GeneID:3257142"
     mRNA            join(154014..154101,154167..154204,154257..154412,
                     154466..154668,154729..155073,155133..155228,
                     155280..155414,155470..156284,156346..156624)
                     /locus_tag="CND00530"
                     /product="urea transporter, putative"
                     /transcript_id="XM_570315.1"
                     /db_xref="GeneID:3257142"
     CDS             join(154057..154101,154167..154204,154257..154412,
                     154466..154668,154729..155073,155133..155228,
                     155280..155414,155470..156284,156346..156537)
                     /locus_tag="CND00530"
                     /codon_start=1
                     /product="urea transporter, putative"
                     /protein_id="XP_570315.1"
                     /db_xref="GeneID:3257142"
                     /translation="MSSTVLPQGAGYGVVIGMGLFFSLLMVGIAKLQTRYTSHKTSSA
                     EEFNSASRSVPPGLIAAGIVSAWTWAATLLQSSATAYKFGISGPWWYASGAAIQVLLF
                     AMISSKLKQHAPFCHTYLEIIKARWGRAAHLVFLFFALATNIIVSTMLILGGSATVTD
                     LTGMNTVAACFLIPLGVSIYVLTGGMRATLIADYSHTLVLYCILISFALVAYATSPII
                     GSPSKMWELLNYAAEANPISGNAQGSYLTMRSKSGLIFGVLNIVGNFGTVFNDQAYWQ
                     RAIASDPKTSVKAFLWGGIAWFGIPLGIATSLGLSAVALAHGTSTPIITLTPDEVSAG
                     LPAVKAASALMGQSGATAMLILLFLAVTSACSAEQIAVSSILTYDIFGTYIRPNPSEK
                     QILWVSHVCIFSYALFMGAIATAFNYIGVSMGYLYELMGCIIGSAVVPIALCITWRKC
                     NGTGACVGAVLGFCAGVAGWLGITSTLNDGVINVTTTFGDYEMLTGNLLSIGVGGIIT
                     VAWSYIHPANFDWDITRSINNKEDFTLTENNEPSAEPLAYDDEKEKLDGEGEGFQGGA
                     EPMRNTTHTTVEAQPTDMTKENEELQKAFRFAAIAALSLVVILIFVIPLPLFFTSHVY
                     PVKGFTAWVCISLIWLFVGLGMVGVYPAWEAREGLMKVGKGIVRDITRQN"
     gene            complement(157121..159870)
                     /locus_tag="CND00550"
                     /db_xref="GeneID:3257338"
     mRNA            complement(join(157121..157638,157705..157782,
                     157842..158593,158641..158907,158969..159870))
                     /locus_tag="CND00550"
                     /product="glucosidase, putative"
                     /transcript_id="XM_570389.2"
                     /db_xref="GeneID:3257338"
     CDS             complement(join(157601..157638,157705..157782,
                     157842..158593,158641..158907,158969..159693))
                     /locus_tag="CND00550"
                     /codon_start=1
                     /product="glucosidase, putative"
                     /protein_id="XP_570389.1"
                     /db_xref="GeneID:3257338"
                     /translation="MQYGSQSPTLGREPLLASAQNPGMSQRLSESSFTSYDNQSSMSH
                     RVGANSPTGASYASFSSGNRFGPTAHLNPGPVAGVSEAGALPTDAYAQGPIDDDDDMD
                     DHLHTFTAAEKKDLSTPFNISSWRGWANALTLAVLAGGGVMLFAGYPIISFYYGDDSS
                     SGSNTSGYNLGGINASGQYPSITGLPSLIDSDTPEYLYTRTGFDGKEWTLVFSDEFEK
                     DGRTFFEGDDPFWTGVDLNYWPTGDLEWYDPSAITTADGHLVITVTQEPIHDLNFKSG
                     MLQSWNKFCVSKNAYIEFSASLPGTSGIGGFWPGVWTMGNLGRPGYGASTEGMWPYTY
                     NSCDVGILPNQTWLNGTGPEAALTSGSSGTQLSLLPGMRTPSCTCEGEDHPGPDVTVG
                     RSSPEIDIIEAQIIISENRGEVSQSFQTAPFDDYYQWDNTSTSNYKQYDTDLTYWNTY
                     LGGTYQQSVSSLTRVPRDIYYSQSGGGGEFAMFAMEYDSAPNNKEDGYVTWYSDNKTS
                     WTMYADAVAANERVGIGRRTIPEEPMTLIVNLGLSFNFQPVDFDHLTFPNYLRIDYFR
                     VYQQSDSISIGCDPDDYPTADYISKHAEVYSNANLTTWAQAGYTFPKNELTGC"
     gene            161021..162734
                     /locus_tag="CND00560"
                     /db_xref="GeneID:3257373"
     mRNA            join(161021..162080,162138..162207,162315..162734)
                     /locus_tag="CND00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656946.1"
                     /db_xref="GeneID:3257373"
     CDS             join(161110..162080,162138..162207,162315..162404)
                     /locus_tag="CND00560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512730.1"
                     /db_xref="GeneID:3257373"
                     /translation="MSHSHIHNTFAPSTLTNPFAPAPLRPRASGNGVIGNVLSAPHDT
                     DDGSYADNAIIPKLHSDTRKPVDRSDPKVSQVASAVVQNVKSSEGEAAVHANHQHGPY
                     GRQPVGFLTPNVQRNQGYGSHDYTQNSNSIPSTNGLGLASSPQRQKQSDTNAQAEHSQ
                     SVPNQSRTQPTHGNYPPIRNVPPAITTGLVPPLSILLPAPASPICPLLAAPPQAHYSP
                     LPFPSSPHPSPHRTTPSSSPSTPKHILAHARASTTSESIRGFDLLAEKKASFREGEEE
                     LMTPFSPRPRNKPSALRDGLRASGADFWKRYSVSVRLDEIDKQKGPSSDWLSKAQANR
                     GILKKMAWSFTLMTLVIVAIIVVVVVVTNNKSDNSSKTKSNL"
     gene            complement(162942..165111)
                     /locus_tag="CND00570"
                     /db_xref="GeneID:3256881"
     mRNA            complement(join(162942..163039,163103..163683,
                     163734..163898,163957..164168,164218..164268,
                     164315..164409,164461..164604,164660..165111))
                     /locus_tag="CND00570"
                     /product="transcription factor, putative"
                     /transcript_id="XM_570313.2"
                     /db_xref="GeneID:3256881"
     CDS             complement(join(162974..163039,163103..163683,
                     163734..163898,163957..164168,164218..164268,
                     164315..164409,164461..164604,164660..164998))
                     /locus_tag="CND00570"
                     /codon_start=1
                     /product="transcription factor, putative"
                     /protein_id="XP_570313.1"
                     /db_xref="GeneID:3256881"
                     /translation="MEGFDLPMSFGKKSKAGNSNLKAKVENTKRADIPTPVKEEKPEE
                     EVPGPSISTSGRKTEAEEEDDEEIGPIPPSATGKRKAEENDASDDEQEAEEEVDRLPI
                     SHEIILKDHTKVVSALAVDPSGARIATGSHDYDTKLWDFGGMDHRLKPFKSFEANGNY
                     YVHDLSYSPDGQQLLVISGTVHPKVFNRNGEDEMEFNKGDVYLRDMKNTNGHTAEINA
                     GAWHPTDKSIFLTCSNDSTLRIWDTSNKRKQKQVIVVKSKERGARTKVTACAWSPDGK
                     WIAGVCLDGTLHIWDTSSNFARPKYSCENAHPKNTETTGVAFSRDGLRVATRGGDDTV
                     KLWDIRSIRNPLAVAKNLDNLYPETNIIFSPDDTQILTGTAAPKGQKGGLVFLNSKDL
                     KEERRIAIGDGSVVRVLWHSRINQIFATLSTGGVHVLYSPNSSIHGALLPLAKLPKTA
                     PRDPSFSTVDLKPVIYTPDALPMYQEQGHRESLHQKEKKAKKMKPMEPVSGVGRAGRL
                     GASETQSFVHSMYPETLKFEDPREALLKYASKEEQEKKKQEM"
     gene            complement(165176..167715)
                     /locus_tag="CND00580"
                     /db_xref="GeneID:3257276"
     mRNA            complement(join(165176..167044,167091..167328,
                     167375..167715))
                     /locus_tag="CND00580"
                     /product="alkylbase DNA N-glycosylase, putative"
                     /transcript_id="XM_570311.2"
                     /db_xref="GeneID:3257276"
     CDS             complement(join(165344..167044,167091..167328,
                     167375..167655))
                     /locus_tag="CND00580"
                     /codon_start=1
                     /product="alkylbase DNA N-glycosylase, putative"
                     /protein_id="XP_570311.1"
                     /db_xref="GeneID:3257276"
                     /translation="MPPSTHPQSRSKPLLNMDSDPASWLNFSLPPRARSGAGVPGSGV
                     PGPPRRSRKGGEGWRGGVLSREKYLNASFKFVLKPSEALSYGAHFADPDISLHWPNIL
                     QILVPTFSALSVAQGYVSEPHAEGGYTSHDLEEMGEEAAERRRRMEEEKRGRMCPICL
                     GKPVAGRMTKCGHIFCFPCILHYIQLSDIPKSAKCPICGDMVQSNALKSVKYLDAEAM
                     LESSTHATSDAFEASLEEAKRLDSGDRHDKRHRLHMRLIQRPQMTTLALPSSSTWPSD
                     AVPPHTAPWYFLPDIITYSRYMLATPEYMGKELEREMKELGGEWELLRGDELGRVFVK
                     AAMDKVERQMIKVKEELETELVRRSERKGREAWSSAIGGDKKEKEQQKERERKEQERM
                     KREKQQDIGAVPVEFLANQQTTFDNSANINIPPNLPVEPNPMPPMPRDKKSRRRLNPV
                     PPPQSVPPAPSYYFYQSSLGANVFLHPLDIRMLLAHYGSYNLFPSSMTFETTGYDPGT
                     INDDLRKRCKYLSHLPLGSEIVFVETNLAELVSSTILAQFEQPLKARRQKRRDKVRKE
                     DRAKQKWEKAERSKTAEELQSVRSVPSAFVRGGVEEDRELELALARSAVEFEQNFPVA
                     YPQPGIASSPPRSGSWGQTPIQTQSESQQDQQRSFATALHQRYDPSLSRSRREVDPEV
                     DALWQQFESTDVHLEPSMGANAGAGTGAGVRESERGNGRKKKEKGKKLILGGGGRRA"
     gene            168188..168283
                     /locus_tag="CND00590"
                     /db_xref="GeneID:3257460"
     tRNA            168188..168283
                     /locus_tag="CND00590"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3257460"
     gene            169004..171421
                     /locus_tag="CND00600"
                     /db_xref="GeneID:3257171"
     mRNA            join(169004..169581,169633..169915,169967..170193,
                     170241..170551,170610..170886,170938..171125,
                     171179..171421)
                     /locus_tag="CND00600"
                     /product="carboxypeptidase D, putative"
                     /transcript_id="XM_570309.2"
                     /db_xref="GeneID:3257171"
     CDS             join(169344..169581,169633..169915,169967..170193,
                     170241..170551,170610..170886,170938..171125,
                     171179..171301)
                     /locus_tag="CND00600"
                     /codon_start=1
                     /product="carboxypeptidase D, putative"
                     /protein_id="XP_570309.1"
                     /db_xref="GeneID:3257171"
                     /translation="MWSKVVTTALLAIALGSVIEAASDPSALRGRGPAALAAKEAKKE
                     APANNASNSDASKMEKCRALLERHPKRKFYNNRTSEFLIESLPEVPFDLGEVYSGLIP
                     IDYNNQSEALFFVFQPKLGEDSDDLTIWLNGGPGCSSLEGWFQENGLWTWQPGTYAPV
                     INPYSWVNLTNMLWVEQPIGTGFSIGTPKATTEEEIAQDFIKWFKNFQDTFGIKNFKI
                     YVTGESYAGRYVPYIGAAMLDAQDKTYYNLSGALMYDPTIGESVFVQEQITTYPFVEA
                     NANLFNFNKTTMAELKDLHEFCGYKEYIERYLTFPPTENQPPLFFDYYDFDNITCAIF
                     DIVNNMALRINPCFDIYEINLMCPLLWDVLGMPTQLSYAPGGIYFNRSDVKAAIHAPE
                     HIDWTACATRAVFVGGIEQGPQGRGDLSLDPIQKVLPQVIEATNRVLISNGDYDMVII
                     TNGTLLAIQNMTWNGYLGFQSPPSEDIFIDIVDTQWSSIFESNGFDGYPGPQGVMGIQ
                     HYERGLMWAETFQSGHMQPQYQPRSSYRHLQWLLRHVDRL"
     gene            172062..173348
                     /locus_tag="CND00610"
                     /db_xref="GeneID:3257221"
     mRNA            join(172062..172156,172228..172275,172393..172494,
                     172561..173039,173120..173348)
                     /locus_tag="CND00610"
                     /product="protein-binding protein, putative"
                     /transcript_id="XM_570307.2"
                     /db_xref="GeneID:3257221"
     CDS             join(172118..172156,172228..172275,172393..172494,
                     172561..173039,173120..173201)
                     /locus_tag="CND00610"
                     /codon_start=1
                     /product="protein-binding protein, putative"
                     /protein_id="XP_570307.1"
                     /db_xref="GeneID:3257221"
                     /translation="MPIRYISQKLAQQIDVELMSASGAFSLDQLMELAGLSCAQALAK
                     SFPPTKHKHVMVACGPGNQGGDGLVAARHLHHFSYTPTVYLPKPSSKDFLQRLVKQCE
                     NLNIPILKDVDAFQTELAKSDVILDAIFGFSFQPPLRKPFDQVLKAIKGVSKKIPIVS
                     VDIPSGWSVTDGPQPLWTEEDDKGGKEMIETFEPEVLVSLTAPKEGVKAFKGQHWLGG
                     RFVPDELGKKHELNIPPYEGIDQVVELPRNH"
     gene            complement(173082..174898)
                     /locus_tag="CND00620"
                     /db_xref="GeneID:3257205"
     mRNA            complement(join(173082..173567,173678..173784,
                     173885..173953,174012..174053,174106..174515,
                     174574..174898))
                     /locus_tag="CND00620"
                     /product="glutathione transferase, putative"
                     /transcript_id="XM_570305.2"
                     /db_xref="GeneID:3257205"
     CDS             complement(join(173501..173567,173678..173784,
                     173885..173953,174012..174053,174106..174515,
                     174574..174784))
                     /locus_tag="CND00620"
                     /codon_start=1
                     /product="glutathione transferase, putative"
                     /protein_id="XP_570305.2"
                     /db_xref="GeneID:3257205"
                     /translation="MMSSADAPPCDALARRPPVTVESFAMTGWHGSVAACFNPFLHLP
                     CLIPLYSTMPHQITLHHLDLSRSDRIFWTLEELNLPYDVRVHFRLPTRSAPPSLHKVS
                     PLGRAPALILDDKLLTESAYIIHTLLSLPEVQQAAQKGEIDVQVENTNDDVFWSHFAE
                     ASMMNLLQGMATVGATSQGWLSGKVPGLPEMSEDEKKGIQKYSSWLQDGYFRPNIQST
                     IDFAENFLAKQDAPFFSGTSKPGEGDFMMFFAINSFLGGSRADMGFKVGPNLKKWYDT
                     VLSRPAGKKALKRLKQEEESAKAKI"
     gene            175357..177535
                     /locus_tag="CND00630"
                     /db_xref="GeneID:3257288"
     mRNA            join(175357..175715,175779..175924,175984..177535)
                     /locus_tag="CND00630"
                     /product="expressed protein"
                     /transcript_id="XM_570364.2"
                     /db_xref="GeneID:3257288"
     CDS             join(175422..175715,175779..175924,175984..177490)
                     /locus_tag="CND00630"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570364.1"
                     /db_xref="GeneID:3257288"
                     /translation="MLGRTSNTLRAVPRCAPQLGRTVAPAHAVSRPLLAFSFSTSRKI
                     DHPHHAQIIPSLRNYATEASTVDTTIEPKVVQEDASQEEEATEDVLIPQLSSWTGLGV
                     SLPILKQLAKGFPHVQDPTPAQRLFLLAVLSGNEVYLRDAMGRGKTLALAIAALELAL
                     RPSPRGKSKGNSPKVMILVPTPHLAHQIFSHLQTLSPYSSSSSSSPLFSLLSPKTLLA
                     KGEKSPAWALPDTPIIISTAKIAVQFNLDTPQLTHIFLDEPDTMVGSLPSRHATSRDL
                     YRHPLIRHPPPIVHAITQLLGITITRDGTLDFAKRRNGINTVWTSATMGREFKRFVKT
                     RGWVRRGNRVVDLDFSPSASDNKRLIRERLLQAIGVSPNDGPQLGKSAKGKGEKKGQE
                     QKEPEHHVILIDHETGDFAPLTPTSDLTGFTSQPKDQLASSSSSSQGYILETLALLHA
                     TSPPPPGKYALALPPEGTSLDQLGEALASLGVSTSLLTPEVLRIGIPPVAEGVAPPIL
                     LAARSSVTGLHLPQLQTVYMLGGLDVQGLSQAQRKNKGVGERMGFYDTVTGRLGRLGT
                     DAVVDASVGEGGEGETQKVVSLVLAGSEEHDKLAKMFFGDAKGNKEDGEIEVVKRKKL
                     SEWDMESLNQILEQELQDERTSTN"
     gene            complement(177668..181956)
                     /locus_tag="CND00640"
                     /db_xref="GeneID:3257337"
     mRNA            complement(join(177668..178002,178060..178660,
                     178719..179016,179066..179095,179143..179286,
                     179358..179447,179508..179583,179642..179738,
                     179794..179854,179911..180081,180147..180318,
                     180379..181254,181300..181386,181438..181574,
                     181630..181749,181833..181844,181907..181956))
                     /locus_tag="CND00640"
                     /product="membrane protein, putative"
                     /transcript_id="XM_024656947.1"
                     /db_xref="GeneID:3257337"
     CDS             complement(join(177874..178002,178060..178660,
                     178719..179016,179066..179095,179143..179286,
                     179358..179447,179508..179583,179642..179738,
                     179794..179854,179911..180081,180147..180318,
                     180379..181254,181300..181386,181438..181574,
                     181630..181660))
                     /locus_tag="CND00640"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_024512715.1"
                     /db_xref="GeneID:3257337"
                     /translation="MVYMGRTKLKDFSPISAHDPDAHYTPSTNRFFGWILPTLKTSEF
                     TVLQTVGLDAAVLLHFYRMCLSLFGVSALLALVVLIPLNLFRHGSTDSGAEQPGNNDT
                     LAWNGTSSFSPHQLFNTTSPHARSSLYDLLLDPTTSSTIHLIFTYLFTFLSLSFFHKN
                     FHSFVLSRQAFGLQLIHSISARTILVTKLPTHLRGDRALAEYFEACNFNVESVNICRD
                     VEPLQRGLEKRTLALTKMEEAWADWVGNPAKKGSGYDPHIYSGKSTPQGQHEGTREGM
                     LVDVDNSETNDTASLLSTAPQTYGTSEDTEANSHPHAHVHIQTTRPRPTFRPRWFGTK
                     VDAIEHWEKKFNAADEEVKEMRRTGRFGATHAAFVTFEDARDAQVACQVTHYPHHSQA
                     VTTPAPEPRDIVWQHVSMSIRESQIRDFIVMGIMGVLILTWIVPVSSLATLMSYEEIK
                     KIMPWLARFIGSSPRLAAIVQNSLPSLALITFNGLLPFLLEWLSYMQAFKSRSATEYS
                     LMKKYHLFLLISVLLIFLLTSTYWALVRDLVDTPMKIPEKLARALQGSNVRNFMVSYV
                     MLQALGLMPLQLLNLGPLFSLALARAFWTKTPRDYAEANAPPMLNYGWVYPQALLVFT
                     ITLVYSVMSPLILIFGAIYFAMAYLVFKYKLLFIYFKPYESNGEAWRITFARTLWALI
                     IFQLFMTGLFSLRTYFWASAIMVPLIVYTLWKSWMMWQDFGPLSEYLAISSICEVQRG
                     EGVHGILGVDSVSRSQSMINHRRYAMNDETLYVAPSDSRTDYSQPPMNNFYYSVLNTG
                     RRRYAHPALDGSLPTPWLPAISKDDGEGHKGRGTKAVVLSLRRKVVKRLRGHRGDEGI
                     SGNGAASMEGSHETLAIPESWTRGGSDTAHSPGASPSHAQQESYPSSSLSTNPWGDPS
                     PTSSLPNTRSTPTLKKSSYRAGTGPIALPEEGNVWEDDEPESPSTYFHNRERGRASSN
                     IDQSAIGVSEVGQGSSAPVPPGVGGAL"
     STS             179355..180129
                     /standard_name="Pst19"
                     /db_xref="UniSTS:470729"
     gene            183583..184461
                     /locus_tag="CND00650"
                     /db_xref="GeneID:3256838"
     mRNA            join(183583..183814,183866..184035,184089..184461)
                     /locus_tag="CND00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_570303.2"
                     /db_xref="GeneID:3256838"
     CDS             join(183659..183814,183866..184035,184089..184356)
                     /locus_tag="CND00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570303.2"
                     /db_xref="GeneID:3256838"
                     /translation="MRFTSIIVAALPLVGSVFAAPFAEKDSIASSPDLVKKEVNVLSV
                     VNEVQSRVNAAAAMPRQSQADVEACLNTVIDAFNWCGGQLGIDVSASASANAGASIHY
                     LRREIIARDDDKEAVAQALSSVVQTVNVGIVQQIPSQFINIPGVSNLVNQLDIALSLI
                     LKGVDAILAGVLYLVKALLIDVGIILDSLLGGLLSIL"
     gene            184866..186563
                     /locus_tag="CND00660"
                     /db_xref="GeneID:3257232"
     mRNA            join(184866..184957,184996..185511,185559..185870,
                     185917..186563)
                     /locus_tag="CND00660"
                     /product="glycolipid mannosyltransferase, putative"
                     /transcript_id="XM_570302.2"
                     /db_xref="GeneID:3257232"
     CDS             join(184909..184957,184996..185511,185559..185870,
                     185917..186545)
                     /locus_tag="CND00660"
                     /codon_start=1
                     /product="glycolipid mannosyltransferase, putative"
                     /protein_id="XP_570302.1"
                     /db_xref="GeneID:3257232"
                     /translation="MSRPLRIGFIHPDLGIGGAERLVVDAALSLKNKGHHVTIFTSRH
                     DPSRCFPETIDGTLPVHVLGSSLPRSLHPKFPFTILFSILRSLLLAVLLLTSLLLPGP
                     PSIANPLSPLQGFDIFFVDQQSVAVPLLRFVSGTRIVFYCHFPDKLLSGGWEIDVGKD
                     KAVVERKGVGILKRMYRWPIDKLEEYTTGQSDIIISNSEFSSRVFALAFPSLAQKPRR
                     VVYPCIDLSSYTSTSSDVKDGSVNLIQSDRPTIISFNRFEAKKNVDLAIRTFAKLRDD
                     DLISKEEFRNLRFVVGGGYDPDQRDNAQTLLHLQNLCTNLSLSHHTIPSSSPISPNTQ
                     IIFLLNFSSAQRAHLLTSPSTLALLYTPTNEHFGIVPIEAGACGLPVLACDTGGPVET
                     VVDFSIPSNAENGTGLLRPPRAEEWAPALTTLLHLSSSQRSIISQSAQTRIAENFSLA
                     TMGTQLEKACRDALAMGDLHVQVGDKLIWGGLGLMGFAAGGLGVIWMVWGV"
     gene            complement(186554..188275)
                     /locus_tag="CND00670"
                     /db_xref="GeneID:3257336"
     mRNA            complement(join(186554..187033,187078..187150,
                     187200..187718,187761..187932,187981..188040,
                     188080..188275))
                     /locus_tag="CND00670"
                     /product="guanyl nucleotide binding protein, putative"
                     /transcript_id="XM_570385.2"
                     /db_xref="GeneID:3257336"
     CDS             complement(join(186777..187033,187078..187150,
                     187200..187718,187761..187932,187981..188040,
                     188080..188240))
                     /locus_tag="CND00670"
                     /codon_start=1
                     /product="guanyl nucleotide binding protein, putative"
                     /protein_id="XP_570385.1"
                     /db_xref="GeneID:3257336"
                     /translation="MEEQHHGQEQDQNQQQQAYAPPEYSFDNASLYASINAASLSSPL
                     ENNFWRSARWSPDGSAVLTTTEDRSFRIHTLSETSLGTFDTHQFKQPDSITSSIWFPT
                     ASSLVPESFCFVAGIRDNPVKLIDAKTGNVRASYPIIDHRERFISPYSLAFHPSLSKL
                     YCGCSSFIEIIDLTSSSSTRLKTTFTRSSKDGQKGIISALAFAPDTTGSFVAGGYDGS
                     VGMYTEDGDLEGWLGGLEVGGVTQLSYHPLNPTLLFVASRRSDVIQVYDIRNPSQPLH
                     SLPRKGRTNQRLWFDIDVWGRWLASGDEEGLVKVWDIISPEVPVVFEEKLHNDAVSSV
                     QLHPYYPLLLTSSGSRNMTASGSTLDNESNEGSQSDSDSDSDDSGSGLENEGSGGMTT
                     PISNIKDSTMKIWSFLPPASS"
     gene            188352..193774
                     /locus_tag="CND00680"
                     /db_xref="GeneID:3256890"
     mRNA            join(188352..188559,188616..188667,188726..189403,
                     189455..189652,189709..189802,189868..189994,
                     190061..190624,190696..190788,190842..190949,
                     191001..191750,191798..191939,191992..192090,
                     192148..193774)
                     /locus_tag="CND00680"
                     /product="peptidase, putative"
                     /transcript_id="XM_024656948.1"
                     /db_xref="GeneID:3256890"
     CDS             join(188381..188559,188616..188667,188726..189403,
                     189455..189652,189709..189802,189868..189994,
                     190061..190624,190696..190788,190842..190949,
                     191001..191750,191798..191939,191992..192090,
                     192148..193677)
                     /locus_tag="CND00680"
                     /codon_start=1
                     /product="peptidase, putative"
                     /protein_id="XP_024512685.1"
                     /db_xref="GeneID:3256890"
                     /translation="MEQLEVHDDIFAAYHIPKISTPSTSSSSTVSSTRAQRGKGKQRA
                     ASSEVEEETHVATPEEEARGSSGRKKMAGQNRQEAGMTRARARMTNVVNGYSPYGASQ
                     RKGAALGRASLAKAVPQSEFYSNPKASGSRELNTPTQQNTRASTSNTRSLSRNQLLAN
                     ARGTHSAGLHDDSDDAEGSPVRRAYKPDETEDDVPVLVELPNKEPSSAQPTRRTGGEQ
                     GTNSNPFKGKGKAADVFGNHRDARHPQPSRAAKNDDEVEYMPHGEVKITKEMRVAELD
                     MLTKQVTPRFGQRQRRPMNNKDGNQVKISNRAPTQVLKSPGDSVPLNFNLAWISPNTI
                     LRCTGITFDGKELRLACEGGGSSWKIDFKKMISIQLCTSQEHPFICFEVNPNDTDRDS
                     FSNLLDGKKLNFEGTVQLCIKPSKSLQTAQRLDTFLSRLRSQAVGRVDELDQASCKLL
                     SESCNSQVLDTRARHEAQRRVKAAEAAEKRIASRASSPIDSWPYGIDDKKEEKEKKPA
                     AKGGRGKKKEEQGDRNQSKLNLYVFFSCQTARRVLTILCSAPQPVVPVRRSSRRSTNK
                     LIEEISSDDERPVHVSKEPPPANKNELYFCYPPTEKAAVSITQGDKYRVKVGEFLNDT
                     LLEFGLRHVLSQVTDARREETHVFNSFFYGKLSNKSKGNKPTSEGWPAYNSVQRWTRN
                     KNVFDKRFIIVPINEHFHWYLAVIINPRGILRPRAPEPALEISRPNTRATAGTMVGGS
                     PGHHYSELMEDPKIEAGPELSAEAQAHKDASLEKEKGTPGLPSAQSNQSPKRSLAQSL
                     TPPKTRKSPFFQSSPLTPAPEDGDGEFPHPGDQSVDPLDVMSQQTDTERDEDIEMKDV
                     RNGVQEIDLDGPPNSKNEKDGSGDEGTGGFIVTPTLLAMQQQQNQVEKGAKLPMVTTV
                     VDDDEEGAKAKAKNSASAKKGKSKGQDANFEDGRTWIITFDSLGGAHRAVGTNLSRWL
                     QYEAKNKLNIDYEPEDAQYWHGKVPQQGNFYDCGLFVVHYAKQLLQRPEEVLSFVQRR
                     QPPEWSPEVGEWRADLDRFWQASETKNLRISWVVTMDDLASEWGKIEKERPKAADDAE
                     GEGDASQVEEVTKEEREAEARMEKEVEQELKRRQEEIDKGEGGKGEGERDGEGDETRE
                     GSEATEKDMEKEQPPDENAEDPELPLHPDFDPSLDLQLDPEFDHSENSTSTPVTSQTK
                     QISASARLEPASPDSSVVSDAYAEKGTSTVADADTAMESQQDDAAINWESPIPIKPAL
                     DFFDRDQATAEVEQESKMNGEVAMLIDDGDLVPSSPLPSQSLRTHISPSHGTHLRFEE
                     EDEPESEMPGNEVKKEKASVLVKSLRQQKEEEEEKEEEEEVKNTVRPLPRSSRFFAPS
                     NDSTPHITKPPFRSSAAKKPRHHADRASSPIDDGPFAGLSESAPNASSRSRSGSIHRS
                     ASVSRKASDTTRDDGEDRVNEADEDRLEGERESTASRVSSPKKLAPASTYAPTSARKA
                     PKRVAGRNDAETRANKRTKGGSKGKGRPSTGASRDEAIELDSD"
     gene            complement(193731..194715)
                     /locus_tag="CND00690"
                     /db_xref="GeneID:3257286"
     mRNA            complement(join(193731..193971,194030..194090,
                     194141..194259,194310..194486,194553..194715))
                     /locus_tag="CND00690"
                     /product="expressed protein"
                     /transcript_id="XM_570366.2"
                     /db_xref="GeneID:3257286"
     CDS             complement(join(193865..193971,194030..194090,
                     194141..194259,194310..194486,194553..194667))
                     /locus_tag="CND00690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570366.1"
                     /db_xref="GeneID:3257286"
                     /translation="MPAPPFGTASAYTDSFPAPPPKQVTVTAETCYNLGVFRDIVRQY
                     RKLDDQIIIRLNRAQAELRDHTRTSTGGSWIGGGVKSMDGAEGMCVKIWSEMMAGWAH
                     RQTLLTFCSQTVQSSVEGKRNEGGHVRGIKEEEVLADQLASEESIEAIIRKRTLEAFK
                     SRCPFFTPSDTTSKAWFNLADRGLKGHGPDLP"
     gene            194871..197324
                     /locus_tag="CND00700"
                     /db_xref="GeneID:3257332"
     mRNA            join(194871..194923,195164..195185,195593..195681,
                     195738..195914,195971..196291,196347..197022,
                     197081..197324)
                     /locus_tag="CND00700"
                     /product="argininosuccinate synthase, putative"
                     /transcript_id="XM_570386.2"
                     /db_xref="GeneID:3257332"
     CDS             join(195624..195681,195738..195914,195971..196291,
                     196347..197022,197081..197138)
                     /locus_tag="CND00700"
                     /codon_start=1
                     /product="argininosuccinate synthase, putative"
                     /protein_id="XP_570386.1"
                     /db_xref="GeneID:3257332"
                     /translation="MVATGEKKGKVILAYSGGLDTSCILLWLIEQGYEVVAYMADVGQ
                     EEDFEAARAKAMQCGAVGFHLADLKREFVEELIYPAVQCNAIYENVYLLGTSLARPVI
                     ARGMIEAAVKEGCDFVSHGCTGKGNDQVRFELAFYGLAPNIKVIAPWRLPEFYERFDG
                     RSALLEYAAKNGIPVTQTAAKPWSTDENLFHISYEAGILEDPNQTPPDDMWKLTVSPE
                     KAPDAPERVHIEFAKGLPVKVTFPADGNTVTDSVEIFLTLNALARRHGVGRIDIVENR
                     FIGVKSRGCYESPAATILRAAHMDLEGLTLDRNVRALRDQFVTTQLSQILYNGFFFSP
                     EREFITAAIPASQKTVNGVVRLKLYKGNVVVEGRDADEGLYDAKFTSMDEMGGFEPTA
                     TSGFIEISSIRIKAWGRANIKRGQDGVSPKDVYHREN"
     gene            197432..198591
                     /locus_tag="CND00710"
                     /db_xref="GeneID:3257334"
     mRNA            join(197432..197558,197682..197879,198104..198178,
                     198437..198591)
                     /locus_tag="CND00710"
                     /product="protein transporter, putative"
                     /transcript_id="XM_024656949.1"
                     /db_xref="GeneID:3257334"
     CDS             join(197492..197558,197682..197879,198104..198178,
                     198437..198546)
                     /locus_tag="CND00710"
                     /codon_start=1
                     /product="protein transporter, putative"
                     /protein_id="XP_024512714.1"
                     /db_xref="GeneID:3257334"
                     /translation="MTIHALWIISKAGGLVFSRSYSDALPQLPVNTILTLAGILHGIH
                     AITARLTPSPAASSQNQSQGPGSTGGLESFEAEGWGGKVFLTPTGTKFVLLHSLPQAG
                     LDDLLKRIYEIYADTVMKNPFHTLEMPINSALFDEKLGVLMGGVNVS"
     gene            complement(198733..199811)
                     /locus_tag="CND00720"
                     /db_xref="GeneID:3257339"
     mRNA            complement(join(198733..199055,199113..199251,
                     199319..199811))
                     /locus_tag="CND00720"
                     /product="conserved protein"
                     /transcript_id="XM_570300.2"
                     /db_xref="GeneID:3257339"
     CDS             complement(join(198908..199055,199113..199251,
                     199319..199757))
                     /locus_tag="CND00720"
                     /codon_start=1
                     /product="conserved protein"
                     /protein_id="XP_570300.1"
                     /db_xref="GeneID:3257339"
                     /translation="MTLTFTIFGGGGKVAKHFTKLAVTAGHKVHSVIKDDGHASELDS
                     LGATTHILSLHAATPSTISSLFRQTKPDVVLFSAGAGGKPPGADEIDHKGAVKVFDAM
                     EQAGVKRLVLVGALDVRSRDKGWPEWYNEEDKKASDKVWGSIGSYMQAKLDAELNLHT
                     RSKIEYTVIRPGTLTTEPAGGAVMGRTHLAHTSRELVAQTALAIATNPSTIGFTIDVM
                     DGDAKIEDELEKVVKEKLDAWTG"
     gene            199961..200792
                     /locus_tag="CND00730"
                     /db_xref="GeneID:3257346"
     mRNA            join(199961..200013,200083..200792)
                     /locus_tag="CND00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656950.1"
                     /db_xref="GeneID:3257346"
     CDS             join(199983..200013,200083..200720)
                     /locus_tag="CND00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512718.1"
                     /db_xref="GeneID:3257346"
                     /translation="MSDTKTSSLSGYAIWLMPSANEKLHYQHLINRLSKLYNETICQK
                     DEDEGRTRGSASPSFEPHITLFAFIPLDTPVGEISNTLRQVVARVTGSGLSSLGGGGH
                     FALGLLPAQSGRSYFQSVLAPVQPTAELLSLYDQTVAAFPPASPSSSPDEKKKKKGGY
                     FPHLSLFYGDCSLAKRDEIAAIANGEDPCLGSGQATVTINELGIVKCAGEVEEWQLVE
                     SIVL"
     gene            200854..202625
                     /locus_tag="CND00740"
                     /db_xref="GeneID:3257360"
     mRNA            join(200854..201131,201173..201470,201523..201576,
                     201620..202375,202443..202625)
                     /locus_tag="CND00740"
                     /product="allantoinase, putative"
                     /transcript_id="XM_570394.2"
                     /db_xref="GeneID:3257360"
     CDS             join(200938..201131,201173..201470,201523..201576,
                     201620..202375,202443..202586)
                     /locus_tag="CND00740"
                     /codon_start=1
                     /product="allantoinase, putative"
                     /protein_id="XP_570394.1"
                     /db_xref="GeneID:3257360"
                     /translation="MPSQTILAPQAILPGDLCPQPATIVFDTDSGTITSVTLGIHQPE
                     HGKADVWEIEDGKILLPGLIDTHVHLNQPGRTAWEGFRTGTLAAISGGITTLIDMPLN
                     SIPPTTTLSALATKQACAKEVGVSCDVGFWGGIVPGNEGELRGLWEAGVKGFKCFLIE
                     SGVEEFPCVGEQDIIKACDALKGTNALIMFHAELDAPSSDAGHATGHADPSEYSTFLQ
                     SRPQQWEISALQLILRIARSYPDLRFHIVHLSASDAIPILQSALGTGKGKGKDTGAGT
                     GKDTGKDTDTENPTLENLTVETCFHYLCLCDTDIPPNGTQFKCCPPIRDESNRVKLIE
                     ALLDGTIHYVVSDHSPCVPELKKGDFMSAWGGVSGLGLGLSLLWTELGAGGRVELGRI
                     VEWMGPVQARQVGLQGKKGVIQTGAAADFVVFDPDATFEVTLETLRFKNKVSPYIGKR
                     LTGRVEKTYLGGALVWEHGAGAGDAARGGFV"
     gene            202694..204456
                     /locus_tag="CND00750"
                     /db_xref="GeneID:3257351"
     mRNA            join(202694..202806,202856..202957,203002..203075,
                     203120..203601,203650..203836,203880..203948,
                     203999..204056,204111..204456)
                     /locus_tag="CND00750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570396.1"
                     /db_xref="GeneID:3257351"
     CDS             join(202727..202806,202856..202957,203002..203075,
                     203120..203601,203650..203836,203880..203948,
                     203999..204056,204111..204225)
                     /locus_tag="CND00750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570396.1"
                     /db_xref="GeneID:3257351"
                     /translation="MSAPVDLKKPQEPQTETQAQKGLSDDALTKYTSAGQALADVLKK
                     LVPQIAPGKKVLDLCIEGDKLVADAVAPLWNKPKNGVKVGKGSAFPTSVSVNNVVSHV
                     SPLPSDPEIELKDGDVVKIMLGIHLDGYPVTHAETIHLSAKTDGLAADVIRAAYDAAQ
                     LAMRTLKAGAKNWDVTDVVDRATKSYDCVPVEGMLSCQHEKNVTDGKKRVLLNPSPEL
                     RRDHETATFEEGEVYGVDVLVVTGTNGKAKADPSRTSIYKRGDTNYQLKMKTSRAVFS
                     EIQKKAGAFPFTLRALDDEKRARMGVQEAVSHGLLKPYDIVQTAPGTLVAEFFFTIAL
                     LPGGPLLLSPTPAWYSPDKVSSSKSLQDEELKNLIAQPLRAPKKKKKAAKEAEA"
     gene            204728..207097
                     /locus_tag="CND00760"
                     /db_xref="GeneID:3257300"
     mRNA            join(204728..205079,205161..205242,205328..205422,
                     205486..205507,205559..205690,205752..205809,
                     205905..206175,206305..206354,206414..206446,
                     206501..206839,206899..207097)
                     /locus_tag="CND00760"
                     /product="lipid particle protein, putative"
                     /transcript_id="XM_024656951.1"
                     /db_xref="GeneID:3257300"
     CDS             join(204744..205079,205161..205242,205328..205422,
                     205486..205507,205559..205690,205752..205809,
                     205905..206175,206305..206354,206414..206446,
                     206501..206839,206899..206992)
                     /locus_tag="CND00760"
                     /codon_start=1
                     /product="lipid particle protein, putative"
                     /protein_id="XP_024512709.1"
                     /db_xref="GeneID:3257300"
                     /translation="MPSRANVHLVLLIHGLWGCPAHLSVAKEELEAAWVASHSASHSA
                     ASTPRTPRTHAQVSGPAEDPVITKTLQVPTHHAEGEEQEELVIMIAGGMTSQLTYDGI
                     DVCASRVAWEVDEKVRELESQHKQVVKFSVTGYSLGGLVARYLLGLLHSRSPSFFDTH
                     KPISFSTLSSPHYGIPRYNTLLSTTLCWLGARIMSRSGEQLYVVDKYSEDDPRPLLEI
                     MADPRSVFYHALEKFERLSLFAAAINDNSVPFPTAAIETVDHFAQWQDQGLVVDCDEA
                     GMIRSWSRGEVEDDEVDGKVNGKGNEKGRKRPVKKSLGTYIGTLPPVLRYRFPFNYLI
                     ILLFPIMLPIVLCLILARQSLDTSRSKRRLQQLAQTSSSSSTPQTTAPIASSASGLSI
                     QHLRDTIRRIERNIESEFIENADGPSLDIYNKTTPLQQVVVKVQLKDSQLRMALWLNQ
                     LPFKKYFTWWPEITNAHATAIVRDAHLFPQHERGRGMLKFWAKVMLGQATDVS"
     gene            complement(206980..209055)
                     /locus_tag="CND00770"
                     /db_xref="GeneID:3257305"
     mRNA            complement(join(206980..207171,207225..207296,
                     207349..207376,207448..207873,207912..208501,
                     208553..209055))
                     /locus_tag="CND00770"
                     /product="expressed protein"
                     /transcript_id="XM_570374.2"
                     /db_xref="GeneID:3257305"
     mRNA            complement(join(206980..207171,207225..207296,
                     207349..207376,207448..207873,207912..209055))
                     /locus_tag="CND00770"
                     /product="expressed protein"
                     /transcript_id="XM_570373.2"
                     /db_xref="GeneID:3257305"
     CDS             complement(join(207131..207171,207225..207296,
                     207349..207376,207448..207873,207912..208501,
                     208553..208961))
                     /locus_tag="CND00770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570374.1"
                     /db_xref="GeneID:3257305"
                     /translation="MIKLKEVEKNKSAHSKLIKPPPSCNLDHATDEPKTAKKGIDNIV
                     EDNKYPKERKDRVVAQILRAFSLSKIKPTAKKKPGPGGEIMRNQSDFKVNTKLDKVAR
                     KMETLNRRTATESSFELVEKEEETEEPEPVARIKVPHALSRHRFGCYAQTSLPVNRTP
                     EPQLPNVSTKVVQEQCSEETERQKSISKQRAKISTSSVQAAQLSKDVIYPSPSSTDTF
                     ETSDTTCSPENKPPMPPFPTQRVISHHLKRPSQSPFGPRATFSTSTPMTRRVRSASNL
                     LFKRSPSKISIVTRKPVPVYIDVPLSLDDGHISGVSIFTRDIVQTPLEKTSSAGPHKN
                     QLLATPPTPKFNILTDVFFSEQSPTKRGSLFIVNNSFDSYEQYQNTLFEDVLKTWGLP
                     LDVIHPKEVELYKKDIAAVHSKETVDKNVPPVQTQKRTPRTVAFSKPVKTNPGVKKFI
                     SMDERRLRKPVGRVKDIVEIFEDRSVDRTMTPIRELGRILQRPSSVSSDNLAAESRQM
                     MEGARKKVRGVVV"
     CDS             complement(join(207131..207171,207225..207296,
                     207349..207376,207448..207873,207912..208520))
                     /locus_tag="CND00770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570373.1"
                     /db_xref="GeneID:3257305"
                     /translation="MITHTTVPHALSRHRFGCYAQTSLPVNRTPEPQLPNVSTKVVQE
                     QCSEETERQKSISKQRAKISTSSVQAAQLSKDVIYPSPSSTDTFETSDTTCSPENKPP
                     MPPFPTQRVISHHLKRPSQSPFGPRATFSTSTPMTRRVRSASNLLFKRSPSKISIVTR
                     KPVPVYIDVPLSLDDGHISGVSIFTRDIVQTPLEKTSSAGPHKNQLLATPPTPKFNIL
                     TDVFFSEQSPTKRGSLFIVNNSFDSYEQYQNTLFEDVLKTWGLPLDVIHPKEVELYKK
                     DIAAVHSKETVDKNVPPVQTQKRTPRTVAFSKPVKTNPGVKKFISMDERRLRKPVGRV
                     KDIVEIFEDRSVDRTMTPIRELGRILQRPSSVSSDNLAAESRQMMEGARKKVRGVVV"
     gene            209389..210646
                     /locus_tag="CND00780"
                     /db_xref="GeneID:3256929"
     mRNA            join(209389..209753,209812..210233,210283..210368,
                     210426..210646)
                     /locus_tag="CND00780"
                     /product="expressed protein"
                     /transcript_id="XM_570299.2"
                     /db_xref="GeneID:3256929"
     CDS             join(209447..209753,209812..210233,210283..210368,
                     210426..210606)
                     /locus_tag="CND00780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570299.2"
                     /db_xref="GeneID:3256929"
                     /translation="MLSFGVTVRPLAVTSRLHSPTVHMWRRNAHTAAMSDDSLDQGSS
                     SSYGGSASQGHPGKGKGRQDPLAQSYRFPEKGRNGGPPDPFEVMALDRSATQQEVKQQ
                     YYKLALLLHPDSSHPSSSPDHFATLNKAYNLLSKQSSRSAFLKTGYGWDVSTSSGGTQ
                     TWSDSLMRAEIARRRNGGAAAWSGASRRYRDSDAGRGAWGGFDGSQGWRPYEDPSKGF
                     SPPTSGPAEERYMSNPRFLAVVGVASAVIAWVHWHRLGYATETHRDMLDKQNIDASRA
                     LAQARYEAATHGRVRREQIRRRVREAEVLKELEKAEQGHIAVAGPPTAYPPSNRE"
     gene            complement(210628..212966)
                     /locus_tag="CND00790"
                     /db_xref="GeneID:3257201"
     mRNA            complement(join(210628..210749,210787..210823,
                     210862..210934,210983..211103,211154..211235,
                     211275..211354,211434..211447,211488..211812,
                     211857..211881,211952..211979,212034..212134,
                     212176..212219,212276..212424,212515..212966))
                     /locus_tag="CND00790"
                     /product="glucan 1,3-beta-glucosidase, putative"
                     /transcript_id="XM_024656952.1"
                     /db_xref="GeneID:3257201"
     CDS             complement(join(210641..210749,210787..210823,
                     210862..210934,210983..211103,211154..211235,
                     211275..211354,211434..211447,211488..211812,
                     211857..211881,211952..211979,212034..212134,
                     212176..212219,212276..212424,212515..212715))
                     /locus_tag="CND00790"
                     /codon_start=1
                     /product="glucan 1,3-beta-glucosidase, putative"
                     /protein_id="XP_024512697.1"
                     /db_xref="GeneID:3257201"
                     /translation="MVKLSPCPIILLSHFLIPAIASPVRPLAPLGNDGSVILNKRTTL
                     APGFTWGLDPMRGVNIGGWLVLEPWITPSIFEGKPDWVVDEWTYGVYMNNQSDTMDEI
                     TNHWNTWFSYTELHNIAAVGLNTIRIQIGFWSVIPLENGEPYLVGAYDYLKLAVTWAS
                     SLNLKVMVDVHGCPGGQNGFDNSGIRGVREWFTNDTNISRTLSTLQVLTAEFSQSFYN
                     NTVIAIELVNEPFPYSTSELNILKSYYQAGYRTVRSNDGASKVVVAIDEGFQGLQTWE
                     AFMQESSYNNVAMDTHIYTILDWYCGQQDYLVASNNVHWTIVGEFVPANTDCAYWLNG
                     RGVGSRYDNTLNTSAALQYPGNCDGKTGADPSKFSAEYVEYLAKSFETQTWVYEQASG
                     WVMWTWKTEQAADWSMQTGMTYGWIPTPIYSKPHGTPCASNTSAKATSGETRYRVDWW
                     LVLVPWVVLLLH"
     gene            complement(213354..217000)
                     /locus_tag="CND00800"
                     /db_xref="GeneID:3257344"
     mRNA            complement(join(213354..213642,213706..213995,
                     214049..214195,214244..214637,214703..214809,
                     214890..215068,215129..215619,215676..216571,
                     216618..216793,216834..217000))
                     /locus_tag="CND00800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570662.2"
                     /db_xref="GeneID:3257344"
     CDS             complement(join(213429..213642,213706..213995,
                     214049..214195,214244..214637,214703..214809,
                     214890..215068,215129..215619,215676..216571,
                     216618..216793,216834..216948))
                     /locus_tag="CND00800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570662.1"
                     /db_xref="GeneID:3257344"
                     /translation="MAAVKSHPPITILKRTREDQHLSQNKFLKKTARGKVINIFRERY
                     VRDDIPCGYQDCHQCAQFPGYKPVLPRTGYLQHTKFAGNGHYLVIDTNIVLHQMDLLQ
                     SLPAQLPLIIPSTTIRETRHRSLPLYNRLQQLIQDEDRLIWVWWNEERRETATVREVD
                     EEHGREKINDRNDRAIRQTVLFYAEHLSRLASNAPSLILLTDDAANRGLAAEQGIVAV
                     SAREYVDGLEPAEREKLVDLVVGGVDEIEVVERRSRRIYPDYLPQDTLLAGVKTGRYH
                     QGHFNANQYNYLEGTVNVPGLVRPVLLVGRQAMNRSVNGDVVVVEIFPETEWKAPREE
                     VVDQDIALRDDDVEDDESGGVADKEFVKEKQERLETDDAKKNKKEILPTGRVVGIVKR
                     NWRAYVCHLDRSSLSDSAFTSLAQQTVFATPLSRALPRIRLRTRQAPQLVDQKILVTI
                     DNWSPTSRYPDGHFVRALGKVASKEAEQESLLLEYEVPYRPFGKAILNCLPAEGDNWV
                     VPKKDMECLEWRDREDLRDLDICSIDPPGCQDIDDALHARRLPNGNIEAGVHIADVSH
                     FVHPDNPMDSEAASRGTTVYLVDKRIDMLPSLLGTNLCSLRPFVERLAFSVIWELNQD
                     AEVVDVRFVKSVISSKEAFTYEAAQLRKDDKSMNDPLTNSIRLLNHLAIKLKDARMRA
                     GALSLSSPELKIHLASSESAEPINVEQKKLLETNSLVEEFMLLANIWVAKKIQEVFPA
                     TAVLRRHSPPPKTNFEVLQDILMKRKGITLDVSTSKALADSLDACVIAGEPEFNTLVR
                     IMATRCMLSAEYFCSGSVSKESYGHYGLASPIYTHFTSPIRRYADVLAHRQLAAAINY
                     TPLHPSLQSKSHVERILSTVNKRHRLAQMAGRASVEFYVSLTLKGKGTGEEIGVRRKE
                     EAWVVRTFKNGLAVFVPKLGLEGLVTFHKELHTYDAENYTISVPSPSGEVVVAVFDKI
                     MVDISIEKDENTQRGKVKMIMVEPVDSDTL"
     gene            228723..229800
                     /locus_tag="CND00830"
                     /pseudo
                     /db_xref="GeneID:3257036"
     gene            260738..262233
                     /locus_tag="CND00840"
                     /pseudo
                     /db_xref="GeneID:3257037"
     gene            <274742..276722
                     /locus_tag="CND00870"
                     /db_xref="GeneID:3256925"
     mRNA            join(<274742..275051,275108..275205,275293..275562,
                     275636..275817,275921..276157,276249..276440,
                     276514..276722)
                     /locus_tag="CND00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_570328.1"
                     /db_xref="GeneID:3256925"
     CDS             join(274742..275051,275108..275205,275293..275562,
                     275636..275817,275921..276157,276249..276440,
                     276514..276694)
                     /locus_tag="CND00870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570328.1"
                     /db_xref="GeneID:3256925"
                     /translation="MPPRRYPLNTSASKNSQAALTQRSLIDPHLEPQEGNQSQTHISS
                     KYSKTLQSRTHAKKSLQQASSARPRGAGEAVGHDKCFGDEDSDSLDGIGEESGTDAEE
                     QELNGIESDDLESADDAESQRPHKALKANHRLSVFPQIRTTAEVINNNGRHSPRDGRR
                     PGDRLNRPVTVVRRNGVQCPSNPTAERASNASQQTSQETHSTGSRGISRGNSSSASAV
                     PIHDSTNTPLQNMEQTSSREIGQPSQITRDSVTDRSRFSPWPTTHICKDLPESPIDTN
                     IEEIYSILKAKQEYKSPFKTVLDRCCRLVARYYSIHTSSYTGGILCSLRYKHYLNSSI
                     LEMEEGEISPDIWFTNTTGDDILEKYAQFLDIEPAMLMMYYNDALSLAAQVLAPLRAL
                     PRLCWLIMSLLMKSKAFYLPLLGTKLMITLSMAPWLAISTTMPLTPSICIYRTYGRAS
                     HRSSHQPTYMMKKMWFFDSTIIAMTRKRMVASKLRSPLA"
     gene            276898..277542
                     /locus_tag="CND00880"
                     /db_xref="GeneID:3257307"
     mRNA            join(276898..276951,277005..277136,277201..277340,
                     277407..277542)
                     /locus_tag="CND00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_570682.1"
                     /db_xref="GeneID:3257307"
     CDS             join(277119..277136,277201..277340,277407..277506)
                     /locus_tag="CND00880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570682.1"
                     /db_xref="GeneID:3257307"
                     /translation="MYAASLVHFVLSVAPKIDNVDIAIHDTIYHSGIFFFRSLEEVEQ
                     QAIIDFYDGHARDDRGEGDGRISSMWQDLWRWRRSQQRRGE"
     gene            complement(278992..283664)
                     /locus_tag="CND00900"
                     /db_xref="GeneID:3256928"
     mRNA            complement(join(278992..279151,279205..279365,
                     279417..279536,279594..279668,279720..279758,
                     279818..279920,279983..280492,280538..281061,
                     281115..281238,281287..281529,281584..281911,
                     281965..282125,282174..282372,282422..282578,
                     282632..283283,283333..283664))
                     /locus_tag="CND00900"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_570324.2"
                     /db_xref="GeneID:3256928"
     CDS             complement(join(279101..279151,279205..279365,
                     279417..279536,279594..279668,279720..279758,
                     279818..279920,279983..280492,280538..281061,
                     281115..281238,281287..281529,281584..281911,
                     281965..282125,282174..282372,282422..282578,
                     282632..283283,283333..283455))
                     /locus_tag="CND00900"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_570324.1"
                     /db_xref="GeneID:3256928"
                     /translation="MMSTDKELYKLELLSLVSKVSQELFNHTKLQDKKLAEFVIALHE
                     QSKTTEAFQKKLNEIGADFPEWFVKNLDRLIVTMHPKYKRKAAKMKASKQSGKSDDGQ
                     SVMEEQKQLQARKFPGLSMPDQDWKPAEKYVDERAAKEPHETLPESLSTSDTMAQLES
                     IASRRNRPAAEDFLDGEPAAKKLRSATSSGHDGSSGRRGGYEGGSFRDSFRHGRPTVD
                     ERPVLYKIYNGTIANITDFGAFVTLDGVERKIDGNQRSNEGLIHVSNITNGRVNSPRD
                     FLKRGQRVKVKVMAVSPKIGLSMKDVDQNTGDDLSPHLTVKTAEEAAVQQQRMSSYAA
                     SGSNSTPLLAVDERQRSSAKRLSSPERFEIKQLIASGAVSAADYPDLDEDFSTNVANH
                     EIEEDIDVEVNEVEPAFLSGQTKVTLELSPVKIIKAPDGSLNRSALAGASLAKERRDL
                     KRLEANEQADAETREINQPWLDPMANQNERQFASDIKGNLLGQKAAQMPAWKAANKVV
                     SYGKITSMSIQEQRRSLPIYKLREQLVAAIRDNQILVVVGDTGSGKTTQMAQYLAEEG
                     FLEKGRLGCTQPRKVAAVSVAKRVAEEVGCRLGAEVGYTIRFEDMTSPETKIKYMTDG
                     MLLRELLVDPDCSKYSVIMLDEAHERTIATDVLFGLLKKACKRRPDLKLICTSATLDA
                     AKFATYFWGCPIFTIPGRTYPVETLYTKEPEPDYLEASLITILQIHLMEPAGDVLLFL
                     TGQEEIDTACEVLYERVKALGPQVPELLILPVYAALPSEMQSRIFEPAPPGARKVVIA
                     TNIAETSITIDGIYYVIDPGFAKQNAYDPKLGMDSLIVTPISQAQARQRAGRAGRTGP
                     GKCYRLYTEVAYRNEMLPNPIPEIQRTNLASTILTLKAMGINDLISFDFMDPPPAATM
                     LTALEQLYALGALDDEGLLTRIGRKMADFPLDPPLSKMLIKSVDYGCSEEALTIVAML
                     QAGGQVYYRPKDKQTQADAKKAKFHQPEGDLLTLLAVYNGWKNSKFSNPWCFENFIQT
                     RAMKTAQDVRKQLIGIMDRYKHDLVSCGTNYNRVRMAICSGFFRNAAKKDPTEGYKTL
                     VEGTPVSIHPSSALFQRPPEWCVYYELVLTAKEYMHQVTVIEPKWLSEVAPTFFRIAD
                     QNKISKRKASEKIEPLFDRFAADKDDWRLSKQKKAARSSQTFG"
     gene            283840..285724
                     /locus_tag="CND00910"
                     /db_xref="GeneID:3256922"
     mRNA            join(283840..283861,283945..284183,284282..284303,
                     284368..284502,284567..284673,284736..284855,
                     284917..284990,285052..285165,285215..285273,
                     285324..285724)
                     /locus_tag="CND00910"
                     /product="expressed protein"
                     /transcript_id="XM_570322.2"
                     /db_xref="GeneID:3256922"
     CDS             join(284037..284183,284282..284303,284368..284502,
                     284567..284673,284736..284855,284917..284990,
                     285052..285165,285215..285273,285324..285490)
                     /locus_tag="CND00910"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570322.1"
                     /db_xref="GeneID:3256922"
                     /translation="MSSSQTRKRSQRLKLPGGTATESARRQVQEVGAIAQDGLSSGAW
                     IYPLLGILYLFSHPTLIRPLLPIIFKGILMSAGVIAALFAFAYLPQVAILAVISGPLA
                     FALAIPLILGEAFVVVMFLTRGILVAQATVDIFDAVLLQKGHSVLVENGRQVTNKGGK
                     VKQLGTLMTKPLSRFNVDSVVRYLLTLPLNFIPLIGTIFFLGYNGYKAGPGFHARYFQ
                     LKNFDKDRRQAFIKKRRGAYLMFGTMAMALNLIPIVSIVFSFTTAIGAALWAAELESK
                     GKTPTAVSQSDANNSTGQQEEIEVQLPERAVNDQKKEL"
     gene            286183..287021
                     /locus_tag="CND00920"
                     /db_xref="GeneID:3256985"
     mRNA            join(286183..286288,286380..286751,286820..287021)
                     /locus_tag="CND00920"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024656953.1"
                     /db_xref="GeneID:3256985"
     CDS             286384..286749
                     /locus_tag="CND00920"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024512693.1"
                     /db_xref="GeneID:3256985"
                     /translation="MPPAPTVQQIQSLYSATVNASQRFTSYNFHKYFLRRADEVFKPV
                     LASLAPPAGSAPSDPIDPSRLAQFYEQQKTQLEILERASEVNRMYEGPKLVVEHAQPI
                     TSGGGAGMEASAGGGGQPE"
     gene            287029..288895
                     /locus_tag="CND00930"
                     /db_xref="GeneID:3256845"
     mRNA            join(287029..287593,287651..287762,287808..287944,
                     287988..288064,288140..288202,288269..288336,
                     288425..288895)
                     /locus_tag="CND00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656954.1"
                     /db_xref="GeneID:3256845"
     CDS             join(287131..287593,287651..287762,287808..287944,
                     287988..288064,288140..288202,288269..288336,
                     288425..288845)
                     /locus_tag="CND00930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512691.1"
                     /db_xref="GeneID:3256845"
                     /translation="MSPIMRLFGKAQKDQERDRAWTALADEEVGAKRKGSKEKSNHQS
                     AGAQASYSSSKLQLKPDDANDLDTQPFVATIPEFSKGKLLLWRLSIILPFLTAGCLLY
                     LLTCSTSSWRANWSSIKIELPSTEFESLYASGSTITRESSNSTPSRRDYANKVSAKPI
                     HNKRVNNTDDALGGHLSLNMWGWCLKSTEQTTAIMCSSESMWFSMDDLVDSSSTRSRE
                     LTTDTFNHFLVHALIVHGFAMLSTMLALIPIVLNTWRILRAQKPKINTSWFENISLSL
                     ASILCLISWIVNRCLQASVSSKLPDYNVDAGIASIITGVSSILLAAIFLVSAVPCLYL
                     HMRRQNQLLKYWMNLEDYDEAVARQHSSEAEKGNNKNYDMGNKGRSTRRPRPRRGLRD
                     HRLTKMIFGGGYDDSEKRKDKGRRREEQASQRRGRRSRRRDRRKYGHRRRHSRR"
     gene            289133..292065
                     /locus_tag="CND00940"
                     /db_xref="GeneID:3257365"
     mRNA            join(289133..289236,289316..289352,289412..289441,
                     289501..289607,289670..289824,289883..290083,
                     290133..290235,290284..290414,290468..291255,
                     291313..291385,291436..291554,291611..291772,
                     291830..292065)
                     /locus_tag="CND00940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570402.2"
                     /db_xref="GeneID:3257365"
     CDS             join(289199..289236,289316..289352,289412..289441,
                     289501..289607,289670..289824,289883..290083,
                     290133..290235,290284..290414,290468..291255,
                     291313..291385,291436..291554,291611..291772,
                     291830..291949)
                     /locus_tag="CND00940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570402.1"
                     /db_xref="GeneID:3257365"
                     /translation="MANFSSNDITAVNTIRTLAADVVAKANSGHPGAPMGMAPAAHVL
                     FTRFMRFNSKNPKWINRDRFVLSNGHACALQYILLHLAGYEVSMEDLKQFRQIDSITP
                     GHPEVGVTPGIEVTTGPLGQGIANAVGLAISQAHMGAVFNKENFSLIDNYTYCFLGDG
                     CLQEGVASEACSLAGHLKLGNLVAIYDDNKITIDGDTAVSFTEDVEMRFKSYGWNVLH
                     VEKGDDDLAAIEKAITEAKKSKDAPTIINLKTTIGFGSLHAGGHDVHGSPLKKDDIVQ
                     LKKKFGFNPEETFVVPKETSDLYHKVAESGAKAEAEWQALFKSYSEKYPKEAAELQRR
                     VEGRLPDGWEKALPTYTTSDAAVGSRKLSETTITKLVEVLPELVGGSADLTGSNLTRW
                     KGAEDFQHPSTGLGSYAGRYFRFGVREHGMTAVCNGIAAYGGIIPFTATFLNFVSYAA
                     GAVRLSALSHLRVLNVATHDSIGLGEDGPTHQPVETAAWLRAIPNLAFWRPADGNETS
                     AAYLVAILSQHTPSVFAFSRQNLPQLANSSIEKATKGGYVVEEVENADVTLVSTGSEV
                     ILCLQALEQLKSKGIKARLVSLPCFEVFNNQPKDYKLSVLPSGAPILSVEAYSTFGWG
                     TYSHDHFGLKAWGASGPYNKVYEKFDITPEGIARRAEKVVDFYKKRGQPVFSPLISAL
                     DDISE"
     gene            292492..295266
                     /locus_tag="CND00950"
                     /db_xref="GeneID:3257362"
     mRNA            join(292492..292796,292863..292876,292944..293045,
                     293117..293185,293245..293357,293412..293531,
                     293586..293771,293828..293960,294018..294080,
                     294130..294170,294225..294348,294398..294453,
                     294505..294654,294720..295266)
                     /locus_tag="CND00950"
                     /product="Aromatic-L-amino-acid decarboxylase, putative"
                     /transcript_id="XM_570400.2"
                     /db_xref="GeneID:3257362"
     CDS             join(292783..292796,292863..292876,292944..293045,
                     293117..293185,293245..293357,293412..293531,
                     293586..293771,293828..293960,294018..294080,
                     294130..294170,294225..294348,294398..294453,
                     294505..294654,294720..295082)
                     /locus_tag="CND00950"
                     /codon_start=1
                     /product="Aromatic-L-amino-acid decarboxylase, putative"
                     /protein_id="XP_570400.1"
                     /db_xref="GeneID:3257362"
                     /translation="MDIEEFRKAGYAAVDAICNYYEQLSQKPVKAEVEPGYLLEKLPS
                     EAPVKGEPFEQITAAFQNDILPGITHWQSPNFFAYFPSNTTFEGMLADLYAASVSNPG
                     FNWICSPACTELEQVVVDWVAKILGLSSAFWTDSKVGGGVIMGSASEAALTAAMAARE
                     RVLRILSKDANAVANEDIEIPEDVRQKYGQKLVIYGSTQTHSIGAKAAILLGLPFRAV
                     PVTAEDEYALRGDALRAAIETDVAAGLIPFLAIGTVGTTSSGAVDRIAEIGQVLKDYP
                     TMFLHIDAAWAGVAYALPECRDQLRLAEVNEYANSVSTNLHKWGLTTFDATLLFVKDR
                     HDLTQTFDVTPLYLRSKEADTGKVIDYRNWQIPLGRRFRSLKIWFILRSYGVEGFQRH
                     LTRGIEQCQKLASIVRASPDFELVTEPALALLVFRLVPGHTTQLSAETLNNLNKRLYN
                     RLDARKDVFLTQTALKSSNGNSVTCIRFAMGGVHTKFEHVQKTWEVVKEEGCNTIDEW
                     KKEEGNQ"
     gene            complement(295251..297537)
                     /locus_tag="CND00960"
                     /db_xref="GeneID:3257090"
     mRNA            complement(join(295251..296586,296651..297403,
                     297453..297537))
                     /locus_tag="CND00960"
                     /product="expressed protein"
                     /transcript_id="XM_024656955.1"
                     /db_xref="GeneID:3257090"
     CDS             complement(join(296686..297403,297453..297457))
                     /locus_tag="CND00960"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512689.1"
                     /db_xref="GeneID:3257090"
                     /translation="MEEFIYQNIVPWLPKDAQELLFSPPTFSDPSSFLPLFRLISPYV
                     GYFIIFVAFIIVWSTVSSIFGYFSRFLRISLRLAPLVGIAAWIMQASGQGSMGELMEL
                     AKQWSGLAPADNGARGAQASPGIAYLSSLFSGNQDGSSTSKGKKKATPRSKYSTRSST
                     KDKAFGQRGGASKPAPDSGADFISSLLSSAVGNGGEERAASSWQNMVQDYVKQSVLKA
                     SHLDWLFTPSEKKDIKKQAGTR"
     gene            297650..299021
                     /locus_tag="CND00970"
                     /db_xref="GeneID:3257458"
     mRNA            join(297650..297749,297803..297901,297956..297969,
                     298022..298085,298167..298242,298299..298337,
                     298389..299021)
                     /locus_tag="CND00970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656956.1"
                     /db_xref="GeneID:3257458"
     CDS             join(297676..297749,297803..297901,297956..297969,
                     298022..298085,298167..298242,298299..298337,
                     298389..298877)
                     /locus_tag="CND00970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512807.1"
                     /db_xref="GeneID:3257458"
                     /translation="MSTSPPAPPALAQWQVNNVPPAAYYIPDFITEEEEQYLIKKIGQ
                     SPQPKWKTVGTGRRLQYWGGTMSKTGVLLPEALPDFLTKFPDIISRIGKFLKLASPDG
                     PRLDINQVLVNEYNPGQGIAPHEDGPAFQPLVATISLGSHTVLDLHHYISSTSPSPPM
                     VATVSSTDKDSGSCARAVAAVPLAHLLVLPRSLLILSSSLYTSHLHAIAAKTQDSVMA
                     GGADDGDVVAVANAELLGDPAVMESLRNGGVWVKERGVRTSLTFRHAQKVIKGGALGK
                     VMGNMRRP"
     gene            complement(298118..299875)
                     /locus_tag="CND00980"
                     /db_xref="GeneID:3256976"
     mRNA            complement(join(298118..298872,298953..299875))
                     /locus_tag="CND00980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570690.2"
                     /db_xref="GeneID:3256976"
     CDS             complement(298956..299789)
                     /locus_tag="CND00980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570690.1"
                     /db_xref="GeneID:3256976"
                     /translation="MPTPPLPLFHQLLTALHIPINPPSLAAIPPSLLLLTLETILNTR
                     LPLPHSTRLCQTSGDELVVIKCVLGVLADDILGMDLSVVDPVNVVRGREHEMAVMIMA
                     LVVAARRRGVHITLPPPAKGDRRGDSRLGVEKVSSWLDDDEEDWEESASLRSALPPPI
                     LPDISLSSSETSVLDTSAGTSFTMQLPDDEFPYLKVTPDKRDYGRTQEGFVTPIMNRT
                     GVSKAHRLSSPSRQMITPSTGSKGNASARSPSLESSEEQGSGRTVLQYMLDELGLGLG
                     G"
     gene            complement(300071..302766)
                     /locus_tag="CND00990"
                     /db_xref="GeneID:3257405"
     mRNA            complement(join(300071..300299,300356..300404,
                     300460..300650,300710..300865,300920..301020,
                     301082..301176,301225..301327,301380..301519,
                     301572..301635,301695..301793,301844..302550,
                     302606..302766))
                     /locus_tag="CND00990"
                     /product="phosphatidate cytidylyltransferase, putative"
                     /transcript_id="XM_570424.1"
                     /db_xref="GeneID:3257405"
     CDS             complement(join(300177..300299,300356..300404,
                     300460..300650,300710..300865,300920..301020,
                     301082..301176,301225..301327,301380..301519,
                     301572..301635,301695..301793,301844..302550,
                     302606..302718))
                     /locus_tag="CND00990"
                     /codon_start=1
                     /product="phosphatidate cytidylyltransferase, putative"
                     /protein_id="XP_570424.1"
                     /db_xref="GeneID:3257405"
                     /translation="MSSHRGQPLFSGGMYELLNKGAAEHEEVEEEEEAPVETSPENPS
                     GSQSQTATLSKSARKRLARQASKGLDGKSKSNKQSGSETESPGTPSVPGAEEFPETNI
                     EAPIPQEAPKQQASSPAKTELEHSTTSPSQIPALEKQIPDIAPKKTKPVTAVPEKKEE
                     NKEQKKETPKKADAARSSSPPSSNFSPSLPATLPQPTGNALPANRKRKTPQDFTPAGP
                     GNVMNSASPSKIAVKFEDGLAPGEGKEGEKTIAPKKNRNMIERTIWTFIMIGGFIVLL
                     CMGHPYMILLVMLCQTLVYNEVTALFDLRDHGGSKAATPGEQGDSWNKTINWYFFVVA
                     NYFLYGESIIYYFKHIVFVDAYFIPFARNHRFISFMLYVVGFVGFVANLQRQYLRQQF
                     ALFCWVHISLLLIVVSSHFIVNNILEGLVWFFVPASLVICNDVMAYVCGKLFGKTPLI
                     KLSPKKTVEGFVGAFICTLLFGIAWGTFWMRYPYMICPARDLGTNVFSQVTCRPNPVF
                     MWHSFEFTGVARQALQTILGHPPPSIPYAPFQIHCLVMATFASLVAPFGGFFASGFKR
                     AFNIKDFGHSIPGHGGMTDRMDCQFMMGLFSYVYYSSLIRIQNVTVGGIMQAVVTSLT
                     QPEQIELLYDLKRFLAGQGVKV"
     gene            304264..306782
                     /locus_tag="CND01000"
                     /db_xref="GeneID:3256977"
     mRNA            join(304264..304895,304950..305049,305105..305197,
                     305250..305343,305394..305508,305557..305699,
                     305761..305842,305901..306109,306159..306225,
                     306275..306389,306443..306554,306599..306782)
                     /locus_tag="CND01000"
                     /product="protein-vacuolar targeting protein, putative"
                     /transcript_id="XM_570314.2"
                     /db_xref="GeneID:3256977"
     CDS             join(304307..304895,304950..305049,305105..305197,
                     305250..305343,305394..305508,305557..305699,
                     305761..305842,305901..306109,306159..306225,
                     306275..306389,306443..306554,306599..306739)
                     /locus_tag="CND01000"
                     /codon_start=1
                     /product="protein-vacuolar targeting protein, putative"
                     /protein_id="XP_570314.1"
                     /db_xref="GeneID:3256977"
                     /translation="MTSESEPNTSLPFSPIQQTLPATPSRSTSQVSMVSAEALLSHSS
                     PTKQLTPSHRSSLPSALPYNTLLNAPAGSPALRARASTASSSRAPSVLDDARVEHNDS
                     ETQVLEITPPMDNYELDGGSDHTSLPSDASSIKGKEKQRSNDRNEIETVGAGGEMALP
                     SGDARKGLKELVRRSTTADKGYGGHDHRRLSEKLSQNENLQILITQSDKMSYSPRLYY
                     VLTNAGKPVFCSHTRPSEDDVTNLMGVAQALISIFADDDDRLRYIIKGNHRVAFLLKA
                     PLYLFCVSDWGEPEHVLRLQLEYIHLQILSVVSSTQLLRLFQRRSNADLSTLLEGTEP
                     FLSNLIDCSQYDFSFLTSTLQPLRMAPALRDTSAAALMPPSKFKDLLYVLLIAGGHIV
                     TVLRPRKHSIHPSDLHLLLNTIASSSALRTTETWLPICFPKFNPSGFVHAYISYVLED
                     VGLVFVSADREAFEDLRVWKDMVLEKLEQDKTLSRIQEAIPLHPYTISSVGCPGLRHF
                     IYKSRQHVQITQPIWEAPYEDGSTNQKRLVTTYQKLHDAVHAKSGQASALKLVYISTE
                     HEACLVWATKPFELYITVSPQLSKSAVVAAANNVAKWVLAEEGRIFLKDAPVF"
     gene            307100..308287
                     /locus_tag="CND01010"
                     /db_xref="GeneID:3256945"
     mRNA            join(307100..307263,307358..307762,307817..307872,
                     307932..308027,308085..308287)
                     /locus_tag="CND01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656957.1"
                     /db_xref="GeneID:3256945"
     CDS             join(307226..307263,307358..307762,307817..307872,
                     307932..308027,308085..308140)
                     /locus_tag="CND01010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512688.1"
                     /db_xref="GeneID:3256945"
                     /translation="MGRGGGVSSRGRGKFKVARGGGRHFSRDLDPRFNKPVSESSEEE
                     SSEEESSEDETAQQNEQLAPEMAALNLKLGNTVALDDEDQEPGMSRAEKKAMKKAQGE
                     KKVTIQEPEDSGSESDEEEVMPAPVPKGKAKVAKKAEPVQMSRKEREAAEKKAAEQRY
                     QNLHAQGKTMEAKTDLARLQEVRARREAAAAQRKAEAEEKAQEAAAKKEKLLAKKI"
     gene            complement(307817..309213)
                     /locus_tag="CND01020"
                     /db_xref="GeneID:3257280"
     mRNA            complement(join(307817..308335,308390..308459,
                     308529..308844,308915..308960,309059..309213))
                     /locus_tag="CND01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656958.1"
                     /db_xref="GeneID:3257280"
     CDS             complement(join(308277..308335,308390..308459,
                     308529..308844,308915..308960,309059..309155))
                     /locus_tag="CND01020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512791.1"
                     /db_xref="GeneID:3257280"
                     /translation="MSSSNRPVRPSYTLKLANTKNEVEACYDIRMEVFCVEQGFTVED
                     EMDEYDPHSFHFLLTIPISSPPDVSTSSLPPTNDTPTTTEKPIGTIRFVPGKSKLTRL
                     AILKDYRKFGFGRVLVEGMENFVRQNAVKESLGKIIEEQGEKWITIKCHSQIHAIPFY
                     EKLGYVAKGPQFDEDGAPHQLLVHRLQVDDDYKSE"
     gene            309444..311366
                     /locus_tag="CND01030"
                     /db_xref="GeneID:3257443"
     mRNA            309444..311366
                     /locus_tag="CND01030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656959.1"
                     /db_xref="GeneID:3257443"
     CDS             310438..311094
                     /locus_tag="CND01030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512809.1"
                     /db_xref="GeneID:3257443"
                     /translation="MFHNAVIYYVPKGVKAILVKFGVSVCRVNEMGWWDEKLFEEESV
                     GSKDSFSILCAKVGQVDNFSETGLLEKGSMENIDVMTVASSISPHHLRVICTPALHNS
                     GRSLCQMDKTLWATWYLEYTLPNRSLWRCFFGGDTGYQAQPNGPVCPIFKGAYSAREC
                     SMQCDRPQADEAMNRDCAAVRPTRLGASSHRTRLGPPISLVHSSTHLWRFAPRFGSAL
                     "
     gene            311655..313640
                     /locus_tag="CND01040"
                     /db_xref="GeneID:3257474"
     mRNA            join(311655..311881,311936..312885,312962..313640)
                     /locus_tag="CND01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656960.1"
                     /db_xref="GeneID:3257474"
     CDS             join(312203..312885,312962..313430)
                     /locus_tag="CND01040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512687.1"
                     /db_xref="GeneID:3257474"
                     /translation="MPSSRFDPLENEVYNTDSVLALHDVELAVDEEILERTKRVQAAL
                     PRYASNRPRLYETPNPFVGIAHRLGSRRVRPIALELIQALGHLVDAVWLTTYPDRPCP
                     WIIGFDESPIQSSIKRLIMACQTADAYPSDVGWKSPMITAVQEGKRTGYVPTTIADSY
                     LQFCENEVAYAIGDVDQVVGVRKGAGYIFARALGAGEYGAPVRTNVLGVSGEGGGMAR
                     LLNDLEEAIWGDAPPRVTDLAYELPGDFDPYAIPDESELIVAAAAAGGGSSGHLTGHS
                     SSLADFFSGEPNTGVAAGANGYSILASRRESSQETGDTYDSLPDFDMTPSLSDVTHIS
                     TPVETAKNKLSGGLLPGIENIRGAEGMTLEELGRKRHQEWLANRAAIWE"
     gene            complement(313799..315699)
                     /locus_tag="CND01050"
                     /db_xref="GeneID:3257403"
     mRNA            complement(join(313799..313993,314053..314235,
                     314292..315094,315153..315501,315570..315699))
                     /locus_tag="CND01050"
                     /product="carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing), putative"
                     /transcript_id="XM_570422.1"
                     /db_xref="GeneID:3257403"
     CDS             complement(join(313871..313993,314053..314235,
                     314292..315094,315153..315384))
                     /locus_tag="CND01050"
                     /codon_start=1
                     /product="carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing), putative"
                     /protein_id="XP_570422.1"
                     /db_xref="GeneID:3257403"
                     /translation="MSAIRALNMRKTASALKAPVAFKRTLATPVNSLYTSVLPAKIPA
                     ALHLKSGQSYFGSSFGSENSKFGETVFSTSITSYTDSMTDPSYLGQILVFTSPMIGNY
                     GVPSNTSSQFPGIPFLESEKIQCTGVVVSDVALKYSHYQAVESLHEWCKRYDVPGITG
                     VDTRAITSLLRDQGTTLGRLAVGDEAGKPAPQEAEYWDPSKENLVAQASTKKAYVLNE
                     KGSGPRIAVLDFGTKANILRSLIRRDAVVTVLPWDFDFNTVRDQFDGLFLSNGPGDPK
                     MIMDSAMRVRQTINEWNKPIFGICMGHQVLGLAAGLEAYRMTFGNRGHNQPVLALASS
                     GSIKAGRVYVTSQNHQYALRLTEDFPEGWAPFFINCNDSSVEGIISTPESGKRIWGVQ
                     FHPESAGGPLDTIEMFTDFVNECDVSRKGFSGSAMIANEVKVDGHAAKAASVSA"
     gene            complement(315993..318193)
                     /locus_tag="CND01060"
                     /db_xref="GeneID:3257278"
     mRNA            complement(join(315993..316629,316677..316776,
                     316826..317051,317100..317180,317227..317280,
                     317330..317388,317439..317752,317800..317887,
                     317937..318053,318105..318193))
                     /locus_tag="CND01060"
                     /product="Golgi to vacuole transport-related protein,
                     putative"
                     /transcript_id="XM_570354.2"
                     /db_xref="GeneID:3257278"
     CDS             complement(join(316047..316629,316677..316776,
                     316826..317051,317100..317180,317227..317280,
                     317330..317388,317439..317752,317800..317887,
                     317937..317988))
                     /locus_tag="CND01060"
                     /codon_start=1
                     /product="Golgi to vacuole transport-related protein,
                     putative"
                     /protein_id="XP_570354.1"
                     /db_xref="GeneID:3257278"
                     /translation="MIPARPWSALSPVQALVEQTCDPTLPVPNDIANIELAELINRKK
                     ANSAREATTALLPHINSRNPNEALLALNVLDYLVKNCGYPIHLQISTKEFLNELVRRF
                     PERPPMVIGRVMGKILDLIHEWKNTLCVTSKYKEDLVHIRDMHRLLSYKGYRFKQFDA
                     ARALASANPNENLKSPEELEEEDRAAKSAKLQELIRRGTPRDLAAAQELMKALAGAEP
                     EKAVDYTAQTLKELDKVQAKAILLNDMLNNATQGEKIGIEGDVYDQVAGACRGARPRI
                     QKWIEDDNGEREGMMDRLLLCNDLINTALERFEACKAGDWTKAQAVVERNNPNQKVAD
                     LISFDVFDNEPASSSSGGVTLPADNIPSTSNVGMTTSGLPLDLFAPSPVATPSPAGSS
                     TVGAAGQKQKQDPMAFFSTASPQPQATQQWGQAQAQPTSAFGGLGGLQQPTPNTNNNN
                     FAFGGFQSSQSSSPAVGYSLSPQPAALSSQQFIQPQQPQQSQPQQQPQQQQQQQTKKD
                     AFADLVDLMS"
     gene            318308..319934
                     /locus_tag="CND01070"
                     /db_xref="GeneID:3257198"
     mRNA            join(318308..318401,318447..318855,318908..319152,
                     319201..319693,319746..319934)
                     /locus_tag="CND01070"
                     /product="NADH dehydrogenase (ubiquinone), putative"
                     /transcript_id="XM_570308.2"
                     /db_xref="GeneID:3257198"
     CDS             join(318383..318401,318447..318855,318908..319152,
                     319201..319693,319746..319815)
                     /locus_tag="CND01070"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone), putative"
                     /protein_id="XP_570308.1"
                     /db_xref="GeneID:3257198"
                     /translation="MSILRVAPALRAKAVPRAVPLVSKRNANDLSITSPPNPSASVRP
                     AIRYGPPTGGRSSDSGRTVTVFGSTGFLARYLIQKLARQGTQVIVPYRDEDEKRRLRP
                     CGDLGQIVPLEWDARIPEQTAECVKHADVVYNLVGRDYETRNYSYDDVNVKVAQSIAE
                     ISADMNIPRLIHVSHINANPESPSEFYRTKYAGERAVRDAFPEATIVRPSQLFGHEDW
                     LLNAIARYPILCKLNNGNTKLFPVHVVDVAQALNLMFDAPVTSTASTFVLPGPELYNY
                     AELERLVSALTLRPISSAPSLPKPVAKFLANLVNRGLWWPTISPDEVERMFIDDAGAE
                     AFQVHSPGPDGWNAPPRPQIVGVNGEPVKSWADLDMQPDTIAEHAIKPLRRYRSTVNY
                     DLPVETHIIKAPKQYHVLP"
     gene            complement(319963..321108)
                     /locus_tag="CND01080"
                     /db_xref="GeneID:3257265"
     mRNA            complement(join(319963..320288,320354..320428,
                     320491..320764,320836..321108))
                     /locus_tag="CND01080"
                     /product="copper uptake transporter, putative"
                     /transcript_id="XM_570353.2"
                     /db_xref="GeneID:3257265"
     CDS             complement(join(320153..320288,320354..320428,
                     320491..320764,320836..321100))
                     /locus_tag="CND01080"
                     /codon_start=1
                     /product="copper uptake transporter, putative"
                     /protein_id="XP_570353.2"
                     /db_xref="GeneID:3257265"
                     /translation="MHTCLQPENYPTFVFSLISHNSDLPITLSEELLSTSTTTTSPIM
                     DMGGMNMSMGGMSGMGGMGMDSGHGHSHSHMGSGHGADSAPACRISMLLNFNTIDACF
                     LSPNWHIRSKGMFAGSIIGIFFLCVLIELIRRLGREFDRWLVKRAGATSCGGEVSSVA
                     EYGKDGGQGGLLNVRTAAARYVPSWPHQILRGFIYGSQFTAAFFVMLLGMYFNVIVLI
                     FIFLGQTVGYMLFGRDTCGGGFDYAAQGRCC"
     gene            complement(321785..323405)
                     /locus_tag="CND01090"
                     /db_xref="GeneID:3257219"
     mRNA            complement(join(321785..322051,322106..323405))
                     /locus_tag="CND01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_570306.2"
                     /db_xref="GeneID:3257219"
     CDS             complement(322121..323293)
                     /locus_tag="CND01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570306.1"
                     /db_xref="GeneID:3257219"
                     /translation="MPPVPITFQFPIPAPSAAPRKRQTHKDGHRELTSIKPFSFTYDS
                     SSDTSPVTSHTIIGDDNVPNAKRSFARPTKRRKASVHVAPLASEQYVTVTPLYRPIIN
                     RCLAYVTSDESHADVHALTGHPYSPESDWGNTRSFNPSDLEVARSEKPKKLNRRELKE
                     KKEKEARAKRLVRELKGEAVEDEEEIPIIIEQTPTPSVQEDAPAADQPEKSKDKGSDS
                     ISKLSPPLSRAPLKRTRSFNALSQTGNGVHAASPLRAVIGANGHRNTDVQPAAKQPYN
                     RRSSATSVIEALGDRESRRAFTHSPSGTNSMPLPEIARPPKSVPLPAGVLQPPRTRGG
                     RSSSTALDAGTGEPTSMKNVASYGTIRSASVGLEGGLRERSRREVTLPNRLKDYEA"
     gene            complement(323601..324898)
                     /locus_tag="CND01100"
                     /db_xref="GeneID:3257206"
     mRNA            complement(join(323601..323913,323966..324234,
                     324282..324731,324783..324898))
                     /locus_tag="CND01100"
                     /product="expressed protein"
                     /transcript_id="XM_570352.2"
                     /db_xref="GeneID:3257206"
     CDS             complement(join(323727..323913,323966..324234,
                     324282..324731,324783..324812))
                     /locus_tag="CND01100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570352.1"
                     /db_xref="GeneID:3257206"
                     /translation="MSRRDAKPYSRPEVDGQWKHDLHQTAQSTLLDRIAPSPGQSLAS
                     RLTGGKKELFPDSSSSPSSGRAAGRGSNAGVELLPAGGPAAGQASTGRTRGGPVRGVG
                     VDQKSRELLNDALGVGARRSTRPQQPRKSQVSIMGAAKTTVWVRVENLAPGTTAEDVI
                     SAFAPLPILNATQSNPINSPTVSIDLELENRNDAEELIKQYNGVVADGNTLKVSIVNN
                     LKNRLGGGSAVKVGANMDNVAGQELLSSAKSSKLYSDMVLATDPNAAIITVADEPEPS
                     SFNAPRGREGRGGRGRPVNALAARMGNGGARGWAR"
     gene            325029..329137
                     /locus_tag="CND01110"
                     /db_xref="GeneID:3257353"
     mRNA            join(325029..325690,325743..326225,326278..326929,
                     326981..327781,327840..328032,328085..328105,
                     328163..328178,328235..328274,328347..328570,
                     328628..328672,328726..328860,328919..329137)
                     /locus_tag="CND01110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656961.1"
                     /db_xref="GeneID:3257353"
     CDS             join(325079..325690,325743..326225,326278..326929,
                     326981..327781,327840..328032,328085..328105,
                     328163..328178,328235..328274,328347..328570,
                     328628..328672,328726..328860,328919..329017)
                     /locus_tag="CND01110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512810.1"
                     /db_xref="GeneID:3257353"
                     /translation="MAPSVPPPQRHHSGDAHPLATPTRHSAHRPHAATISTSRPANAL
                     LDTPRSSRPPLNRKPSATAKPWDHLESLAKDELSIVDTRFDLMSDDELYEYLQHVPVA
                     PEDPTPHVELSAPVFPANERTSSPAGPLYTAQLPPSGDKSPLFPPSPPSLQNNAQITD
                     HPLRVLSRAVRELREVIERLEDENARLRMNQVERKPASGRATDQISIHDDLNEAISTS
                     LTSTPSLREIPSRTSALNIPQSELPSLSPTTSRFPAGFSPSSSNSIPFTSTPVDLPQP
                     DADAASINENHDRKSSRQSWTSGLWVWGNKKNSVTKRSSMGSVASVNQPVPPSPNAIP
                     RSTPEHEDEDEAWRKGDGGSSPSYRAIFLATRILTPDPSSILVPTETPPKPLIAQLAH
                     SLVSNARDEGIVAKEAVNRRRSRDLSRSRAISLGGQERSQTDEARNKDSKGYGDSALT
                     ATALLGRSLLSSVTGATIRGSRSGASVVNEETRPSVLSRGSSGHGFPVAAAPSSPAIS
                     HSAAVGSPLSEAAPLPSVELSSIVPDESRPPTVLLSRENLGSFFQSNRVNRAKMVTAS
                     RFESDKPPLTDRYGFIYDIQHAKMLKDASVAGTPAPMSLNGTLFKNDDPEEEGWIAKH
                     RRGSHGSQKSDSKSIKNTGDVRENSQLASPRPSIDSTSSSTQAPSRSSDTPESVASPK
                     TRSRSSSHADQHRHRSSTLLSLNPSPARPVTGKDHLTVSARGSSSLHSGVSPSITSTT
                     APQPISASLSKPIPPIETSTNVSRVTISSLLDQLTDLHDRQQKERVAEWDVFIKKRAK
                     SRAADKGHGWTAGLIGVSQMGLSGKGQEDWKTFSRLTRRGIPLKYRGDIWAECSGAKD
                     LMVPGEYAEILIVHKDDISPVMADIEKDVSRTFPGNVFFGGDGPGVEKLRRVLVAYSW
                     YNPGVGYCQGMNMVAATLLLTHSDEEQAFWILICIIDRLLPPNYFSPSLVGSRADQLV
                     LSQIVAQILPKLHAHFVALGVDLASITFGWFLSLFTDCLPVETLFRVWDLFFVEGHDS
                     IFRVAVAILKINEIEICNCKTVGDLFTFISAMTSRLWAADKLVSLQHNFKPIIRHTDI
                     TAKCEKASELLEKEAEGA"
     gene            complement(329097..330853)
                     /locus_tag="CND01120"
                     /db_xref="GeneID:3257254"
     mRNA            complement(join(329097..329336,329389..329451,
                     329508..329619,329677..329700,329767..329932,
                     329985..330182,330235..330853))
                     /locus_tag="CND01120"
                     /product="fatty acid beta-oxidation-related protein,
                     putative"
                     /transcript_id="XM_570351.2"
                     /db_xref="GeneID:3257254"
     CDS             complement(join(329215..329336,329389..329451,
                     329508..329619,329677..329700,329767..329932,
                     329985..330182,330235..330467))
                     /locus_tag="CND01120"
                     /codon_start=1
                     /product="fatty acid beta-oxidation-related protein,
                     putative"
                     /protein_id="XP_570351.1"
                     /db_xref="GeneID:3257254"
                     /translation="MAPPSSVPKEYRPGYLPPSITEQAQKDLPGKQKPLDPTPFNDVM
                     ADGSKYKPAGKLEGKNAVVTGGDSGIGRAVAILYALEGANVLFTYHPKEEADAKDTVD
                     DIKKRVPKAKVEAVAVEIQTEKACFELADKIKKWSGNELHVLANNAGTQKEIPNIEDL
                     PSEQWRHVFDVNIHSMFYLIKSLIPIMPWGSSIINNASINPFVGHPKLLDYTATKGAI
                     VGFSRALSNQIVGEKGIRVNCVCPGPIWTPLIVATMGEESLKAFGPGTPIGRAGQPIE
                     VATAFVFLASIDSSYFTAQCFHVNGGSAY"
     gene            331046..331685
                     /locus_tag="CND01130"
                     /db_xref="GeneID:3257327"
     mRNA            join(331046..331335,331394..331472,331525..331685)
                     /locus_tag="CND01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656962.1"
                     /db_xref="GeneID:3257327"
     CDS             join(331167..331335,331394..331472,331525..331648)
                     /locus_tag="CND01130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512811.1"
                     /db_xref="GeneID:3257327"
                     /translation="MNFVLLAIFFFPLAFAQFGHFFQQGFPFGGGFQQQQQQQEQQAP
                     GRQHKGWTESERVHCRAGYVCPASLACVPTPADCPCPYPEDIKCVVPDNRPRDEGEGP
                     PFFCVRGDTGCAQVLEFSKPI"
     gene            complement(331662..333258)
                     /locus_tag="CND01140"
                     /db_xref="GeneID:3257395"
     mRNA            complement(join(331662..331899,331949..332048,
                     332099..332322,332377..332753,332807..332927,
                     332987..333079,333130..333258))
                     /locus_tag="CND01140"
                     /product="URM1 activating enzyme, putative"
                     /transcript_id="XM_570420.2"
                     /db_xref="GeneID:3257395"
     CDS             complement(join(331688..331899,331949..332048,
                     332099..332322,332377..332753,332807..332927,
                     332987..333079,333130..333250))
                     /locus_tag="CND01140"
                     /codon_start=1
                     /product="URM1 activating enzyme, putative"
                     /protein_id="XP_570420.1"
                     /db_xref="GeneID:3257395"
                     /translation="MQVNQEASSSRRTAVEGLPLDPDEYERYGRQMIMPDFGLPGQVN
                     LKNAKVAVVGAGGLGCPVLQYLAGAGVGTIGIIDHDTVSMSNLHRQILHTTDRVGMNK
                     AESACQALRALNNKINLIPHPVPITPATALDILRPYSMILDCTDRPLTRYLLSDAAVR
                     LDVPLVSGAAISSAGQWAVYGGKTKSGKRRACYRCIWPSILPGSVGTCEEQGVWGVVT
                     GMVGVGMAGEAIKLIVGKEDPDPLLHLHHLGSNPLIRTIRIKPPSAKCITCGPNATIT
                     DDLDVFGYESFCAGGPETNDETGLVAGQSGHRISVQELDELLQFDKSKVTVIDTRPEV
                     EFGICSVPGSINMPLPSILSGPTDIQLTPDIVFICRRGNDSQIAAASLRKALDAKEDV
                     RVRDVRGGLKAWGREVDLNFPVY"
     gene            333424..336150
                     /locus_tag="CND01150"
                     /db_xref="GeneID:3257335"
     mRNA            join(333424..333560,333625..333701,333761..334058,
                     334118..334276,334333..334440,334525..336150)
                     /locus_tag="CND01150"
                     /product="prefoldin subunit, putative"
                     /transcript_id="XM_024656963.1"
                     /db_xref="GeneID:3257335"
     CDS             join(333492..333560,333625..333701,333761..334058,
                     334118..334276,334333..334440)
                     /locus_tag="CND01150"
                     /codon_start=1
                     /product="prefoldin subunit, putative"
                     /protein_id="XP_024512686.1"
                     /db_xref="GeneID:3257335"
                     /translation="MATTSSSKQMEVNPRGIPRAPFVDNVDEYVGGKDAEVQTTIKKF
                     EETTAKYRYMEISLQQRRKALLGKIPDITQTLQVVKYLHQRRQKTLGQPVEEEKLSDD
                     EDDLDDLDDEEAKKEEQPMKTLFELNDTLYAEAEIVETGEVGLWLGANTMLMYPLEEA
                     IDLLSSKLAAAQKSQDETIEDLEWLREQITVMEVNFARVHNWDVKRRREKGQIGQQSG
                     LLPSRKGNDKDDSEDERD"
     gene            complement(335984..339401)
                     /locus_tag="CND01160"
                     /db_xref="GeneID:3257393"
     mRNA            complement(join(335984..336694,336742..338176,
                     338224..338334,338383..338532,338588..338740,
                     338793..339071,339127..339231,339288..339401))
                     /locus_tag="CND01160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570418.2"
                     /db_xref="GeneID:3257393"
     CDS             complement(join(336429..336694,336742..338176,
                     338224..338334,338383..338532,338588..338740,
                     338793..339071,339127..339231,339288..339386))
                     /locus_tag="CND01160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570418.1"
                     /db_xref="GeneID:3257393"
                     /translation="MNAAQLLQDSLSSNQAARESATQQLEAAARDNFHGYLHTLATEL
                     ANESQGLDVRYAAGLAFKNGIAARDAINQPVLSERWLALPESATNPLKHLSLSTLGSP
                     QLRAGAVAAQCVSAIAAIELPVGKWPELIPQLLEFVQNQDNTGLRVNTLQAVGYICEV
                     IRPDILAAKSNEILTAVVQGARKEEPSHEVQHAAIQALYNSLEFIRDNFEREGERNYI
                     MQVVCEATQSPSVPVQVGAFECLVQIMHLYYEKMDFYMERALFGLTIMGMKHAEEPVA
                     LQAIEFWSTVCEEEIELTAQAQDALQYGDHPEIESKGFAKAALNDILPVLLELLSQQN
                     EDDDEDDWTKSMAAAACLQLLAQNIGDEIVGPVVPFVEAGITRQDWQHREAAVMAFGS
                     ILDGPDPMTLAPLVTQALGALISMMQSDPSLQVRDTVAWTLSKITETMLEVIDPSIHL
                     RNFITALVMGLNASPRTCNSCCAALNNLVMQISQPPELLTEEVQTTVMSEYYSGILKE
                     LMPIAERPSNQSNSRSAAVQTIATFLSFSANDTLPVVQEVAVAFIARQEALMGMHNQL
                     VGMDDRNNWNDMQINNCVAIAAFIRRSPALAAPFADRIMTNLIQLISASGKQSGVLEE
                     AFSTIGGLASALEAGFNKYMEAFAPYIITALGSHEDYSVAQAGVFITSDIARSVNEGL
                     QPYAESLMSSLIELLRSPIVARQVKPHAISAIGEVALAIGSGFKPFLEATMAILSQAG
                     STSAPPGDEAMMDFVQTMRESIVDAFIGIMNGFKDSEAGVMLPYAPGILSFLQTCWAD
                     EDRSEGFCSASLGLIGDFASAFKNNIKDQITQNWIQEAITSGRSRSASKQSKTNAAYA
                     QHAIKELLK"
     gene            339728..341174
                     /locus_tag="CND01170"
                     /db_xref="GeneID:3256953"
     mRNA            join(339728..339860,339913..340074,340124..340165,
                     340220..340276,340322..340371,340424..340697,
                     340751..340976,341030..341174)
                     /locus_tag="CND01170"
                     /product="ubiquitin-specific protease, putative"
                     /transcript_id="XM_570294.2"
                     /db_xref="GeneID:3256953"
     CDS             join(339765..339860,339913..340074,340124..340165,
                     340220..340276,340322..340371,340424..340697,
                     340751..340976,341030..341106)
                     /locus_tag="CND01170"
                     /codon_start=1
                     /product="ubiquitin-specific protease, putative"
                     /protein_id="XP_570294.1"
                     /db_xref="GeneID:3256953"
                     /translation="MADDPSGWSLTESDPQVFTQLLKDLGVNGLQVDDLYSLDAETLA
                     TLKPIHALIFLFKYVAPDAESAQESAGVEVDPLDNGVWFANQVINNSCGTLAALNAVM
                     NIKPQQSVHERESIKLGSELENLREFGAGMQSLDLGHVLSSSDHIREVHNSFSKSSPF
                     AMDPSAFPEREKEDAYHFVAYLPINDILYELDGLRRFPIMHAPVDGDWLDTARETIEQ
                     RIATYPPGSLMFNLLCVRSDAIPRLERLLNDPSTPAEQKFVIQDQLEHERNKSQKGAM
                     ENSLRRHNLLPVVFQLFKSLGESGMAAKAVEDARTKGKERRERMQAKGEAE"
     gene            complement(341171..341969)
                     /locus_tag="CND01180"
                     /db_xref="GeneID:3257392"
     mRNA            complement(join(341171..341476,341584..341639,
                     341737..341794,341902..341969))
                     /locus_tag="CND01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_570416.2"
                     /db_xref="GeneID:3257392"
     CDS             complement(join(341246..341476,341584..341639,
                     341737..341794,341902..341925))
                     /locus_tag="CND01180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570416.1"
                     /db_xref="GeneID:3257392"
                     /translation="MASILRLSAQKAPVAFARSFSVSAVKMDLVQDLYVNQLKSYKPA
                     AKAADAHVGSVRSFAAPKAPSAPSLPTDLASELSKFDAEEPTIGGSAPKTSASSEGGE
                     SVEEYLTFLEKDLPKADAHH"
     gene            342177..344058
                     /locus_tag="CND01190"
                     /db_xref="GeneID:3257380"
     mRNA            join(342177..342266,342323..342384,342444..342556,
                     342608..342710,342762..342935,342990..343193,
                     343244..343734,343793..344058)
                     /locus_tag="CND01190"
                     /product="flap endonuclease, putative"
                     /transcript_id="XM_570406.2"
                     /db_xref="GeneID:3257380"
     CDS             join(342254..342266,342323..342384,342444..342556,
                     342608..342710,342762..342935,342990..343193,
                     343244..343734,343793..343994)
                     /locus_tag="CND01190"
                     /codon_start=1
                     /product="flap endonuclease, putative"
                     /protein_id="XP_570406.1"
                     /db_xref="GeneID:3257380"
                     /translation="MGIKGLTGLLSENAPKCMKDHEMKTLFGRKVAIDASMSIYQFLI
                     AVRQQDGQMLMNESGDVTSHLMGFFYRTIRMVDHGIKPCYIFDGKPPELKGSVLAKRF
                     ARREEAKEGEEEAKETGTAEDVDKLARRQVRVTREHNEECKKLLSLMGIPVVTAPGEA
                     EAQCAELARAGKVYAAGSEDMDTLTFNSPILLRHLTFSEAKKMPISEIHLDVALRDLE
                     MSMDQFIELCILLGCDYLEPCKGIGPKTALKLMREHGTLGKVVEHIRGKMAEKAEEIK
                     AAADEEAEAEAEAEKYDSDPESEEGGETMINSDGEEVPAPSKLKSPKKKAPAKKKKVA
                     SSGMQIPEFWPWEEAKQLFMKPDVVNGDDLVLEWKQPDTEGLVEFLCRDKGFNEDRVR
                     AGAAKLSKMLAAKQQGRLDGFFTVKPKEPAAKDTGKGKGKATKGEKRKAEEKGSAKKK
                     SKN"
     gene            344217..346414
                     /locus_tag="CND01200"
                     /db_xref="GeneID:3257376"
     mRNA            join(344217..344512,344604..344686,344744..344995,
                     345045..345298,345353..345411,345470..345627,
                     345682..345889,345944..346414)
                     /locus_tag="CND01200"
                     /product="homocitrate synthase, putative"
                     /transcript_id="XM_570408.2"
                     /db_xref="GeneID:3257376"
     CDS             join(344303..344512,344604..344686,344744..344995,
                     345045..345298,345353..345411,345470..345627,
                     345682..345889,345944..346195)
                     /locus_tag="CND01200"
                     /codon_start=1
                     /product="homocitrate synthase, putative"
                     /protein_id="XP_570408.1"
                     /db_xref="GeneID:3257376"
                     /translation="MCPPADEPINAGADQDMVAIETNTPHISTSSANQVNGTTGTAEA
                     QPPAVKTHKGLYGRASDFLSNTSNWKIIESTLREGEQFANAFFTLETKIKIAKMLDEF
                     GVEYIELTSPAASPESRAHCEAICNLGLKRTKILTHIRCHMDDARLAVETGVDGVDVV
                     IGTSSFLREHSHGKDMTWITKTAIEVIEFVKSKGIEIRFSSEDSFRSELVDLLSIYRT
                     VDKIGVNRVGVADTVGCADARQVYELVRTLRGVVSCDIETHFHNDTGCAIANAYAALE
                     AGATHVDTSILGIGERNGITPLGGLIARMMVADPEYVKSKYNLTMLRELENFVAEAVE
                     VQVPFNNYITGFCAFTHKAGIHAKAILANPSTYEILNPADFGMTRYVSIGHRLTGWNA
                     VKSRVEQLNLKLNDEQVKDATAKIKELADVRTQSMEDVDMILRIYHTGIQSGDLKVGQ
                     SAVLDRLLEKHMPSRDNSPSGRSSNADGTPAKRQRVGEPSA"
     gene            complement(346374..347378)
                     /locus_tag="CND01210"
                     /db_xref="GeneID:3257386"
     mRNA            complement(join(346374..346698,346745..346944,
                     347000..347378))
                     /locus_tag="CND01210"
                     /product="ubiquinone metabolism-related protein, putative"
                     /transcript_id="XM_570414.2"
                     /db_xref="GeneID:3257386"
     CDS             complement(join(346461..346698,346745..346944,
                     347000..347317))
                     /locus_tag="CND01210"
                     /codon_start=1
                     /product="ubiquinone metabolism-related protein, putative"
                     /protein_id="XP_570414.1"
                     /db_xref="GeneID:3257386"
                     /translation="MSSIKSDNIRRTVASRLPTYRTLVSHAYSPPPRSSSFKPPSDSE
                     ISQSSIEATTETPGNLTEEQKKLIERIIRVDHAGELGANWIYRGQKWAMDVKGDNKTA
                     RQVEEMWENERHHLKTLSLLSAQHRARPTLLYPLWQTMAFALGAGTGLMSKEAAMACT
                     EAVETVIGEHYDDQLRELEPMLNPPKDGASSAQPHPSVPLMASILREFRDDELEHLDI
                     AVEEGAQKAPGHSLLSAVVGEGCKLAIKVCQKI"
     gene            complement(347633..348862)
                     /locus_tag="CND01220"
                     /db_xref="GeneID:3257271"
     mRNA            complement(join(347633..347727,347780..347825,
                     347879..347968,348031..348118,348179..348242,
                     348433..348492,348564..348619,348700..348705,
                     348765..348862))
                     /locus_tag="CND01220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656964.1"
                     /db_xref="GeneID:3257271"
     CDS             complement(join(347717..347727,347780..347825,
                     347879..347968,348031..348118,348179..348242,
                     348433..348492,348564..348619,348700..348705,
                     348765..348805))
                     /locus_tag="CND01220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512702.1"
                     /db_xref="GeneID:3257271"
                     /translation="MSTEDLLKDKFYLRYYTGHQGAHGHEFLEFEYSYGRIRYANNSN
                     YRNDSLIRKEMFVSPAVVDELKRIVRESEITKEDDVAWPRKNVVGKQELEVRIDKEHI
                     SFETAKIGALAEVNDSSDPDGLRVFYYLIQDLKCFIFALIQMHFKIKPIQS"
     gene            complement(349137..351697)
                     /locus_tag="CND01230"
                     /db_xref="GeneID:3257241"
     mRNA            complement(join(349137..349995,350058..350167,
                     350225..350544,350630..351112,351172..351335,
                     351389..351519,351569..351697))
                     /locus_tag="CND01230"
                     /product="meiotic recombination-related protein, putative"
                     /transcript_id="XM_570348.1"
                     /db_xref="GeneID:3257241"
     CDS             complement(join(349336..349995,350058..350167,
                     350225..350544,350630..351112,351172..351335,
                     351389..351519,351569..351650))
                     /locus_tag="CND01230"
                     /codon_start=1
                     /product="meiotic recombination-related protein, putative"
                     /protein_id="XP_570348.1"
                     /db_xref="GeneID:3257241"
                     /translation="MRVTKTLLYTFLAVAATSDAKLFGKEKPAYEDWSLDKSVAFLKE
                     QGVAIKDSATLPEIQKQVAAHADAAAKWGAGSAGAAQGYYEGVSEKLLSTWTESQLRE
                     WLLEQGVVSPSSGREELLVKAKQHLSAASTAVYGHPTAQAASSVSSAANGYYNAAASQ
                     AVHASATVQKAFDDAKDYIFSTWDDNQLRTWLEEHNVVSTPEPTGRAALLNNVRVAYL
                     KVTDPFYEAWSTSRIHEWLVEHGIVHPEPTAREKLLELMKDNYYDAKDTAYSRWSDSQ
                     MRDWLISEGVISTEAAELKREKYEKLLDEHYTRAKSTVWSGWEDSEIRDYLVQHGYIK
                     SDYEAKRDDLINLISNKYHGATSAPYLAWPDARLRAQLRSYGIDDTKFSGRQSLLHEV
                     RIHYVQSQNKVEQILAAIRETISHGVEFAEDKLSNVLEILTASKLTAEEKLDRAYASV
                     SSVYQAAITSASSAANAYASSASSAASVASVSAISSASSASAAAESAAYSISSSLYSQ
                     ASAASKAAAKSANSPALTSSASAASKSASSHAHYASSSAASVASSVSHAASLAAHSAS
                     LSASSASKAASLSAVSATNAAAESSASLSRSLSSAYTQASKSAFSASAVAASKASSAS
                     KSAASYSSSLSSVSASASKSAKNEL"
     gene            352372..355261
                     /locus_tag="CND01240"
                     /db_xref="GeneID:3257135"
     mRNA            join(352372..352504,352583..352891,352952..353356,
                     353411..353594,353652..354554,354609..354936,
                     354998..355261)
                     /locus_tag="CND01240"
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase, putative"
                     /transcript_id="XM_570292.2"
                     /db_xref="GeneID:3257135"
     CDS             join(352421..352504,352583..352891,352952..353356,
                     353411..353594,353652..354554,354609..354936,
                     354998..355088)
                     /locus_tag="CND01240"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase, putative"
                     /protein_id="XP_570292.1"
                     /db_xref="GeneID:3257135"
                     /translation="MSLAPRKRRTDRNESPSLPVRSYSDDDKQRTPKPPLSAPYLRHE
                     YIISWSTATALTVVACIVRFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAK
                     MLNGLAAWFVGFDGNFGFDQIGDSYTEASVPYVGMRSFCAILGTLTIPVVYAIMRESG
                     YPVGIAAFSAALILFDNGHITQTRLILLDAHLVLFMALSLFCYVKFHQYRYQEFSRAW
                     WGWLLATGFWLACTLGCKMVGLFTFATVGAAVIWDLWEILDIKKGHSMSYWTRHFCYR
                     AIGLVIVPFFVYLSFFWVHFKILKFSGPGDSFMSPAFQETLEGNELLLNAQEIRYYDT
                     ISLRHKDTKQYLHSHEERYPLRYDDGRISSQGQQVTCYPHNDTNNHWQVIPTKEIPES
                     GRGRIVRHNDVIQLKHVNTQTLLLTHDVASPLMPTNQEFTTVSPDKEDKRNDTLFKMV
                     LDDAHDGEAWKTLSGHFRLIHVPTKVALWTHPKALPEWAFGQQEVNGNKNAAERSTLW
                     FVNDIVEDGQGFDFKNRTVHVEPKAVKKRAFIKKWFELQVLMLQHNAGLTSTHPYQST
                     PIEWPFCLSGISFWTRNEGQQQIYMIGNLLAWWICAVSVSVYVGVVAADMLARRRGIH
                     PIEDGVRNRLYRNTGFFLGAWAFHYFPFYLMNRQRFLHHYLPAHLASVLVAGSVMNFI
                     LIEAVNYPISIAGPTTRLRPAVRAKLNKSAKMVIAGLLVVVIGVYLFLSPLTYGQSMT
                     GEEVNRRKLLSTWSLHFEAKKTHSMDE"
     gene            complement(352613..355840)
                     /locus_tag="CND01250"
                     /db_xref="GeneID:3257264"
     mRNA            complement(join(352613..353884,353937..354542,
                     354596..355312,355425..355446,355566..355656,
                     355713..355840))
                     /locus_tag="CND01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656965.1"
                     /db_xref="GeneID:3257264"
     CDS             complement(join(355253..355312,355425..355446,
                     355566..355656,355713..355725))
                     /locus_tag="CND01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512684.1"
                     /db_xref="GeneID:3257264"
                     /translation="MAGPGFHPHPPSLLHRGLAKALGASMWFFIFYRARQDGPALIGL
                     RHPWDGHGHGHGDEGHH"
     gene            355936..361287
                     /locus_tag="CND01260"
                     /db_xref="GeneID:3257309"
     mRNA            join(355936..356110,356160..356644,356705..359719,
                     359768..360275,360326..360432,360483..360523,
                     360580..361287)
                     /locus_tag="CND01260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656966.1"
                     /db_xref="GeneID:3257309"
     CDS             join(356094..356110,356160..356644,356705..359719,
                     359768..360275,360326..360432,360483..360523,
                     360580..360990)
                     /locus_tag="CND01260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512710.1"
                     /db_xref="GeneID:3257309"
                     /translation="MNSGHQWPQQDGYQHGLHQDHQRTSPPPATADSYTSTLPPLTTT
                     TPIPPVSQILRSSPPNKKLGPTWSVRSSPPSSRSSSLSNAAPFPPIQALPPPMSHQPL
                     PQSLSPPRTSLVSPNPVYPSPNRPRWATRPPSPQPPPSSLDAMLQRGAGPHSQLSATR
                     RLSAAHPAQTFGLPEHPPLQPLHLHATEADREGPLPKANANDGTGSSERITTIPLRRE
                     SPEPSSHMPPLDEPVEVSRPPTPPLPLPSPAHPPSDRPPTPPLPPNLASPPPTASPRP
                     PTPPLNPPPESVPPVNHLHPPDRPVNNPNRVELDAGTLTQAFSLENYDAGRFVSAIRA
                     QRQAHHPANPHKRKSNILASPESHTPEIKGIKSVPTSRPPKQKAKRSRIRQSLPSQDH
                     PVPERVPFPLPSRPFGYPEGAVPSGLDGPSAPSSSTAGPGPVASGSGVRRNRPNSLPP
                     ESVEGLSMGSISDQSPATQTVTTLPNVGSALPPTIPVHPPVPVGRRVPFDPRIPSDPR
                     IPAEPRVSCDTLFPVDPRMPVGSRVVTDSRTSIKPRALFASRAPIDPDVPLDPRAPVD
                     PRTRRPGSRPVSRQSTPVSVINGKQEAINLPQGPTSMHRSESKGTSVIPPRKYHGNQP
                     AQQIALSHPGVAHVAANIQSASALQSLQGKPLSQSEAFLAARAEMEAKKFSGDPHNHI
                     SSNLSGSAEGRHKSAGISAVGHKVQHDAQADDDNEPKHFRLPKHLLSLFKMNKGLTDS
                     ISESTASSDAEPPKSAMAATVGSATVDAVTVEPATVESATVDAVAIEPATVESATADA
                     VAIEPTPKTQPIDDAPVAESSRPSDPKPSSVPLLEEPREQPKVPLPLPSGVKSDSYPS
                     AARKKLFASVHGSDPPARPLKKRKGPATSRKRKQAPVPPEISLAHVPPARTSEPRAPR
                     KIKKVINISSGLFPPAVIEDIEGLPNQSTPLFDALDFGRQEEEPDDREMRADGDSSVD
                     SKNLVARPRDRSSSVSSQATRLLQPSFGQVREPLFLSKSPTLSPNSPAQTVKIEVDIK
                     FDEPDPAVRADPGAGPSSIGLRSAQVDENGVITVSDQWPDESRAVVGPSGADQADELL
                     MRYQLTVDRESTPASLDIVLSRSSTEERFTETWSSPEIPLASLKSKNLQAWSWRDKSH
                     DSLDRLSVVLPISKARRRRLIQRGIYNPSEDDASEDELKHPAGREKAHREPPPMAAPH
                     GMADYQRSTQAATSRSSLRTLYTVIPREGSPYNVRVRSPSPLASRLPPGVPPVPEMYQ
                     DVLNETLLDRCTARECRWDDCNAVLGSENTLGMHVHRHLANEEGAKDTWKMQLGMSSW
                     IFTGYKGGRMKTEAVPNEYLYKCLWRKCDEPCFTTKEKLLQHMLSKHVSGKLICPYGW
                     CRYACPSANTLARHITKIHAKTNDRPRPMLLPSSLRRLSPPTPLPLPMSVPSYLLQCT
                     ALPRPCRSVRELKRLREEIIDFCATPDHPVMAAWQENDDDVKMKHMLDASSPAKEPMT
                     YIDNYEYSQEDDASEYEQGGGRTTSSSEDSGDG"
     gene            361464..362768
                     /locus_tag="CND01270"
                     /db_xref="GeneID:3257410"
     mRNA            join(361464..361724,361783..361860,361925..362058,
                     362114..362768)
                     /locus_tag="CND01270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570641.2"
                     /db_xref="GeneID:3257410"
     CDS             join(361524..361724,361783..361860,361925..362058,
                     362114..362612)
                     /locus_tag="CND01270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570641.2"
                     /db_xref="GeneID:3257410"
                     /translation="MFSDMPVYPGAAFIASVLGVHGYRKGSLSQSGAIAAFCVGYGHL
                     ANPVKLFGVTMIGMYLIGSRATKVKADVKAKLEDGPDPSKSGGNRTWIQVLASSLPGL
                     VAALLYRFGPASQLDKANVVLSLHPLSRPLIYTSLGLNATILADTLASELGILSSLPP
                     LHIITFQRVPPGTNGAISSLGTWASAFGGAAIGITQVIDLLIENPACRTSGWTWAGEL
                     VAVGASLGLLGSILDSLLGATLQSTYYNVEDKRVITDASPNYHTSTQRVEGVKRIGGG
                     IDLLSNSAVNFVCGCILAGTGWWYGSK"
     gene            complement(362738..367808)
                     /locus_tag="CND01280"
                     /db_xref="GeneID:3257238"
     mRNA            complement(join(362738..362919,362974..363200,
                     363252..363459,363508..363745,363797..363942,
                     363995..364317,364366..364603,364657..364789,
                     364848..365009,365061..365384,365431..365944,
                     365993..366238,366291..366614,366672..366742,
                     366794..366890,366953..367060,367130..367808))
                     /locus_tag="CND01280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570346.2"
                     /db_xref="GeneID:3257238"
     CDS             complement(join(362806..362919,362974..363200,
                     363252..363459,363508..363745,363797..363942,
                     363995..364317,364366..364603,364657..364789,
                     364848..365009,365061..365384,365431..365944,
                     365993..366238,366291..366614,366672..366742,
                     366794..366890,366953..367060,367130..367640))
                     /locus_tag="CND01280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570346.1"
                     /db_xref="GeneID:3257238"
                     /translation="MLSSLPSLSRLSHIADSSHSQQANQYSTQIMPSSNQVQPYLSGQ
                     VGVPVQQGVYPQLPGTQPYPQTPYNPYGGTAPGMGTVGAPISQNQALSQPFAPGSGAV
                     GQPYPSQPVAQWNRYITPLQAPQSLESVSKDEDPIYGPLGRASGKVERGLRGDVDISA
                     DLEEKLGPSAQIQDPYAAPPSASAAYKCCSVTKRTPLPDALHQELNFKHLTAKMGLFE
                     EIERAWFTVDNKLFLWDYGDGRDFSRYDEQTDTIQAVGLVKARKDVFVDDITHVLVIC
                     TSTKATLLGLSRSLTSREILLYHTNLTVDTPTVMVDIKGTDEGRVFVLGANKDLYELD
                     YSSDSSWLFGSSTSVRLKNRTSGGVSNWVPSVVASKVKAGIESFAVDSQQKRLYTLHT
                     GGEIEFYDVSANRFDLRSKYNRLKHDLNRDPRGGAVTIVSISAIGGHESKRACLVAIA
                     SNGVRAYFVSTPSFYPIILRAPPPLQLGLSVSDQSIYTSGTFIAVQYDPNAPLTQTHL
                     TFAIPQSGRQSALRENYETLEPPVFQEWTATEIVPSQVWAIVELSDANPKNSPASLRR
                     SDGLALSALPRQAEAGPRGFLVLAASGLFWVDQPRPVDILKANLEIEKDVAVNTIRMT
                     FGKTQLAAMALLLGSTPETKHPDLISSLSTILLTSGEPVVKDSTGGKTITYSSRHDGL
                     ALAIARYLRPIWSAKVTLPLVGGKQILGIKETVLSKVQANLESLRRYLEEHPFQSYQV
                     EGEAKIAWAQEEMSLHGLNILLKQAVEAISFVLLLSDYKITDIVAKCDPVTQSALASL
                     TFESLITSLDGRAVARKLVTALIEQQIGQELGIDTLSEILQQRCGTFIQPGDVVQYKA
                     EESMRRAEATRDPLEKTESLAESLRLFIRAAGSIPIPRLQEVSERYRTLNYTLGAIEL
                     ALRTASDLDPHKKAIDFVRDGEHPADPRKALFEARKECYAEVIKALKVADDRLDKAVA
                     EGDAATATQNRNEAYALAIASDDELFHFYLYDWQVERGLQEQLLEFDTPFIEDYLKIT
                     ISNVEDRRDLLWKFYARREQYLPAAEALSSLATRPSPMPLHDRLYYLAQALTSAKSAA
                     SLGSEDVEFTSRLQEQIDVAQVQMEVARAVEVHPEMTGEEKLEVLASLNDGLLQLDEL
                     YQNYARPFRLYEPILLILKTADTRVDDVCEAVWRQLLGSAGKIGGAAGVSEVVKSLGR
                     RYFPSEAAPMDIMIPVVYAEAAGYPGSPGWASTTLLDAGVPLRDLWEAVTGLYENSDD
                     EEREFYAEQISILAQRWMSQMDEIPAAEIERFASAYILRTNGASDDSTRAIRDKLLAA
                     KQAAVKY"
     gene            complement(367959..371317)
                     /locus_tag="CND01290"
                     /db_xref="GeneID:3257190"
     mRNA            complement(join(367959..368388,368443..368567,
                     368628..368909,368963..369179,369235..370049,
                     370103..371133,371179..371317))
                     /locus_tag="CND01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656967.1"
                     /db_xref="GeneID:3257190"
     CDS             complement(join(368274..368388,368443..368567,
                     368628..368909,368963..369179,369235..370049,
                     370103..370426))
                     /locus_tag="CND01290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512683.1"
                     /db_xref="GeneID:3257190"
                     /translation="MIPQGFSFSHSVDSAYRSYYDHRPASYQARLPPLKYSTPHELRG
                     APRRHRDGEPASLTSEMGACVRPIYPADYTESCYMEALQEEISGVLDRMESLHKIEGV
                     AALSYLPPTPVDFPHSTSRESNSIIRCPEPIIHLSTPFTPLPNICFATPSSLEAKAII
                     QERRPFPDEFHSYLSEIFFESNVTGLDLEGEGEDGVETTLRMPSGNNGKQEHLFSGHT
                     SLLAQGIFNDTVIPSSSSQEMMPQIIRRHSLATMDATVYEQSSSGASNPFSRSYDTQG
                     DPFAPSYVLARERAKLYKHASISSARRTSEPLVRASCKLEDIKPKSKPVKETTLEPSL
                     PVKAKEGYRSLTASLGVTSFDEMKSNNSPSIDSERKHFLSSNVYKLNPVTQSLGRGKA
                     LPLLTPRRPVPDKVQLPTPTTTPKISLKLGKRAGHVKSTPKTAGVSEGKAMERDAKAL
                     YPTPPSCPASPFSMSGASRLKKASISAPTPTPLFESPTINKGKKRKRRLSSKLKAMEI
                     GEDESDGNFASHKSKKLRTLKNTRHSEDVEVFKYTKEEDNIILSHWDGCPPLPANILS
                     TIQKDLVSRGFVARSLPALKFRVYNSLREQFEEKRLQMDRKRTKQESRRSRESRNSSR
                     P"
     gene            371482..374173
                     /locus_tag="CND01310"
                     /db_xref="GeneID:3257312"
     mRNA            join(371482..372067,372122..372209,372261..372276,
                     372329..372534,372586..372993,373053..373085,
                     373141..373210,373266..373338,373390..373602,
                     373656..373680,373736..374173)
                     /locus_tag="CND01310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570378.2"
                     /db_xref="GeneID:3257312"
     CDS             join(371907..372067,372122..372209,372261..372276,
                     372329..372534,372586..372993,373053..373085,
                     373141..373210,373266..373338,373390..373602,
                     373656..373680,373736..374032)
                     /locus_tag="CND01310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570378.1"
                     /db_xref="GeneID:3257312"
                     /translation="MSNQPIAIPMDMEGTLEYTPSRHSQETHHKSQYVFKRQKKEMPL
                     PSKRMAITMLCVLFLVMFLAGWNDASQGPLLPSLQLYYNVDYLVISIIWIMNFVGFMI
                     AGLTNVLITDRFGFGIAAPFGASMQAVAYALICWGCPYPLFLIAYIFNGFGLGLQDAQ
                     VNSLTSRLPNASTKMFLMHAWYGFGATVSPFVSTAFVQHVQQRVYLYFAVSLGLAIVT
                     MIFLISVFRLRTDDQVVGKREETDQKSPASSDVPAAVNSEGQLSEKKPKQNSGSKMKR
                     IMKTPVVHCMAFYMVIYVGVEVTIGGWATSFLIDERGGDDNAGYVSAGYFGGLTLGRV
                     ALIPVSNWLGPHISIWLYTVLSIVLSIVIWVTHSIVGNAICFSFIGVLLGPMYPLVMN
                     VVVEVLPGELQGGTIGWIASLGQAGSAIMPFITGAISEKHGVWILQPLIIAFMCASLL
                     LWMFVVRASHPNRSFWCIPRAVTAQPDKEGVHHEVPLESRVEERRECEELCDGQDNGH
                     IEDLKWRRSIREAEATPTKGL"
     gene            complement(374111..376858)
                     /locus_tag="CND01320"
                     /db_xref="GeneID:3257231"
     mRNA            complement(join(374111..374292,374352..374563,
                     374621..374858,374910..376469,376528..376858))
                     /locus_tag="CND01320"
                     /product="electron transporter, putative"
                     /transcript_id="XM_570344.2"
                     /db_xref="GeneID:3257231"
     CDS             complement(join(374266..374292,374352..374563,
                     374621..374858,374910..376469,376528..376716))
                     /locus_tag="CND01320"
                     /codon_start=1
                     /product="electron transporter, putative"
                     /protein_id="XP_570344.1"
                     /db_xref="GeneID:3257231"
                     /translation="MLSAIDIVIITLTIALPLLFFFRESLPFIGGKTRAAAPHAAIAN
                     KASVDEGDPSDFVGKMTRANKRCVIFYGSQTGTAEEYAIRLAKEAKSRYGLSSLVCDP
                     EEYDMNMLDQVPEDACVIFVMATYGEGEPTDNANAMMELLQEPEPEFSQGGSTLENLN
                     YVIFGLGNRTYEFYNEVAKKLDKRLTELGAKRIGERGEGDDDKSMEEDYLAWKDPMWT
                     AFAERMGVEEGGAGDVPDFVVKELHDHSPEKVYHGELSSRALLASASGTNTPVGAYGV
                     KNPYPAPVLSSKELFSVGGDRNCIHIEFDITGTGMTYQHGDHVGIWPSNSDVEVDRML
                     AVLGLAASGRRQAIVDIESLDPALAKVPFPTPATYDAIFRHYLDISAVASRQTIAFLA
                     RYAPSEAAREKLTRWGTDKEAYANEIDGPALKLAEVLQSASSDSVEPPFESQTVWPIP
                     FDRIVSSVPRLQPRYYSISSSSKLHPNAIHVTAVVLKYQPTVSPPHHHEPRWVFGLST
                     NFILNVKMAHSGENTPVEGDVSHVSMKKVPSYKLSGPRGHYVKENVYKVPIHVRRSTF
                     RLPTSPKVPIIMIGPGTGVAPFRGFVQERIALARKAIDKNGPDALKDWAPMYLFYGCR
                     RADEDFLYREEWPKYEQELKGVFRMKVAFSREMKKPDGGKVYVQDLIHDLASELAPLI
                     LEKRAYIYICGDAKTMSKAVEERLMEMLGAAKGGSAAVEGAKELKMLKERNRLMSDVW
                     S"
     gene            complement(377031..381028)
                     /locus_tag="CND01330"
                     /db_xref="GeneID:3257195"
     mRNA            complement(join(377031..377390,377443..378205,
                     378254..380164,380218..380635,380714..381028))
                     /locus_tag="CND01330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656968.1"
                     /db_xref="GeneID:3257195"
     CDS             complement(join(377119..377390,377443..378205,
                     378254..380164,380218..380277))
                     /locus_tag="CND01330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512699.1"
                     /db_xref="GeneID:3257195"
                     /translation="MSNSFLQHVPRSEFTEVVKQQSATPSSLFYTNSHFSWIPQRAAP
                     QPPVITDLSLPPSTSPPPGGSSEPITSPQCSVENSPASACLCTPPQPDASRRSIRFSL
                     HTSPCTSQEQYSLSTGDEADADDGKESGKHGPFTDPGMFQVSQYPLAPTSKATSCDSK
                     EGFLPRISPDEAVDHFAPVIQPSQAPPRPPRRRLPLESQSTLLVTQAHLSASPTPSPS
                     IHPSDLLLPQAVRRRSLSPNSILTITPSTCTSKSPPNDETVQSVIGGDANKTLASSIE
                     AGCSSMGMDQKKRHSVQRRLGALRDLVCDLDFNQSWSTSHTPSEANELPLTSASECNS
                     IVDFSIASRPWSKSEMNVSLISKPLPTRTRFARADRPKGIVEPDLDLSNIPCLISDHL
                     VVPHDADATLIDPEVCRIQPQKLSKPISQSSNRTDQSRLFSATPDPPRPALRARKEVF
                     SVAWSGYGRCLEPSSPITSTAPAAGKTWRYTLPSEAIYHQVVNEMGNDEVKRQEIIWE
                     MCETEQGFVDSMKMVMKLFASPLKTPHGKWIDGIPDQICSLFDSLQSIVNVHASLVKS
                     QQSLKHNHIIDIFTFIGVFRAWVDQLSIHESFLLKFESVTRLIDENVKDPLSVFGEFV
                     RMQMKAGVLGSMSLPSMLLKPVQRLTKYPLFLKGLLDATPSSHPAQSCALSLLTKTES
                     MISSVQAAKVREEDYQSLQVLESRILGLPEGFVLAMKGRKLLGHGRVASAVFGKDGPP
                     PNDAGIIHSRARAGSVHSLRSTRTSGYSTISSSTLSTSGLFTSFDFSASQAGSSRTSA
                     FSVSSFGSSFHSPSRSNSISTCQPSHPSQTLSRPPSVPSMFSIPRPSSSASMRSSKIR
                     KKEDVSIMLVFDDIVVLGQMEKGVAVYGKRRDKRLRVIEGGVGRVLEVKNLTGWGGYD
                     DLLCLTLDPVYSDDAHSPITHFLTTPGTQKITSSSFLRSKSAPLQVDLNTPTIVTFNG
                     FLEILCQGLEVGVAVDAPADGEEEEVLEV"
     gene            381623..382366
                     /locus_tag="CND01340"
                     /db_xref="GeneID:3257408"
     mRNA            join(381623..381877,381967..382025,382082..382104,
                     382170..382366)
                     /locus_tag="CND01340"
                     /product="glutathione transferase, putative"
                     /transcript_id="XM_570426.2"
                     /db_xref="GeneID:3257408"
     CDS             join(381671..381877,381967..382025,382082..382104,
                     382170..382321)
                     /locus_tag="CND01340"
                     /codon_start=1
                     /product="glutathione transferase, putative"
                     /protein_id="XP_570426.2"
                     /db_xref="GeneID:3257408"
                     /translation="MSFTALHRLSTLSTHIIRAPISTRYFATTQTAKIGSSISTPNMT
                     ADVKSLVDKAIADNKVVVFSKTYCPYCKRAKSYLAEDTKDIEILELDEREDGAAIQAY
                     LKELNGQGTVPHVYINKEFIGGSSDLLKLSHEQVKQKISAAASA"
     gene            382770..385230
                     /locus_tag="CND01350"
                     /db_xref="GeneID:3257116"
     mRNA            join(382770..383094,383166..383627,383690..385230)
                     /locus_tag="CND01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_570289.2"
                     /db_xref="GeneID:3257116"
     CDS             join(382942..383094,383166..383627,383690..385066)
                     /locus_tag="CND01350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570289.1"
                     /db_xref="GeneID:3257116"
                     /translation="MPSFPSKGGVPMLGQAGPSRQAYLIKLPEDIISALESSQGASVT
                     VGMDGSVTLNVPDQDPMPLDARPASTASEIHRLSSGPSPTLKLAALATTRLNIPFSSA
                     STARAADKLRAQTDALEKQRKERALKVDGIKRHTDRVASGAMSAPMAVTTSAPGAVWG
                     SGTGTGSIPLKTRVMQYLAMGETTQEDLCRRMGGDEQNVMRVVKVVGRPSKTQPGSWS
                     LQPNQYSKIKLGAGQWPYTYAEQQQVIRLAYAAFDELGLPANSEERMEFEKKERDASN
                     AFANRSSDESEKNAPQLSNAANTSTLQSNAVTSVRERDKARTESPAPVTRQKVPTKRG
                     PQSKIAKERAKFVAERQRAGSGSLPNIKGPNGIASPRLGPTASPSVSPEKKDPNKFKD
                     GEHKEKEVAKGKERKDESRRREEKKEREREEEKSRETELSAISKTKRSKTTYDYSSNE
                     DAASNQIEVKTTKTKGVNNHKKKTEDSPREKLAPLAEIVRKKEKRARKVDYSDSSGEE
                     GEIRGRPKARVTSDEAARSNKHKRRDSESRRKPSRDRNDSDKRDVEDRRIEDSLRTHS
                     QQSKSSRETSSHRSPPEMAVNLASRSGQPADPEALRDRYEELYPAYNLLANKLSKIHQ
                     MAESGKELGSSEAEIKKMVGKWEKWHKELTEIRRWFGEV"
     gene            385302..387216
                     /locus_tag="CND01360"
                     /db_xref="GeneID:3257316"
     mRNA            join(385302..386060,386119..386503,386558..387216)
                     /locus_tag="CND01360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570380.2"
                     /db_xref="GeneID:3257316"
     CDS             join(385411..386060,386119..386503,386558..387109)
                     /locus_tag="CND01360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570380.1"
                     /db_xref="GeneID:3257316"
                     /translation="MPSEDKPQGGYDATALSPSTSPTYTLRITFHKATNLPVADFGSQ
                     TSDPFILAQATTSHKSRHSQDPYLRFRTNTVRKTLEPVWEAPWVIAGVPEDGLKLSVR
                     VYDEDPQDHDDRLGKFEIDTGPIDEKWQGLKQQSFKVKKTGADLRAYALRWTCVMLAG
                     HDLHAHAVISIEMLGRTKREMGKAYTINGFWWKHYSPMIGRLTGTKAKDDQGVERYNF
                     QANEIQLIGPVPNELYHRYVDFKPFVSGMFTAKGIRGKILNKTLHHQHERLYNYDRQT
                     EYGVFPETVEGKDPDQHVTKKFLDLVHHDQGARIFTFIITLDGLFRFTETGKEFGIDL
                     LSKHTMHADVNIYIAWSGEFMIRRLSDPSKSPSDPSQHTHPTEDVPGGPPKSSPPVDP
                     AKYELIIDNDSGTYRPNKDLIPIFRKFLKRNFPGLKIVVMACDDDKLQKMKDEQRKAK
                     LKEGDGIVYGQGSVSSLASGSNASISSSDQEGLNERARIMQEERGDSAPSGGVLEKGV
                     EALENPKDTLTKAIGKEKQG"
     gene            complement(386492..389193)
                     /locus_tag="CND01370"
                     /db_xref="GeneID:3257192"
     mRNA            complement(join(386492..387469,387522..387764,
                     387814..387923,387982..388207,388264..388307,
                     388360..388615,388670..388681,388760..388780,
                     388830..389011,389085..389193))
                     /locus_tag="CND01370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570340.2"
                     /db_xref="GeneID:3257192"
     CDS             complement(join(387302..387469,387522..387764,
                     387814..387923,387982..388207,388264..388307,
                     388360..388615,388670..388681,388760..388780,
                     388830..388835))
                     /locus_tag="CND01370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570340.1"
                     /db_xref="GeneID:3257192"
                     /translation="MPTAWSLAKFGYQMAAFKDVTVKNAKTLIPHVKPNFGADLPRKD
                     LKATWLGHACTLVEMPVASQVKGTNEGQRGVRVLFDPVLGPGMAFWGLGPSRESTPPC
                     EIEDIPEIDVIAISHNHYDHLDVPTLTTLLKTQRAKYSSSPVLLLPLNNRHIVSGLPI
                     DKENIVELDWWEGREIEVEGVGKVRLVCTPCQHSTARYPWDRDRSLWSSWVIQDQSSS
                     ESTNSASVWFGGDTGYCTVHMDVHAGTHPTITNPKALPQDVCPAFKEIGERLGPFTLG
                     LIPIGAYSPRLVMSPLHAAPVDSVRMFEDTKCKQAMAIHWGTFRMTNERFTGPPEKLK
                     EAMEEAGLETSLFSTCKLGESRSYKVG"
     gene            complement(389297..391761)
                     /locus_tag="CND01380"
                     /db_xref="GeneID:3257357"
     mRNA            complement(join(389297..390680,390727..391108,
                     391548..391761))
                     /locus_tag="CND01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_570398.2"
                     /db_xref="GeneID:3257357"
     CDS             complement(join(389621..390680,390727..391108,
                     391548..391554))
                     /locus_tag="CND01380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570398.1"
                     /db_xref="GeneID:3257357"
                     /translation="MSDTGADTSDIITASAVQSDTSQASVSPSASPSASPSDVQSASP
                     SASESVTASPSPSEQASSSPSPSASASPSASASPSASESPSQSAQQSQSASSSPSDTS
                     SAAPSSSAAPTSNPSSVTESETSSQIPSSTTQSSGVESSTVSSSTSQSSSTREIVTFT
                     GSSTSTSSSSSSSSTGETTVSSALSITTTDSAGHTITTAPSMLTQQLTSTDAAGQVYT
                     VTQIVHNPSSTGTSSAADGDSGFFSNSGAVAGTFVAVGLVATAGIMAFVIFMLRRRRR
                     QRLDRDVSAAASAAAAAAAHSRSGYDDEDDQPSMAQYGGYYAATTPSNTDIHNQPQPE
                     MGPYHDYEDPAGGYDPYAVNMVNLAPSNERLSTSTEPGMAGFGATSAQANYAVQAPYA
                     QDPNGQEYMAEPHQPDFSMPVHEQQAANEGYYFDPSQAYAYAQEDAYGGFHDNTQDQY
                     IPEQPAGGHRRNGSDGSVSRPGGERGLKVTNF"
     gene            390773..391752
                     /locus_tag="CND01390"
                     /pseudo
                     /db_xref="GeneID:3257060"
     gene            392131..393435
                     /locus_tag="CND01400"
                     /db_xref="GeneID:3257379"
     mRNA            join(392131..392362,392419..392448,392512..392571,
                     392622..392989,393040..393435)
                     /locus_tag="CND01400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570410.2"
                     /db_xref="GeneID:3257379"
     CDS             join(392251..392362,392419..392448,392512..392571,
                     392622..392989,393040..393132)
                     /locus_tag="CND01400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570410.1"
                     /db_xref="GeneID:3257379"
                     /translation="MPSNRSAIQVAEDSTKGNAKSVEQASEDKLQGLVEENADSTESS
                     IRYAAYLRRARDVVRAGSRYTAYTSDVGEAFRPVVPPWLVTAAYGVSWAYLIGDVSFT
                     TYKSSQLGPSPIEAANMSERTRLAMVAVKRSVFQGVASMALPAFTIHTAVRYAGRAFA
                     KSQNAILRRWGPTAVGIGIVPALPYMFDHPVEQATDALFEKVEESYFRKNVLESEPKR
                     EL"
     gene            complement(393082..394618)
                     /locus_tag="CND01410"
                     /db_xref="GeneID:3257352"
     mRNA            complement(join(393082..393485,393543..394393,
                     394454..394618))
                     /locus_tag="CND01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_570397.2"
                     /db_xref="GeneID:3257352"
     CDS             complement(393675..394331)
                     /locus_tag="CND01410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570397.1"
                     /db_xref="GeneID:3257352"
                     /translation="MSTKTPRKRLLPPSPLALPASSLPSLLPEDESTSLGSPIDSKSY
                     PVPQQTPTKPPLSKSIPIPVTRRRSKSYVYTSSPHSPDSVLPLTPSSTKQQLSTTSRL
                     STSTATEMSRLALETSSVKRHKLDANCDGSQQWGHKACCGRDMKQNDEGSGLSTGWSS
                     SHASAEKTGATVEKSALTPNRSGSTEHSSSKKRLNERGRGHMVSHPENCQRTTDAARI
                     "
     gene            395125..396201
                     /locus_tag="CND01420"
                     /db_xref="GeneID:3256861"
     mRNA            join(395125..395495,395553..395683,395742..396201)
                     /locus_tag="CND01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656969.1"
                     /db_xref="GeneID:3256861"
     CDS             join(395270..395495,395553..395683,395742..396140)
                     /locus_tag="CND01420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512682.1"
                     /db_xref="GeneID:3256861"
                     /translation="MAPLPFHLSTVLRPLSPSLATVRLKSNVFALVLFSLRNLFPPFR
                     AVRSLVLQACDAAQGRFGREKSFGEIGLGLGEALITLVLVWNIVEAIVALQYPSTYVP
                     PQPKGMELTPSKVSSPLTRSYTPHPSTPPQPLSRQVYRPSPSSLNQPAQTAVQQTPSG
                     PSHAAARTALSNSTSTSLSSSTAKILNLPPTESPSSGLFYERGQGRSPQGTAGINGAT
                     NMGGDFVLVDRDEKEWVDNVWKGVKGKGGRVGL"
     gene            complement(395774..397844)
                     /locus_tag="CND01430"
                     /db_xref="GeneID:3257381"
     mRNA            complement(join(395774..396307,396364..396796,
                     396842..396907,396958..397390,397438..397487,
                     397539..397844))
                     /locus_tag="CND01430"
                     /product="chromatin binding protein, putative"
                     /transcript_id="XM_570412.2"
                     /db_xref="GeneID:3257381"
     CDS             complement(join(396227..396307,396364..396796,
                     396842..396907,396958..397390,397438..397487,
                     397539..397702))
                     /locus_tag="CND01430"
                     /codon_start=1
                     /product="chromatin binding protein, putative"
                     /protein_id="XP_570412.1"
                     /db_xref="GeneID:3257381"
                     /translation="MAISTTAPPPTATRTPNYVPSSTLSAHSRAVTALRFSPDGTLLA
                     SAGADGWLHFWHPTSGEHIRGFRAHKAGINDITISPDSLYIATASDDHTSDIHLLHPT
                     PGVTFYPPPLEPSDASDTEDHPIAPVPPQSSVSSSSTVPAIRHLVSHTAPVLSVAFSP
                     KSNLLATGSFDESTIIWDVKRGKALRQLPAHADAVWCVAWDAEGEMVLTAGADGLIRL
                     WDASTGQCLKTLDNDTNSPISYAAFTPSSVFLQASTLSSTLRIYNIHTGKVIKTIRAP
                     GTFVSERWPCPAVIYEGLPPLFQGTESNGHLDPLKEEKMDVDCVDRDPEPAKPPVVVS
                     NVKTKMRDAWIISGSENGKLIIWDIQSKRVLQVLEGDLSHRCSVVALAVSPDGRTIAS
                     GSLEPEKVIKLWRDAE"
     gene            398751..401205
                     /locus_tag="CND01440"
                     /db_xref="GeneID:3257356"
     mRNA            join(398751..400030,400092..401205)
                     /locus_tag="CND01440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570399.1"
                     /db_xref="GeneID:3257356"
     CDS             join(398891..400030,400092..400313)
                     /locus_tag="CND01440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570399.1"
                     /db_xref="GeneID:3257356"
                     /translation="MSLTSNFSFPQSFSVDTNHQSACSIPSPPSLSSGRTSPDFDFES
                     FTHYSPNASSLVDEIDSADLHKESSSTPPSTDLVSPRSSIADISQIQPPTQVGELDTA
                     EALSKHHLQRYLHYKTLAARAEADRAIVVHQQIQSHTPDDEFDALFSACDKSSVGLMP
                     DGSANSTFFKDAAVSGDNHNNMLAYQSHMVQPTYYQMGQAVPNWQQSDGFYHPQPSQV
                     ALHNAQAQAHLQAAEVARFQAEQHRMNMSNFYVPVSAAPRSSYDAPQNAPSFAGQSIS
                     NLTNQSPSYSSTTSYPVSNVVMDRTSSMSGLTTVAVSRRASEEGEEELAYSSEEDAKP
                     NVASIPVANVHGGGRGYVPGQTPDDPKKKHKCQVCGRGFARAFNLKSHIQTHNPLRAK
                     PYQCPHATCKRGFSRLHDLERHRQGIHSDGPLVDAKRHGVTPAVARAQNRIQKRAESG
                     SLI"
     gene            complement(401265..402573)
                     /locus_tag="CND01450"
                     /db_xref="GeneID:3257378"
     mRNA            complement(join(401265..401714,401767..402033,
                     402097..402573))
                     /locus_tag="CND01450"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570409.2"
                     /db_xref="GeneID:3257378"
     CDS             complement(join(401336..401714,401767..402033,
                     402097..402194))
                     /locus_tag="CND01450"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570409.2"
                     /db_xref="GeneID:3257378"
                     /translation="MQKGGSVKTYVKHIERGVDELNADPKSLLVFSGGATRHPPSPPI
                     PEALSYYRLAMALSLIPSTSIADSPKTAPLPLNLRTATEEYALDSYQNLLFSIARFKE
                     VTGNWPRKITVVGYGMKRLRFENLHRAALRFPSSAFHYIGIDDAGDTSAHYAGELKYG
                     YLPFLSSPSGCHPPLSIKRLLRNPYARYHPYFTSCPELADLFEWCPAIQSIKGEETWE
                     ARNSDVGMGYPGRVPWDDKEQVTWDRERD"
     gene            402693..407312
                     /locus_tag="CND01460"
                     /db_xref="GeneID:3257348"
     mRNA            join(402693..403035,403083..403425,403476..404426,
                     404474..405366,405422..406168,406248..406489,
                     406550..406648,406710..407312)
                     /locus_tag="CND01460"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_024656970.1"
                     /db_xref="GeneID:3257348"
     CDS             join(402710..403035,403083..403425,403476..404426,
                     404474..405366,405422..406168,406248..406489,
                     406550..406648,406710..407269)
                     /locus_tag="CND01460"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_024512787.1"
                     /db_xref="GeneID:3257348"
                     /translation="MLSPANVPLPSSPAPTASRRSSSSSTPFQPSPLTALRPRSPAPR
                     PHDDDDPFSEGATVSVNQPVGSISISPSSRDVCLASRKGLYILDLANLNNAPRFVPQG
                     GAWQIADVQWSPHPATSSLILSTSSQKLLVWDLAAPRPLLTSFDAHSRAITDINWHAL
                     NPNLMATVSMDAGIRGWDMRCFDRPVMRLCDWGAAGTQVKWNRRHDHLIATAHGNIVH
                     VWDDRKGSVPVTTIHAHDAKIYGIDWDRQYRHKLVTCSLDKTVKFWTVPELGGSSDSS
                     MVYHSSLPALSSPSYTISTHYPVWRARNLPFGRGVLALPQRGEKALEMFGMDDDAPVE
                     RFQGHENVVKDFVWRMRGGNDSSFDDREFQLVTWSKDRTLRIWPVSRELEERVGWQYG
                     APIKALVSRRGAPDVTYTKDPFNTDIDAPRLPPPVVNHHPANPSNLTRQRSARPEAQP
                     GMTRGGNKVRRMDQLEWLTKVVKNAPSPESSLMSSRIASVSRTRRPASRAASRLDSRS
                     ASAEDRQEWKNLKDEVVAVSRIYPRPKINFEKIDLAHRKLTISMQGPWANGDRQAFMR
                     IHWSFPPNYPYGPEIPTFELERNPTVSPITRQTIVMNIKEMRAHNKQCLIETTGYLLG
                     LHERQGRRRGMDEESDSESSVKGEEKRREDVVPELMLRKTCGATFGPNGQLVCFFPKQ
                     VTLPRTRNFSRSPSVTRENPSPMLKAISALTRLQNPHQRAVLRYKPRTRRLDPISSPL
                     PPPAGSTMTIHDVSYLGQPNIHLAKMYGMSVEANMSYALEAKRLDHADVWATVRGILA
                     DPPPPYTQLPQLDEKQDRVRRERLIWEKGMERKKKVVDRLFTNLMAQRDVQMLALLSC
                     ILLEYTRSMYIPPVAESVTSHSPMQDYFNLRFVPPRPTLNISPVRRRTGSSVIPVSPT
                     NSSSFRTSGWSQILNPSGISLRGALTPKEHTSFSDIPFSRTALSTSYEEQSSPNGLAV
                     AIPTSKRSDSPKPIQGDKSKVFPTSSMSPPPIVTPLRSSGPEKSLYSGGEPRSHKVSF
                     GSASPITRGGRSQSSIGYVGAGGLGSAVTTGPNTPDGERKAAVRDGGVKLDFPKDESS
                     TPSLLPQDMLPLCEAWKLSYADFLLRHHLLGVRMTLLSYRFITSSTSTAVDAASGKSS
                     GIVRAGVGETEKMDEGQSVIRVCVPCSGTPSGTCPSCNKQPQKAVCSYCRVPIKGISM
                     GCTICAHKFHAKCFQRYFLSPVTTPMTCPACSCSCLAHRGISTPLYTVAALPKQSPNI
                     TRGGFDRGKMPSENAPLARSRSVPSQGRRGRNSPEEGKSRLTYASLVKLGAIRENFGL
                     GFADGGSSGTASAMGFHADGDGDEVSTDRDKTVREHRGDHRGDGLLARARWGGEGLLH
                     WGSTTHHQ"
     gene            407516..414314
                     /locus_tag="CND01470"
                     /db_xref="GeneID:3257018"
     mRNA            join(407516..407803,407862..408989,409040..409326,
                     409385..409752,409808..409812,409878..409974,
                     410024..410080,410137..410713,410761..410838,
                     410879..411069,411110..411195,411254..411476,
                     411529..411683,411736..411783,411837..411895,
                     411950..412121,412159..412245,412297..412397,
                     412449..412679,412729..412792,412846..413108,
                     413160..413211,413266..413307,413364..413499,
                     413553..413629,413681..413732,413790..414314)
                     /locus_tag="CND01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656971.1"
                     /db_xref="GeneID:3257018"
     CDS             join(407674..407803,407862..408989,409040..409326,
                     409385..409752,409808..409812,409878..409974,
                     410024..410080,410137..410713,410761..410838,
                     410879..411069,411110..411195,411254..411476,
                     411529..411683,411736..411783,411837..411895,
                     411950..412121,412159..412245,412297..412397,
                     412449..412679,412729..412792,412846..413108,
                     413160..413211,413266..413307,413364..413499,
                     413553..413629,413681..413732,413790..413982)
                     /locus_tag="CND01470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512681.1"
                     /db_xref="GeneID:3257018"
                     /translation="MSDVWPATSSYMLELDHRKYDLSQLAKAVDIAAKDRDQSGDEYA
                     VALPTPTCFHVHTNTVEATLLPPDAKIEYYGREPESNPAWEIFQTIGEQVASVVPSME
                     RMPLVPSTAKLIRQPPNPGNTTSSAVGACLYLPKHGDRYPLARLELPPIAEQKEWMPS
                     ATAWDMQHWIHTIIALDPEANTTRKAIYRDDKKRVHMQTAIDICWVPDEGGEADRAEI
                     KLLVVSRIYLDISFLFDPLPEIGNDMLGFILHSIIPSPTATTYASESEARAAGLRNFY
                     TCLKPAPDLPFNFPASRLQPREMLSKLLPFQVRTVRLLLEREGAQGVGKAAIRTKMDP
                     DGLWKGLDWGNNLGKLGYRRITGSMVPIDSLKSVNTDIEGKGKQKAYEEEEDYHYVSG
                     ITEEERQRLPTLLDLTGVRGTMLCEEMGLGKTVEAIALLSLHRHPLSTPRNIPSMAPL
                     VSTGTSQSSAHARIAKQPVPVINLLAGIPGLQDLEVKDWVEKENIAFAGCRAWDEHSQ
                     LEVTEVAATLIVTPPSLLKQWVAEIQRHAPTIRVCVYEGWKSLQQGVEKQRDARRKAR
                     ARKELEEKKRKAAAFRGQTRRKYAKGNNGLAIKEESDEENDQDDEEEGTLQLTQRQFV
                     DYVRAHDVVVTTYHDHLKFALPVPARSRRSTANYQLNDRPRSPLVMVEWWRVIMDEVQ
                     LHGDQTDAANMVSLIPRKNSLAVSGTPARSDIKDLMGSLKFLRVPVLPNDNRLWHRLQ
                     QPSMRPAFEGLFRSLAVRTTKKEVSGEFNLPHQSRYVVPIELSEIELHYYNDTLERAR
                     ERLHLPANFREARPDDWVLDRSMFQTVLRSLRQICTHIQVGQMQSGTGRGDQRLRLGR
                     TLMTMSEALEKMRDDHLQETSSEARQQMRMMIRQAQLTVMDDQNDLRHLQALALYERA
                     RAAAESHLEPAQKRLKSLLDENDGNDEEEDEEFEDEMSEKQQTQQEKARALAIKTVKH
                     TIRELDLIIHQCWFFEGDVRHVQKDEEKEVYAYARADAIRKSILARPLKTANMSVDLL
                     KGSLTRGPAVVQVNELQTTDLKRKGGILTHDVISQANALLRIMNDNALLVFNWRTKIV
                     DLLSSPIDVDPTDVPDGQGQEVENPEAEYYAEALKAQGEVEAYLIAFAAAVADRREFM
                     TETRSLLSTHDSRIAKQRNTKAAMNALTDVEMPNVPDDIGEQATVLLKERQVFRDARM
                     NEGCERPLKGLLMDLNAIIHGQHRHEEIEIAKSMASMLKKYIAEQTELVEKLNKELDM
                     FRATFNRRVVYFASLQEISDSVTAPEFKDLGKDIHAAAKEVNELEVKLAKMAVKGRYL
                     HYLGTKQHEEEDIREDCIICFGSSDDNQAVLLQCGHYFCLSCYREYRKTPGGRKCPSC
                     RIKISDKEIQRIKLNPARAEAADPMGKQHQEFSVQTLAPAVSGSNEAEEDTTPEEQEQ
                     LRRAADLERLRMMDVERRRAVMMMDMMGEYGSKINFLIKHLLYYKSTEPDTRHVIFSN
                     WSDSLNIVMQALRLNGISFASFDQGKKQKDVVDQFLRDESISVFLLHAERESSGLTLT
                     SCHVVHLLEPVLRHSFELQAIGRVDRLGQEKETSVFCYATMDTVESRILSQGVRNGTS
                     IYLADDTADQVVAEMPNVASAAHKGGDVAAGGNEEDLLGLIL"
     gene            complement(414050..416157)
                     /locus_tag="CND01480"
                     /db_xref="GeneID:3257237"
     mRNA            complement(join(414050..414922,414991..415250,
                     415310..415431,415634..415771,415885..416157))
                     /locus_tag="CND01480"
                     /product="eukaryotic translation initiation factor 2
                     gamma, putative"
                     /transcript_id="XM_570286.1"
                     /db_xref="GeneID:3257237"
     CDS             complement(join(414147..414922,414991..415250,
                     415310..415431,415634..415771,415885..416010))
                     /locus_tag="CND01480"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2
                     gamma, putative"
                     /protein_id="XP_570286.1"
                     /db_xref="GeneID:3257237"
                     /translation="MSAINDPIAAASSGPSEPVQEVQVDVTKLTALSPEVISKQATIN
                     IGTIGHVAHGKSSTVRAISGVQTVRFKNELERNITIKLGYANAKIYKCQNPDCPPPSC
                     FKSYPSSKEAHPKCERPGCDGRMDLQRHVSFVDCPGHDILMATMLTGAAVMNGALLLI
                     AGNESCPQPQTGEHLAALEIIGVDPKNIVILQNKMDLVRESEAMEHCESIKKFVEGTT
                     ARLAPIIPVSAQLKFNIDAVVAAICNIAPPNYDFSADPRMVVIRSFDVNKPGAGVEEL
                     KGGVAGGSILQGVFKIGQEVEIRPGLITRDANGICTCRPLRSRIVSLHAEQNHLQFAV
                     PGGLIGVGTLVDPALCRADRLLGMVMSSVGKGPSIYVEIRAEVFLLRRLLGVKTDDSK
                     KAKVGKLVVGETLFVNIGASQTGGRITAVKGGDVSIALTTPACCEKGEKIALSRRIDK
                     HWRLIGWGKVRSGGTLCEVVDPE"
     gene            complement(416658..417776)
                     /locus_tag="CND01490"
                     /db_xref="GeneID:3256867"
     mRNA            complement(join(416658..416794,416847..416991,
                     417042..417089,417144..417297,417359..417451,
                     417690..417776))
                     /locus_tag="CND01490"
                     /product="copper zinc superoxide dismutase"
                     /transcript_id="XM_570285.1"
                     /db_xref="GeneID:3256867"
     CDS             complement(join(416779..416794,416847..416991,
                     417042..417089,417144..417297,417359..417451,
                     417690..417698))
                     /locus_tag="CND01490"
                     /codon_start=1
                     /product="copper zinc superoxide dismutase"
                     /protein_id="XP_570285.1"
                     /db_xref="GeneID:3256867"
                     /translation="MVKAVAVLKGDSHVYGTITFTQDSEGAPVCVSGEIKNLDADAKR
                     GFHVHEFGDNTNGCTSAGPHYNPFHKNHGGPTAAERHVGDLGNVQTNGCGVAMVDISD
                     KVISLFGPHSIIGRSMVVHAGTDDLGKGGNEESLKTGNAGARLACGVIGIAA"
     gene            complement(417978..419489)
                     /locus_tag="CND01500"
                     /db_xref="GeneID:3257079"
     mRNA            complement(join(417978..419149,419204..419489))
                     /locus_tag="CND01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_570284.1"
                     /db_xref="GeneID:3257079"
     CDS             complement(join(418032..419149,419204..419255))
                     /locus_tag="CND01500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570284.1"
                     /db_xref="GeneID:3257079"
                     /translation="MSDSHTLTNGGGIGLRPAVEIPCSSEAAESSTSRSEAKFETPGS
                     PQTDSYLLSIRAAPVSPASSRPSSAAFSHSPSTPPSRTASPAASGRRRSESAASSPSR
                     GKAASNVRRRSLLGTNVALPGDDDEEEGSKEAADAGEGVPTIPEHSQLQTDDDGDSLG
                     LEGLPDGDGPKKVDQADDGKPVLSPYQAGLAATVRSIVVRDFAYHKTDDRYHGRNYEE
                     EKWGSPNDPETRWGEEKPLEEEKDDNAGGWGGFGFFGWRSRFGKQNEAEDGGAVNDQV
                     DVVDGDADEDYYSSPQPSEPDASGYAYKILPPLSPSLEPAGLYRAAYMFEGMGASEMS
                     VDEGELLLLTGRGNGNPGWVIARRMRVEDGKVHRSEAVGLVPESYLERVEVLDAE"
     gene            419674..421077
                     /locus_tag="CND01510"
                     /db_xref="GeneID:3257007"
     mRNA            join(419674..420100,420202..420569,420625..421077)
                     /locus_tag="CND01510"
                     /product="ATP phosphoribosyltransferase, putative"
                     /transcript_id="XM_570283.2"
                     /db_xref="GeneID:3257007"
     CDS             join(419793..420100,420202..420569,420625..421022)
                     /locus_tag="CND01510"
                     /codon_start=1
                     /product="ATP phosphoribosyltransferase, putative"
                     /protein_id="XP_570283.1"
                     /db_xref="GeneID:3257007"
                     /translation="MSANSAPQPAQSESLESSTILLPPSGGDVSPSAGGGRASKSSFG
                     YESTMSLLVDSLKDRLLFAVPKKGRLHEKCLELLNGADIKYNRAHRLDVALVQNMPIA
                     LVFLPAADIPRFVALGSVALGITGQDVIAESTHAPLITELLPLGFGKCKLQVQVPVTG
                     PIQTLEGLSGARIATSFEVLAGELFNGPNGVDAKVGKGKTSVEYVGGSVEAACALGMA
                     DGIVDLVESGDTMRAAGLHAIHTLMSSEAVLITSATPHPNLTPSLASFIPLIKSRFAG
                     VLASKRYVYASYNIQRSNLAKALTITPGRRAPTVSPLDENGWVAVSAMVERKEVAKVM
                     DELERTGAEDILIMALDNCRVGV"
     gene            421333..423802
                     /locus_tag="CND01520"
                     /db_xref="GeneID:3257369"
     mRNA            join(421333..421464,421539..421677,421734..421857,
                     421918..422404,422451..422602,422661..423098,
                     423147..423636,423696..423802)
                     /locus_tag="CND01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_570401.2"
                     /db_xref="GeneID:3257369"
     CDS             join(421419..421464,421539..421677,421734..421857,
                     421918..422404,422451..422602,422661..423098,
                     423147..423636,423696..423742)
                     /locus_tag="CND01520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570401.1"
                     /db_xref="GeneID:3257369"
                     /translation="MTSVPPPYSSRDHAQAQPGPQSSNVSSSSPTQEFSETTSVCLEW
                     KITGLKSMYEGTRGEQKSKCVKSAVFGDVDTTWETLFYANSGASHQTAGDHVSLYLSC
                     VPTSQERNSKLAGQWTRKGLWWFKFEIRPAPTAANPKPDPIASKDASDHTFAVKTANW
                     GWQAFAKRDLVFLHPSVMAADSFVIVCTIQAQPQPPAGFWLGVGLQPGQGVGVNTRGI
                     GSGGGLSAWSTEHGYGGVAGGTTAGGGARKVVPKELITSVGSLLDDPLYSDVEFIIPS
                     RRGMPPKKIYAIKKMLERWDYFEAMFNGGFGEEERAIAEDEDYNDDELDILSDSDMGD
                     ESGIFEDEEAPESPELGGLTTTTSRASSTPPLNQHRHIASSDFTGKPEAGDDDGEKAT
                     IPGGLGNPVELGNRQPEGNQEGKIDEEGTINKEVRDEGRTGKKKEVLGPKKTRIVIRD
                     AAWCTWWALLYWIYTDVIYFAPLSSSFEHDPKNMGATAPDTDSEEPQTRLDWIHRWMA
                     EHDIDLQPDPSSSSAFSSSFYELHLGPRPVSAKSIYRLADKLGLLPLKLRAFQHICSQ
                     LTARNVPAEVFSRFSSTFEDIRKVEVACFLKNWAEIKKSETMMQIWKNIRHGKHVGFE
                     EVWPLIVGQLDFKPAV"
     gene            423967..426581
                     /locus_tag="CND01530"
                     /db_xref="GeneID:3257277"
     mRNA            join(423967..424162,424263..424399,424455..425052,
                     425119..426071,426130..426581)
                     /locus_tag="CND01530"
                     /product="nuclear cohesin complex protein, putative"
                     /transcript_id="XM_570356.2"
                     /db_xref="GeneID:3257277"
     CDS             join(424045..424162,424263..424399,424455..425052,
                     425119..426071,426130..426300)
                     /locus_tag="CND01530"
                     /codon_start=1
                     /product="nuclear cohesin complex protein, putative"
                     /protein_id="XP_570356.1"
                     /db_xref="GeneID:3257277"
                     /translation="MILNELIKSGPLAKIWLSAHQERKLSKTQAMGVDVGESVEAILT
                     QDAALPLRSSGPLMLGVVRIYSRKVGYLFDDCKEARERISLAFRPGIVDLPEDQVRAS
                     HNAITISSRADFDFNDWTWGPSNFLVPPQPSQAAVTTTVLPGGQAFGAFNFGVPRAPS
                     IYGGSETAASRHGSHDEFSSQLGSNEFSGIDLGLNLEGDETIEYGREVMTPISREGSA
                     FAARERSIRAGTLDLAGFGGEGIGDVLPPMAPMDDYDVEMAERMEPFEPMDLGLDFEQ
                     EIERARRATTELLTPPPPTPPQESISDLTPRTAAQISAHPAPPVKAAKKPRLVMPDHE
                     TELTQELYDRAAILGAEHFIPANLELLHLNEIVSDPASHFLPTLKIGGENWTAVAPLG
                     LAPELTELFAFPSNVLRKGRGLEEAEEDRPAKRARREGEIEAEAEAEAEEDVEEQLRQ
                     AEEDVEVVRRHEFDVGFNAAEEAFVPAFVGDDGDYGIGIGDEMPMEPMGASPPAFGIS
                     RGPSLAPSRAESIAREIEYGGPEGDFTLAMFDTRSSRAAESQLSQVPSSPSRAESQKE
                     GAPGRHTSMAMGLLRRELEAIEEEDKVVSFEKLADKATKRAASAFFFELLSLGTRDCI
                     KLEQPEPFQDIKIRGKDKLWPFPSQTASQLGSEV"
     gene            complement(426455..>427587)
                     /locus_tag="CND01540"
                     /db_xref="GeneID:3256974"
     mRNA            complement(join(426455..426704,426762..426849,
                     426901..426969,427021..427184,427234..>427587))
                     /locus_tag="CND01540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656972.1"
                     /db_xref="GeneID:3256974"
     CDS             complement(join(426627..426704,426762..426849,
                     426901..426969,427021..427184,427234..427587))
                     /locus_tag="CND01540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512680.1"
                     /db_xref="GeneID:3256974"
                     /translation="MAHATPHPPPGAAPPVPLSAAHLSLLDALPHSHVAHALKTVAVP
                     ANAPPDIAGKSFALVVCSLHDQQKCDQCAVDFSPVNFLHQFLRFAPAEAIPPPPNVAP
                     PPQRAQAVTNLKEAGNNAFKAQKFDVASQFYSKATDAALSRPPWEPAALGREEVAITL
                     CNRSASNAFSGKWAAALADAQTVINLKRPWTKGHFRKARALVGLERYEDAKQAVIDGL
                     QYEPNDKELNNFLQEIEEKIKEADAAFPDTIQ"
     gene            427757..429577
                     /locus_tag="CND01550"
                     /db_xref="GeneID:3256933"
     mRNA            join(427757..427853,427952..428140,428196..428387,
                     428442..428619,428686..429034,429101..429577)
                     /locus_tag="CND01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_570281.2"
                     /db_xref="GeneID:3256933"
     CDS             join(427849..427853,427952..428140,428196..428387,
                     428442..428619,428686..429034,429101..429294)
                     /locus_tag="CND01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570281.1"
                     /db_xref="GeneID:3256933"
                     /translation="MPVFSGSLLSKRKPELVEIGAALGLPTDDIRVTDLVKSIQAHLD
                     ANEAQLASDPTFKGLFYKKRSSHGNGGGNGSHTPERSSSPTTRAEIKKLESGASTARA
                     LTNKASDRLQEVADAAKVPLPESPVALSRVSDATHAISESVQNALVPASVPSGEISSK
                     LQDIAQQLLQIQHRGQERVNIGIRHTRDVISTPQALTITALSAELLFLLGHVLPFYNY
                     TYFFPPIPGKSGTLSSLVHSLFSWSPTFSWTLRLPEASGLVSSELWGAIAWWVFSTVL
                     PPLALSTVVSFVPQKGVHRHNTPRTRYQETHLPQPTPDPLVFALSRLAILVLPLTSAA
                     PTSLVDALEMSGNLQGRALGAALFAGLILAAKLA"
     gene            complement(429619..432488)
                     /locus_tag="CND01560"
                     /db_xref="GeneID:3257110"
     mRNA            complement(join(429619..429739,429796..430112,
                     430173..430251,430361..430427,430504..430620,
                     430711..431022,431099..431317,431377..431480,
                     431557..431986,432046..432488))
                     /locus_tag="CND01560"
                     /product="Gamma-glutamyltranspeptidase 1 precursor,
                     putative"
                     /transcript_id="XM_570280.2"
                     /db_xref="GeneID:3257110"
     CDS             complement(join(429660..429739,429796..430112,
                     430173..430251,430361..430427,430504..430620,
                     430711..431022,431099..431317,431377..431480,
                     431557..431986,432046..432456))
                     /locus_tag="CND01560"
                     /codon_start=1
                     /product="Gamma-glutamyltranspeptidase 1 precursor,
                     putative"
                     /protein_id="XP_570280.2"
                     /db_xref="GeneID:3257110"
                     /translation="MPPIAASPPNHDENAPLLASPSLEAGTTGPPTPSPPWQFWNRPP
                     FRRVHFADHDQFVSPASAHSESELSADGNGGYGTNPKYPRQPLQQEEKMGQWMMYCLL
                     VLVGMVFGALFSRNWSIKGDAGDMPMVPPVWTLPPPTGLPRNDAYLINATTAAVASED
                     VTCSNLGLSIMQDKNGSAVDAAITTTLCIGLLNAFSSGIGGGGFMVVRVPETHEVKDQ
                     ALRDIGYDGELEESRVVALDFRETCPSNCEKDTYGTHKAGRMAAQVGGLAIGVPGELR
                     GLEAAHKLYGTLPWKDVVMPVAELAKGWRVSRELARRLRLFGDFMLSSPTWSAVYAPR
                     GPLLVEGDFIQRLNYGKTLKKIAEEGASAFYQGEIAESSVKTIAKAGGVMTLDDLQSF
                     KALSYPAIHSTFMSKEIYTTSAPSSGGIMLGLLNILEPLNITSNNGLKNPLNLHRFIE
                     ALKFAFGARSWVTDPAFAEDRKRLEEVYTKEWANEIREKITDNETHSADYYGLQYDTP
                     IDHGTTHLSVVDKWGGAASVTSTINLIWGSHVMDPKTGIIFNDEQDDFAVPGAPDAFG
                     LWPSPWNYPAPGKKPLSSTSASIILNPATGSSPSPSLYAVVGGSGGSRIFPSVAQVLL
                     NLFSGLGISQSIEAYRVHNQIVPDLTTMEVGPEGVDEEVVKGLKERGHKIGEFDVNIG
                     ISEVQAIVLEDGHIFASSDSRKNGIAAGY"
     gene            432701..434859
                     /locus_tag="CND01570"
                     /db_xref="GeneID:3256984"
     mRNA            join(432701..432960,433018..433111,433164..433651,
                     433709..434158,434216..434323,434387..434595,
                     434653..434859)
                     /locus_tag="CND01570"
                     /product="succinate-semialdehyde dehydrogenase, putative"
                     /transcript_id="XM_570279.2"
                     /db_xref="GeneID:3256984"
     CDS             join(432745..432960,433018..433111,433164..433651,
                     433709..434158,434216..434323,434387..434595,
                     434653..434773)
                     /locus_tag="CND01570"
                     /codon_start=1
                     /product="succinate-semialdehyde dehydrogenase, putative"
                     /protein_id="XP_570279.1"
                     /db_xref="GeneID:3256984"
                     /translation="MPIRSPTSLSLKRSSHFTTATRRLHTSTPTLIAAASLSKKLQRF
                     SPQLTPRLLAPNGSRTMSNWPKVTSENPLGLDDPSLFIQKGFINGQYVGTQSGKTFEV
                     NDPASGKTIGTCPEMTVEDTRHAIEVAEKAFATFRNTSPVQRSNWLSELYRLYQASIK
                     DIARLIVWENGKSWNDAMAEATYAGTFFSWFAGEALRTYGDVIPCSVPGTRNFSIKQP
                     IGVVALLCPWNFPAAMIARKMGPALAVGCTSVIKTPSETPFTTLAIIELARRAGIPDG
                     VINVITTDANLQDVGKELCTNPAVHKVSFTGSTRVGKILASQCSSTLKKMSLELGGNA
                     PLIVFEDADIPTAVAGTIASKFRGSGQTCVCANRIYVHEAIYDEFAKKLAEKVAEFKV
                     GPGFGEGVTHGPLIHSRQADKVEEHVQDAIKKGAKVLVGGKRGNGTEYIPTVLTNVSD
                     ECLIATEETFGPVAALFRFSSEEEVVARANRAEVGLAGYFFSRDSDRIWRVAEALETG
                     MVGANTGMISQAVIPFGGIKESGYGKEGGRQGTEEYTITKLVAVGTSLHNMPK"
     gene            complement(434834..436032)
                     /locus_tag="CND01580"
                     /db_xref="GeneID:3256951"
     mRNA            complement(join(434834..435233,435296..435402,
                     435476..435628,435682..435937,435985..436032))
                     /locus_tag="CND01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656973.1"
                     /db_xref="GeneID:3256951"
     CDS             complement(join(435008..435233,435296..435402,
                     435476..435628,435682..435937,435985..436016))
                     /locus_tag="CND01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512792.1"
                     /db_xref="GeneID:3256951"
                     /translation="MATDPYTDLKREVEASLSTIHSLTQNHPDIFRKSSSPEIVQAQD
                     ELRGTLSMLETDVEDLEESVRVVEDMGERWGLGTNEVHKRRDFAQRVKREVESLRHKV
                     YHLGPSNSKGKGKDGASGRYRDEPADLERGYDEDEVRRWEAQEQEMLVKKQDDTLGII
                     SGTLHTLASQAGLIGHEVHEQNEMLDDLSTRVEHTDSKLRKVQRTMGDFIRRNEGESL
                     EFQCYRKDLLTARAETKSGWCILILIIVLMILLLLVIIT"
     gene            436206..437918
                     /locus_tag="CND01590"
                     /db_xref="GeneID:3257464"
     mRNA            join(436206..436459,436517..436976,437032..437565,
                     437615..437918)
                     /locus_tag="CND01590"
                     /product="regulation of amino acid metabolism-related
                     protein, putative"
                     /transcript_id="XM_570278.2"
                     /db_xref="GeneID:3257464"
     CDS             join(436232..436459,436517..436976,437032..437565,
                     437615..437841)
                     /locus_tag="CND01590"
                     /codon_start=1
                     /product="regulation of amino acid metabolism-related
                     protein, putative"
                     /protein_id="XP_570278.2"
                     /db_xref="GeneID:3257464"
                     /translation="MLTRRARPFLTPFLQRPPIPFLHRHIASLRPSMAQYADSLADAL
                     ASLKLPSGPEHLESQRRSAPEPLRDPHGTLLKSTPLTTQFIEHLLSEENFENDPNLAA
                     IGYELEALLSIYGDESVRLAFTSRPPSRSSQLADIPNSERRGSQQWTDAVWNAEIGFT
                     PGERIRYEVSLPVWEEGDTLEGVDPTLMPHKAPIMRILVSLPPTYPNSSPPQLQLLGR
                     YLGSFAIDSGLFGNITRTYISSDGAPFNPGDVCVFEGLTHVQSLARTWYSQQLASGAA
                     REAQRNPQITVSVSNSPEASDNEDAGYSRRLSPRPMFSYTRTASDTPPTEAMLRIEAG
                     KDHGLKVWVSEEVVDRKSVFVGRAVKVTDERDVPLVVHELLGDKRVARAAHPAIYAYR
                     IAKDVGGTAGKVYNTDYDDDGESQAGGRLRHLLEILELENVMIIVTRWYGGHKLGADR
                     FKHISKVARDALEIGGFLDEKKDSGKGRKGKK"
     gene            complement(437862..439312)
                     /locus_tag="CND01600"
                     /db_xref="GeneID:3257404"
     mRNA            complement(join(437862..438876,438957..439312))
                     /locus_tag="CND01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_570653.2"
                     /db_xref="GeneID:3257404"
     CDS             complement(join(438035..438876,438957..439113))
                     /locus_tag="CND01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570653.1"
                     /db_xref="GeneID:3257404"
                     /translation="MNRSSVIVDDDDEDDEFAGIESITASQWVRDPIVNRHGGPSSSS
                     KHSSQDATERRQFQTPELSHFNTSDPVSLPVPQTPCSSPRQSHPSTPISWSPSPPPLP
                     SRIRKAFPGAIEDKENVPPSSGSTERASKGSLGKSKRRRMVIDSEDEEVITAQKQRND
                     KGKGKEPEVIEILDESMPDERWIGHVDYNPTEDYYDPYDEPYDNYDPLPFNNQDPVST
                     SPRPLGDIPHIDPIQHPPDGPVAATSVLGTMDYPLTMISDLDDRLQEFYTTHFRRGAD
                     KDINSALKNPRAAGDDDESGTRGGKAKKATSFRKKSWPRRGWNNTSSRSRSKAKKK"
     gene            439469..439576
                     /locus_tag="CND01610"
                     /db_xref="GeneID:3257148"
     tRNA            439469..439576
                     /locus_tag="CND01610"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:3257148"
     gene            complement(439664..441260)
                     /locus_tag="CND01620"
                     /db_xref="GeneID:3257466"
     mRNA            complement(join(439664..440423,440475..440533,
                     440586..440806,440858..441260))
                     /locus_tag="CND01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_570277.1"
                     /db_xref="GeneID:3257466"
     CDS             complement(join(439836..440423,440475..440533,
                     440586..440806,440858..441213))
                     /locus_tag="CND01620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570277.1"
                     /db_xref="GeneID:3257466"
                     /translation="MDPTTQARPADDFFKSTEPSHAVPAPVPTPADINNQRQQQQQQQ
                     QNSAPEATGIRQRVNKLSHSVEDAASHPAVQNAKQVAVNQTRGLRERLGKSPTIMKLE
                     RRTGIDRVALVGGGVLLYILLIPVNIFHLALPTTQLLTVLPAAYLSAQVLDSSESSAN
                     DEKVKSLLSFFVVLGCIQTLESLMAGFLEKRIPQYYTVKLLFLAYLLHPKTQGAKKIH
                     ESVFRPLIKNRDSPLSPAKVYPSSTSKTDASATGSTNDSVPSRGEGTGTPPTSRSSNS
                     NIASSPIHSNNPFTSDDSSPKAVPQTTSATSPPDFDRNFGALSSTFASSSGSENVTGH
                     QAPTLAQLQATTGSAAADSSFPPPRVQAQQALAHAVQDSGVDTTEPIDPSRGDGNVTM
                     ADAEGQNFRVVNELH"
     gene            442023..444560
                     /locus_tag="CND01630"
                     /db_xref="GeneID:3257343"
     mRNA            join(442023..442181,442237..443701,443791..444367,
                     444416..444560)
                     /locus_tag="CND01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656974.1"
                     /db_xref="GeneID:3257343"
     CDS             join(442273..443701,443791..444367,444416..444497)
                     /locus_tag="CND01630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512788.1"
                     /db_xref="GeneID:3257343"
                     /translation="MAKAKTPPPPSALHSYEPPTEVASHPPSQRHHHDHEHHHHHSHY
                     VRSVSPGETVKGTIEEKQVDELKEEKIVEAQVKVAPELVAPPVIASAKASTNAKSRAA
                     SVEAPSAAATISHITRTKSILATTSAPAQVVEVVPAAPSASSIAAPPTTVVPSVKARP
                     SKAPSVKPVNRRPSVKVPSIIPPSLTSSHRSRYSHHHPEVIVNVTIPQAVAAPAPLSP
                     PVIAAVLPAPTVIEGTVKETTAEKSSPLVVPATVPPTTTQASTIVTSPAAPPSPSPST
                     RSRLFRLHSTKPTTAPLPPVAPTAGEQGVEGEPEEEIVEETKVVTTTRTSKRRPASPP
                     KVSETGSRYVENILEEEAPAHPPPPPPPPSTKPKSVKSRPKSLASLSPLPSAPNTPVT
                     MKCHFFGSKSSPPPPKTRTVETTTVETVSYPLLPQSVEEADVDTAATTAGGPTTKGIR
                     GARSVALTASSGRMSGTKAGIRPIPMVDYQALMKRSPAPSQKKSLSPPTVPAAPAPVP
                     STTVEVTTAPAQAVAATELPPATTVAVTAAASSTGPPPNALPPSTAPPPSTLERTTVA
                     MEATALTSPKTIMTLSAQLDKDSHGNEHLHARWRDHTNVNEVDLNTGHDAGEHVETTE
                     SPGETDKERTRREKREKKEREKRDKLANSAPYRPVGALPPPKSERYAYPPAPTEIGRQ
                     ARERLSEKTGRGG"
     gene            444643..446795
                     /locus_tag="CND01640"
                     /db_xref="GeneID:3257366"
     mRNA            join(444643..444886,445055..445085,445168..445274,
                     445338..445358,445426..445654,445886..446041,
                     446097..446795)
                     /locus_tag="CND01640"
                     /product="expressed protein"
                     /transcript_id="XM_024656975.1"
                     /db_xref="GeneID:3257366"
     CDS             join(444712..444886,445055..445085,445168..445274,
                     445338..445358,445426..445654,445886..446041,
                     446097..446652)
                     /locus_tag="CND01640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512719.1"
                     /db_xref="GeneID:3257366"
                     /translation="MFNPMMLNPMMSGYPMGTMGMPMGMGMPMAAPIPGIMPGMPGVG
                     NLPRGWFGRDQLGRDFAGPGGVGSSQPYRPPDPSALPPMPFGLPFIARPGQEGFDQYG
                     RMLPPTLPEGWDGWGRPIVAAGANPPAPAVQPLQEPPAPLAQPRTRAVPRTTQPSAIG
                     GSTYGYPNQSGSQTSTLVSETATNRPDQPPCFDRPPAQHDSYYRYEPFEAFSFSAKLL
                     NHPHQLHLPPELVSRDVNEQDWMKFIEDFAREALHGASHSLTRQARGQHTGPDPILSE
                     AVHSLLASWAVAFFAPRGIRVYAAQNGKKVIPPPIGPSHSTRGYSHASEWSDSETASD
                     DDFGYGSEDEKERQARKGDMYLPKREREIRRSERIRMRKRERRRRMREFELKNGENRE
                     AWEIHFVPATPTIWLPGARPRTYGEPVVRLKR"
     gene            complement(445879..448042)
                     /locus_tag="CND01650"
                     /db_xref="GeneID:3257367"
     mRNA            complement(join(445879..446747,446798..446846,
                     446908..447066,447140..447244,447306..447387,
                     447451..447633,447687..447755,447815..448042))
                     /locus_tag="CND01650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656976.1"
                     /db_xref="GeneID:3257367"
     CDS             complement(join(447150..447244,447306..447387,
                     447451..447633,447687..447755,447815..447961))
                     /locus_tag="CND01650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512720.1"
                     /db_xref="GeneID:3257367"
                     /translation="MSSPSLLLPGQPLPAQLITPPLPKCGKGCYERNGQILASVVGRP
                     RRDGAVVSVIGREETVGTVDVDSIVIGVISRLTPQQAHMTLTTLSDRPLPESSEDFTG
                     LIRIADIRLTERDKVKMGECFRLGDIVKAKVLSLGDARSYYLSTAADELGVVYAKSEA
                     GNPLLPVSYQEMEDEVTGKKEKRKVAKPEGI"
     gene            448259..449576
                     /locus_tag="CND01660"
                     /db_xref="GeneID:3257218"
     mRNA            join(448259..448310,448405..448433,448489..448539,
                     448596..448722,448775..448899,448950..449252,
                     449305..449576)
                     /locus_tag="CND01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_570276.1"
                     /db_xref="GeneID:3257218"
     CDS             join(448289..448310,448405..448433,448489..448539,
                     448596..448722,448775..448899,448950..449252,
                     449305..449517)
                     /locus_tag="CND01660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570276.1"
                     /db_xref="GeneID:3257218"
                     /translation="MSRSYDRALTVFSPDGHLFQVEYALEAVRRGTCAVGVRGKSCVV
                     LGVEKKSTLQLQDPRTVRKVAMLDDHVCVAFAGLTADGRILIDKARIECQSHRLTVED
                     PVSIEYITKHIAGIQQRYTQSGGVRPFGISALIVGFDPHDTIPRLYSTEPSGIYSAWK
                     ACSIGRASKTVREFLEKNYVEDLEREQAIKLTVKSLLEVVQTGAKNIEITVMESYGVV
                     KALEQSDIEKIVAEIDAEKEAEAERKRQRLAATQAGQASMAMGSSVPSGTETPAGRPQ
                     EHASAPGGDSGVQ"
     gene            complement(449543..450912)
                     /locus_tag="CND01670"
                     /db_xref="GeneID:3257431"
     mRNA            complement(join(449543..449785,449830..449928,
                     449975..450333,450385..450501,450554..450704,
                     450784..450912))
                     /locus_tag="CND01670"
                     /product="geranylgeranyltransferase beta subunit,
                     putative"
                     /transcript_id="XM_570274.2"
                     /db_xref="GeneID:3257431"
     CDS             complement(join(449582..449785,449830..449928,
                     449975..450333,450385..450501,450554..450704,
                     450784..450855))
                     /locus_tag="CND01670"
                     /codon_start=1
                     /product="geranylgeranyltransferase beta subunit,
                     putative"
                     /protein_id="XP_570274.1"
                     /db_xref="GeneID:3257431"
                     /translation="MSLAATSQPLNKSLHIKYIQDLDKKKDLAYYITSHLRLNGIYWG
                     LTALYMLGQPEALDREGVIEYVLSCWDDETGTFGPHPGHDGHILATLSGIQVLLMEDA
                     LDRADIERIISFLLKLVNPDGSVSGDKWGESDTRFSYILLSCLSLLGRLSSLTDEQIE
                     GITENIRKCMNFDGGFGLSPGTESHSGQVWVCTAALTILDRLDLVDRDLLGAWLSERQ
                     LPNGGLNGRPEKLEDVCYSWWCLASLSIIGKIHWVNADKLINFILSAQDLDDGGIGDR
                     PGDWVDVFHTIFGVAGLSLLGYPDLRDIDPVYCMPADLISRLGLRRPYSVLPRRSAQ"
     gene            451019..453980
                     /locus_tag="CND01680"
                     /db_xref="GeneID:3257434"
     mRNA            join(451019..451413,451462..451808,451861..451992,
                     452041..452056,452110..452235,452283..452401,
                     452454..453618,453676..453980)
                     /locus_tag="CND01680"
                     /product="mismatch repair-related protein, putative"
                     /transcript_id="XM_024656977.1"
                     /db_xref="GeneID:3257434"
     CDS             join(451116..451413,451462..451808,451861..451992,
                     452041..452056,452110..452235,452283..452401,
                     452454..453618,453676..453911)
                     /locus_tag="CND01680"
                     /codon_start=1
                     /product="mismatch repair-related protein, putative"
                     /protein_id="XP_024512678.1"
                     /db_xref="GeneID:3257434"
                     /translation="MPNILPLPRPTSTTLRSSIILPSLAQIFSELLQNSLDAEATKIE
                     CYVNLAKGNETLRVEDNGTGISKNGLAKIGKRFRTSKEIHEGGLGPVGSYGFRGEALA
                     SIASLSLLDITTRRASFPVYTKILRHSKTLFEGPNPDRHIAGGQGTTVVVREIFRTIP
                     VRREELAATSSTLLMSQLKKVVETLALGNPGVRWVLWEEKTTTTGGLKRIMSINASDS
                     ALDVFKTLYGGALVQSVQKIKVTAGKRKVDGFISISGDVSKAHQHLYINNYPIDRGDV
                     HTAIAKKFASSKFANLASAGQHDEDEDYHPSGRRSPRRLERYPVYVLNVTLSAGELDV
                     SYEPQKGVLGYKDIESLKTMLLAVVDEFLRRNGFGPAHTPSSMSSPTKRPVSHVSQPV
                     GRLASALGRPSPLSLSSLRTNTPVPRPMSLALPSKDSPKRVASHLSEEAPDSTKRRRL
                     MSPEKTITPRISERGTRKSKWIDDLLAKLNTGVFPLSPHTFRTTDHEHDFTGDDVASM
                     AGCSYEPTNPVSLPSPFPFTTDVQISKSSLSNATVLGQVDRKFIAVVLSTNINLTTLA
                     LIDQHAADERVAVEKVLLELCEGFAKDDLLVAELAKTRPMIILTQAEAQILSQPWVLS
                     LFKRWGIRLTMPPGLSHGEYIQVKVETVPLSLLSRLGRKEGSEMTRLVRGYLPIVAEH
                     ASEITVLVENLEGKAMEDNEGGDTEGYGGDWGRLMRFMPREMLELANSKACRGAIMFE
                     DRLSHDQCDRLIQQLSQTRFPFMCAHGRPSMVPLVILNEQQDKPVTKAKRKINWDNLR
                     NKTYEGNMDGENDE"
     gene            complement(453970..456531)
                     /locus_tag="CND01690"
                     /db_xref="GeneID:3257430"
     mRNA            complement(join(453970..456293,456346..456531))
                     /locus_tag="CND01690"
                     /product="expressed protein"
                     /transcript_id="XM_570270.1"
                     /db_xref="GeneID:3257430"
     CDS             complement(join(454036..456293,456346..456466))
                     /locus_tag="CND01690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570270.1"
                     /db_xref="GeneID:3257430"
                     /translation="MPFRARCNPANLLQRRHAVLALRKARTPLLSSVQLIQEPIRNDV
                     MYQTRLSSTTSLLSPFTSFFSRVRKSQTPETAAEDFANALQTRSFEAMSKAYYMVVND
                     PIPSNLLSEEQLLGAMKALAESTTKTPKALRLLRRIYEDFPTRFGYPVRRDHKHVVFQ
                     GLVNCGMVREALEIALSMDKKDVNWRLMLRAAVDADIALSDIVIQRFRETTPLNQEDY
                     ILLLRIIRSHPSQNKKRLEPLLAEMEQKGVTLNQNIQAEVMQVHIAYGELEKAKQIME
                     KWDFFTLEGVGPRMWDAQVQYYIAVHDLSKLQTTVLSMRDAGLTVQQNAILALALEQL
                     DQFIDSKSKVLYSDVIAAIHAAEQMAGTEPGSKVWAEVIRHYLQNVKHREALEVAMHL
                     YEECQGRGVTLDVELTRTLIIPLCSSRKQTRLDDALRIYDQYMSLASSAELESENTRL
                     RFAEVYEKLLVACARTQPPPMASVIRLLDDMRTLSLDFTPTNLISLLILLMRASPDHI
                     SAYNVYSHFHALNPNAIDRAGFSAILTTFLNLSWKHSPLTPPDLFISMMKDMDRAGYS
                     PSPYILSSLLKQYGQLATRARRGNTVESEESINGITKAIRDVHTLVKLDPLISPDIPL
                     LTALMDAYGRVGAFFEAFEVWDELVQRRAREPRETVQEVYGAAINVMLDTCGWSYSLG
                     KARKSWGWARRWGLVWEKKQWDGWIECLCRCGEVEEAGHVVLEEMGSGAIPPPDKETV
                     RLLYKFGRKQRERGRNVAGIDRLMVRVRERWPQWVEELSNERGSTRMNKSTE"
     gene            456678..462025
                     /locus_tag="CND01700"
                     /db_xref="GeneID:3257370"
     mRNA            join(456678..456887,456934..456991,457045..457181,
                     457229..457304,457356..457804,457854..458104,
                     458153..458457,458503..458660,458709..459121,
                     459184..461293,461351..462025)
                     /locus_tag="CND01700"
                     /product="translation repressor, putative"
                     /transcript_id="XM_024656978.1"
                     /db_xref="GeneID:3257370"
     CDS             join(456760..456887,456934..456991,457045..457181,
                     457229..457304,457356..457804,457854..458104,
                     458153..458457,458503..458660,458709..459121,
                     459184..461293,461351..461921)
                     /locus_tag="CND01700"
                     /codon_start=1
                     /product="translation repressor, putative"
                     /protein_id="XP_024512790.1"
                     /db_xref="GeneID:3257370"
                     /translation="MATKNALKSIKAHLGEKNSESALYEATELLKSIGPDSPEADQVL
                     VFRGLALTQLQRLDEAEKSYLHAYKLNPNNPLASVGLRRLYHKNQSWEKLATFLEVQV
                     QTTFEKQDDEKLAEVLKELLEVREQHGPEEKLYRTLDLLLPSSPVAGLLQSVTPPQGT
                     YIPLAIPVYPSASDILPTLPSPLPHPVHLAGSLSLALVSLIRSEIEIKQKIDARVNNE
                     RKRLGAGTEKDVRRKVDREILGTEGMRLVDLWKEIAGHPQVEEEIRREVEIREFEFWR
                     RLVAALPVENKIASKESAGKASQAEMPANASNELVEPALFKAKQYVAPNRTEALSHVN
                     ALADGFVLLDISAKGAEEGWRWVLEGKDEPTLFYDIDLLHKYSEAFPNSPMACFIEEY
                     CRWFKRPLPETEEDSSKTEAYERDEKAEGSVKHRKSHKGGRGALTKRQSRRAHLREIH
                     VSEDVEKEEREELFSSMTKLVDQLPMSIFAHRVMARIALEDEDWSSAISFAEKARKLL
                     TGLEAERGITLSNVRADLDTVLGVALVPHYPPKHHVRAARILETVLKIHPTNNEARFA
                     RAQIYETAGQWSDARHHFEKIVQDGGSEKERLDSKEEVGWCLANEGKLEEGRDILEEV
                     IEVRDTKTEKEKEAEARERGRTWWRLGRTEWMIGDEESKQHAEEWFMASVRAHPDFAA
                     SYTSLGVCYSSATPPDNERALKCFQRAFELDATETDAAYRLANGYADEDEWARVRTIA
                     VRVMEGEGGLEGVAGGDVLNAKGRFAPQNGWAWKALGSSEMHYKKYAEAAAAYQIALR
                     ADDQDVSTWIMLGESYVKCGRHMAGLKTFDHALTLDPDNWRALYNIGQTQSQLGAFDK
                     AIEAYQKVLEITQDEDVGVIAALAEANLSLGRQTGTGGFRERSRGAFHRAIELAMKVL
                     KSGKAHKAWGWKLIGDATYELSGQESNIEEAQDSFTVVQPVLIFLVEDDTDRRSTTPG
                     VGHAANLLQDVVSTTTSLRASIFAFAYRAHILKNEPRVIDPALYDYASALHTLAGKLI
                     ESDERKQCLKTAISAVRAALDRNAGDERLWNALGVICATAGPQVAQHAFVVSLELYSK
                     DPVVWVNLGYLYLHLDDLDLANQCFLKAQIIDPDSARAWYGQGLLADRHGDKEHAKAL
                     FSHSVTLSAQSLLEADLALAAATFAQFFRPNASVDSSLLHQPAFALKHYCHQRPRDST
                     AAHLYALICERLGLVEEAALSLENAAAVLEEEFERVESGEIENLYSVALCNLGRVRLS
                     AGVYLESLDALNNCWELIASSSEPSAVSLKPQCKLLQGLAFYWLGQIDESLEAFQASL
                     DAATQNQDYDVKEKVAVLLSRTLWGLGGNDAKETAKSNLMECLARERPSLGVISTLAA
                     IALVSSDADLTNAAVSELLTRPIAERVQDPSGQANLVLYLQAISEGREEDAYNTLQSA
                     SQAAPASRSIRNRLVEALIKAGKSKEALDVLAVKNVKEGTAEVKAKEERLLGIGELME
                     GDAKGMKGVVRSVMLAPWEDESWQALAWGKKVVEEAGLIETKDGAKDDAATKLDLTE"
     gene            463316..466304
                     /locus_tag="CND01720"
                     /db_xref="GeneID:3257465"
     mRNA            join(463316..463987,464038..464320,464372..464598,
                     464646..464956,465015..465288,465339..465526,
                     465579..466304)
                     /locus_tag="CND01720"
                     /product="carboxypeptidase D, putative"
                     /transcript_id="XM_570266.2"
                     /db_xref="GeneID:3257465"
     CDS             join(463762..463987,464038..464320,464372..464598,
                     464646..464956,465015..465288,465339..465526,
                     465579..465701)
                     /locus_tag="CND01720"
                     /codon_start=1
                     /product="carboxypeptidase D, putative"
                     /protein_id="XP_570266.1"
                     /db_xref="GeneID:3257465"
                     /translation="MWCKLLTTALLAFALGSVVGTARYTHGLRGRRPAALASMREAKR
                     EALARETSRMEESRALLERHPKRKFYNNRTSEFFIKYLPDVQFDLGEVYSGLIPIDYN
                     NQSEALFFVFQPKLGKDSKDLTIWLNGGPGCSSLEGWFQENGLWIWQPGTYAPVINPY
                     SWVNLTNMLWVEQPIGTGFSIGTPKATTEEEIAQDFIKWFKNFQDIFGIKNYKIYVTG
                     ESYAGRYVPYISAAMLDAQDKTYYNLSGALMYDPTIGETINVQEEILTYSFVEANANL
                     FNFNKTTMAELKQLHEVCGYKEYIDRYFKFPPTENQPPLFFDYNDPVDIMCDIFGMVN
                     DLALQINPCFNIYGVNLMCPLPWDVLGMPTQLNYAPGGVYFNRSEVKAAIHAPKHIEW
                     AGCAASPVFVGGEGGPQSNGDLSVDPIQKVLPRVIEATNRVLVSNGDFDMVIITNGTL
                     LAIQNMTWNGHLGFQSPPSEYIVIDINDTQWSSVFESNGLHGYPGTQGVMGIQHYERG
                     LMWAETFQSGHMQPQYQPRSAYRHLQWLLGHVDRL"
     gene            466963..468194
                     /locus_tag="CND01730"
                     /db_xref="GeneID:3257163"
     mRNA            join(466963..467104,467279..467366,467426..467441,
                     467509..467602,467655..467725,467780..468194)
                     /locus_tag="CND01730"
                     /product="expressed protein"
                     /transcript_id="XM_570264.2"
                     /db_xref="GeneID:3257163"
     CDS             join(467093..467104,467279..467366,467426..467441,
                     467509..467602,467655..467725,467780..468002)
                     /locus_tag="CND01730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570264.1"
                     /db_xref="GeneID:3257163"
                     /translation="MVDVSTHIRRGHPAFMGALLLFAIIEGCITAYLVAQFNDDDTYP
                     SHSYRDRLKFLVFTSWWTVVFAAAYMAAFLAAAGSFVSSIASHLAIWTVTWIFWLAAA
                     ASYTAALGGGMRCSVSDVAHCSSLVAAEAFAWIEWIIMTIFFIFLLTIAGAALRRGDR
                     LSAELAV"
     gene            468519..470072
                     /locus_tag="CND01740"
                     /db_xref="GeneID:3257046"
     mRNA            join(468519..468831,468886..468916,468967..469317,
                     469379..469632,469686..469748,469803..470072)
                     /locus_tag="CND01740"
                     /product="ceramidase, putative"
                     /transcript_id="XM_570262.2"
                     /db_xref="GeneID:3257046"
     CDS             join(468786..468831,468886..468916,468967..469317,
                     469379..469632,469686..469748,469803..469951)
                     /locus_tag="CND01740"
                     /codon_start=1
                     /product="ceramidase, putative"
                     /protein_id="XP_570262.1"
                     /db_xref="GeneID:3257046"
                     /translation="MGAFDKLRGDQVSSGFWGEHTSTIDWCETNYSHSPYIAEFVNTL
                     SNLPSFLIGLYGCYSVLKNGLRKRYALCYLGLSLIGVGSFGFHASLRWEWQLMDELPM
                     IYVVSYAAYLVLDTLPGFEPRFGTIGPLILLAWDAFVTVSYICLPNPVYHQVAFAAIL
                     ITATLRTIALMFDLPAGHPARRTIGIMMAWGIVTFATGFGIWNIDNIFCGQLRAIRSM
                     IGPFGVLVEGHAYWHYMTGYGAYLIFTASILLHCLIKDDIKGYHIDGRWLPTVNHRPQ
                     VASKPESKDWKGTITPPEKLD"
     gene            470281..472984
                     /locus_tag="CND01750"
                     /db_xref="GeneID:3257368"
     mRNA            join(470281..470495,470551..470580,470641..470731,
                     470777..470872,470937..471108,471161..471287,
                     471342..471514,471570..471711,471766..471858,
                     471913..472480,472534..472743,472801..472984)
                     /locus_tag="CND01750"
                     /product="expressed protein"
                     /transcript_id="XM_024656979.1"
                     /db_xref="GeneID:3257368"
     CDS             join(470424..470495,470551..470580,470641..470731,
                     470777..470872,470937..471108,471161..471287,
                     471342..471514,471570..471711,471766..471858,
                     471913..472480,472534..472743,472801..472910)
                     /locus_tag="CND01750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512721.1"
                     /db_xref="GeneID:3257368"
                     /translation="MPVLQPRPLPSGGAAVAPSKPATTPLQKIERQYRKFLAKRYMTL
                     MSRVALWIAVLLSLFSAFVSGDISKVPFAVLSSFPVFLSLAFLLRVRKSFITQPYRPS
                     PRSSLIGLIVSSFWNQRVITLLFSYAVFSITITNVWFTLLGREDMTLFNSTPRHPWQL
                     NESRFILTASNACLFLVAAARDILNDNLKADWPRERKPFAQAVKIALFDNVWGSSRIG
                     FTFLWSISTPFAYCWLGLRSFIWQWVNWRLWGVAVRPFLGSFARSTSKTPGPWALLGP
                     MLTLNMLTLLALQFPVKGLAAYTTQPIHFDEFYKKSPLSLEIYLITALKSQDPYYLQF
                     TLMELLRVVSIPRHRKIFFDDISKSPSLISQLCQELLLQFGKVHNVLVNRGVTIQPQN
                     TKSSPVAASGISTAHDERKISIRQADIFRPLAKPKSTFNLKSILDGPIQATAPSPVVK
                     LGQAGTLAIKHVESVQDRVVGRIEGNPVGGAIVSEAKGARKGVNEWAGKEWGRRSVRS
                     VLGEVLVAQRVIEILVILSIASIEEDTYGNVQQVLPAILEAIVRFREAIFALEVQLLA
                     QTRLLGPAQSGAMDEVKKDLYVAIGSCDKAVKRIADTFGQSLSSFRFPPSVAYGLGEI
                     CKG"
     gene            473622..475313
                     /locus_tag="CND01760"
                     /db_xref="GeneID:3257375"
     mRNA            join(473622..475074,475131..475313)
                     /locus_tag="CND01760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570407.1"
                     /db_xref="GeneID:3257375"
     CDS             473647..474828
                     /locus_tag="CND01760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570407.1"
                     /db_xref="GeneID:3257375"
                     /translation="MAYVPLPSRPNQRVVIVGAGIVGSCVAAILSERLGSNIVLVDRD
                     IRELPGSTGHAPGLVGQYNELPVLTELAKRSVKYYQNIDGGFDQSGGLEVGQGLEKRF
                     EGAQKEGLEAKVLNKEEILQIAGAFVRDDISDGHAGVFFPSDGTANTITIAYHQQHKA
                     ASNGATLLNADVKSVIESSNGNGRILQTSRGRIDCHTVILCTGIWASQLFSGFTQTVV
                     PVAHPYSYSLPNNHQSKTPFVRWPSKHVYARDHGRMDGLGSYAHAPIHVHSDQIGETA
                     YGQWEPSFDDVLKEGYSLLPQETAERFKGGQKFNGLFSVTPDGLPLVGKLEDGLWCAV
                     AVWVSHAAGCAGLLADMFLGTADEKDAGLRKALDPKRFEGEGLESKALAKYNDIYNKI
                     S"
     gene            complement(474933..476158)
                     /locus_tag="CND01770"
                     /db_xref="GeneID:3257253"
     mRNA            complement(join(474933..475063,475117..475352,
                     475425..476158))
                     /locus_tag="CND01770"
                     /product="expressed protein"
                     /transcript_id="XM_570260.2"
                     /db_xref="GeneID:3257253"
     CDS             complement(join(474983..475063,475117..475352,
                     475425..475485))
                     /locus_tag="CND01770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570260.1"
                     /db_xref="GeneID:3257253"
                     /translation="MYIPNVQNVIAAGLALTGAYTSTVSSGKILDYAVEKCIDKEGNH
                     RCSKPFPVTKSTCYEIKWTTDGKISHTTAEVRDAGSNEIVFYRDTNGEWTPEKNELVY
                     VDFKPKVWGQGNNTVEYEVITCK"
     gene            complement(476673..482055)
                     /locus_tag="CND01780"
                     /db_xref="GeneID:3256935"
     mRNA            complement(join(476673..476860,476925..478307,
                     478365..478721,478777..478845,478896..479003,
                     479058..479450,479502..479621,479669..480187,
                     480241..480295,480340..480420,480477..481270,
                     481328..481378,481439..481698,481917..482055))
                     /locus_tag="CND01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656980.1"
                     /db_xref="GeneID:3256935"
     CDS             complement(join(477060..478307,478365..478721,
                     478777..478845,478896..479003,479058..479450,
                     479502..479621,479669..480187,480241..480295,
                     480340..480420,480477..481270,481328..481378,
                     481439..481489))
                     /locus_tag="CND01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512675.1"
                     /db_xref="GeneID:3256935"
                     /translation="MSTGREMDYKQKNRSRKVPHIVSKSDQKIVQVMTETNNAHHSGI
                     KGGVLANHTEPTTECEAPNEMSNRGILHHLEDSQPAPNSAGKSALEFPSLKSARAIPP
                     SRHQLHPSLVMTPQNENTSIAMCHSAINGMPNSKKDGRLSPLNKYMGSCSRTKNEENI
                     DPTSATTPVSACNIDRVSSSQPRVSSQKLPYTKSSILTIKSVSDPQTWEDEKNKTFSA
                     QISGRKKHETPITEIPFASVSRPSVSVTTGSTSVLCDNPDAPDTGSLSQIKSPESRRK
                     DWWRRDPHPMFSPKYAAQRLLVEFPSAINVIHAKPILESHFSKYGKIHSVYHYDQNGD
                     RCCKGFVVFIDPMSIQKVLTDPYSNICANALDPEAPRDMSIAIRPSSASDLERTVFIR
                     ITGSRSEEEACERHHEYQLLCEREMEAKNMPNDDHDLFGITHDMRGMAKSDGLSLFHK
                     ALLPEKVILDQVPMRGKTPGKYYSTVCVRNLNTPWFDFVRQVRERCGKDPAQIGEIAL
                     RGPNISERNFVPQLCDHLAEICNVRPPNENSCGWLVSVSGSRDGRHMMHELQKIPGFF
                     VRWADEGDGLFDDAEPALEMSPPNCAGSFEDSSSPTETDDVRSLSTPQTNNHVLSALL
                     HPSPTHPHLRRTLIHTYRGRPLIEDNSTGETKFLDESAIFVGRLNKRMETYATLYKRF
                     EKYGKICNMEFNPKAVPSHVNNATARIMYQGQESAARAIARENGSISFGTAIKVELRR
                     VIHSDVHTRRVYVDLTGRIIRPPTLSNLACEPAIKRVTESQSAIEARMRQPQFSSGLN
                     MPSAAYLPMSSQQPGFLQPDVGIGMPTATFPPRFSLSPPAFSTGHGFQHLSMLGGQGH
                     LSPTYDHIMPIVNSFVHVGQLSNGMMTADRFLYPLSEAFQSPQSLTGKSSSMAYPPAE
                     EVHFQPPLDEQFFAGQSHAIPATVQYPVSALDEPSSRTPGVSSHPELPTIAPIGDEGI
                     SSNMKLKPVAYKEENGTVKAIYDDNELKAYCVQNNLPYPPKPEKTIKKGSDETFTVTQ
                     DWRKSLLPVQTGGHDSSLPSPLRRGSLAFSEAQELSSLSRLRLRRSQSDYSLPTNRKP
                     QDCCRVVDERVNVANASTTSHCKENSYCSSPRLAKPPLLNHDPMPDYRNQLIQAQANN
                     FPDTHGNLKQPPFNLPFRQPLSPPNVQFDPENLEERMCHLDIHGQNSLSTFTSSAQAQ
                     GSQGWYSTSFDALTYQLQNQQPATKHIPPDGNSWIANESPVVQGPKCDRVRSKARGRG
                     SRRKTFFGRFSGEQHLSKQ"
     gene            483000..483665
                     /locus_tag="CND01790"
                     /db_xref="GeneID:3256966"
     mRNA            join(483000..483153,483207..483222,483280..483322,
                     483372..483426,483483..483665)
                     /locus_tag="CND01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_570256.2"
                     /db_xref="GeneID:3256966"
     CDS             join(483116..483153,483207..483222,483280..483322,
                     483372..483426,483483..483525)
                     /locus_tag="CND01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570256.1"
                     /db_xref="GeneID:3256966"
                     /translation="MHLMYTLDERGNRVYTLKKVTAAGKPTKSAHPARFSPDDKFSRH
                     RVTIKKRFGILPTQLPCKPL"
     gene            complement(483548..485575)
                     /locus_tag="CND01800"
                     /db_xref="GeneID:3257085"
     mRNA            complement(join(483548..484000,484054..484234,
                     484297..484440,484495..484510,484569..484672,
                     484747..484921,484984..485575))
                     /locus_tag="CND01800"
                     /product="expressed protein"
                     /transcript_id="XM_570254.2"
                     /db_xref="GeneID:3257085"
     CDS             complement(join(483795..484000,484054..484234,
                     484297..484440,484495..484510,484569..484672,
                     484747..484921,484984..485417))
                     /locus_tag="CND01800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570254.1"
                     /db_xref="GeneID:3257085"
                     /translation="MASPAKAYPSRRSFLHFIQNPHHLVRPSIRLKTTLYSLSLVIII
                     LLVLALNAATTPPTHAPDIAKSPSPDTPADSGEGKDIAQGKDAHLVDGDIQRSFEEPD
                     YALLSGRQPHEIGCDIPLEGDGKGVLVFLGIFSTAQNKGRRDLYRETIIPDFPPELVT
                     VKFILGTPPYPEQSSISERSKRTKLLKDVSKEMKEHGDMVMLPMIDNIDLGKTHEYFK
                     WVAHEYAGEGRVKGRPRFVMKADDDTILVMPNMISAFKDLDCATNVYWGTSAGRSHYF
                     GDYFRGLAYAMSWPLVSWIGSANMTHAHITKIEDARTGQWLRHLDPITDPIKRIDMGW
                     TMGDWNQLDVDTKTVALHWCKLDDWVREQHRRLLQVWSDAGREYTAENGVPPRESIAK
                     GKITPQEAAKEHQRQKELGWDVQGNLE"
     gene            485776..490517
                     /locus_tag="CND01810"
                     /db_xref="GeneID:3257331"
     mRNA            join(485776..485946,485995..486124,486172..486844,
                     486895..487134,487190..487292,487346..487804,
                     487852..488421,488478..488647,488699..488798,
                     488849..488969,489020..489251,489299..489432,
                     489492..489563,489618..489777,489835..490517)
                     /locus_tag="CND01810"
                     /product="Dynactin, putative"
                     /transcript_id="XM_024656981.1"
                     /db_xref="GeneID:3257331"
     CDS             join(485828..485946,485995..486124,486172..486844,
                     486895..487134,487190..487292,487346..487804,
                     487852..488421,488478..488647,488699..488798,
                     488849..488969,489020..489251,489299..489432,
                     489492..489563,489618..489777,489835..490376)
                     /locus_tag="CND01810"
                     /codon_start=1
                     /product="Dynactin, putative"
                     /protein_id="XP_024512671.1"
                     /db_xref="GeneID:3257331"
                     /translation="MTSQEVPIDAKVQVSAGIGYVRWTGANPGFAAGKWVGVELFEAG
                     GKNDGSVKGERYFECKPNHGVFVRPSQVRILEAPMPTETPRPQSTRPSATPSAHRLTS
                     ASSARAASPQKQPTTRSTAPPTPSQTLRVVSGSSSIEDVVPSTAPMTRRVSNSSSSRP
                     SQGIFKRPPSVLDARALTIATEDIEHVAAHSIVSPPPGRISSPTRRVVSPTPSISQQS
                     RTRSISSAFVAPPDPAALEQASTQPQSLSRPPSPDEEHTLSAQKRELEELRIKIRILE
                     SKKHEDQEKIRDLETRVGEADSLKAARVRLQAKFQEIQSSLLTAQRQARDLQSENSIL
                     ETRAAEALDQLEMAALDREVAEEKAEAAEADIVKLGEKVAELEMEVAVLKEENAEYEK
                     PVGGIEGERTSLAFVQLEKHNERLKEALIRLRDVSAEAERDHKVKITELEKVLTSQED
                     LISQLEFAEAKLANAESQVEDLKQQLDDALGAEDMLEQLTDRNLQMGERIEEMRLTIE
                     DLEAIKDLNDELEEGHVEAEKQLNEEIEALTAQLRQERVRSGELDALVLDMETTINQF
                     RDLVASLQSELETIRLQQITRESNITSTSKESQALMNLNLKLQSTAAKAQSKTIDLDL
                     KKLEAYQLAEHLRIVQAYLPEAYHKTEEDSTTMFLFFNRVAAKVDLLINVISQIHGLP
                     ASLHGASSEALVGICELIGKLHHFSTLNRRFAAIMRRGTSEEWMGYGKFIGDVGGVES
                     RVDVWLNGLKADEFNEGDCARDLGSLIAQFDHFAETTFNHPVLDTGEQQLGLAHLFDC
                     DLDNFAAAVGFARQAIAALTSEGDIEVEVGDSSLEEGVYEPVQRILDLVRSVKIPSSK
                     MVLQVKEIVQTSSAFQPEIELMLRDLTTSVSNVVDLAVQLAQRIGQHVSTLRNTKEPL
                     RLSDIESFLQDVTAQSAIAGSNAHPWELIAMFVSKLGEDLNGTLPKIKEAAKDGKIVS
                     LESTPPWLGRVASIKEAASHNADVEKQVVKLTEEVKDMLREIKIRDQSLQESGVKVET
                     LERRLEASRKQADIIIELENDVAKARKQEKVYEDAIEQLQAEQDALEVENARLRKGQV
                     QSTDRQGNGVSATPGFGGEPIIIGNGAGLESSQLAEQVESLKSAVRFLRSENALLKSR
                     ELYNDIHSLSALRYRSEPQMPELISSNAPTSPSSSESSLPTTPTHSPIRSLPMTKHII
                     GVESRILLHQMAKFQASTKIVDISNLGGKEGWRSRKNAPELQYREWKKKEKRLEKKLE
                     GLVGRSKGLSGL"
     gene            491096..492869
                     /locus_tag="CND01820"
                     /db_xref="GeneID:3257298"
     mRNA            join(491096..491490,491544..491801,491857..492153,
                     492207..492390,492451..492584,492643..492869)
                     /locus_tag="CND01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_570250.2"
                     /db_xref="GeneID:3257298"
     CDS             join(491260..491490,491544..491801,491857..492153,
                     492207..492390,492451..492584,492643..492810)
                     /locus_tag="CND01820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570250.1"
                     /db_xref="GeneID:3257298"
                     /translation="MRSHNGHVFIRRSIETTNNGKYHCMPRYIKASHSSLPPPLLRSQ
                     YFLPTQHTTTTTVMFRQTSIRLASTATPARAVLRPKAAIRPSQPRYNGLRSVRRTYAT
                     DVPPPSQPSGGNGGSNGPMFLVLAAIVGLGAGGYYYLKPVRDVATITNQSINSMKDNA
                     SSLSDLAGYAKSMLPPGAFALYSHLSKQEGGINGFLSSLKDKDLKEVLEELKKAGGDD
                     IKRIVEKVQKKVDEAKGNVEKVDWKGLAQDLKDELPESSQRVVDMMIGRIPDKAELEN
                     LVKKAKSIGDDQLKQFEEAANKVWQKVEQAKKDGKGQADALLTGLKEAAPADVDSLIK
                     QLKDVAKKAGLPADTTEAWLKSKVEDGKVDADGLAKQVEGKLKTAAKFIPGEPKDLVQ
                     QIEQVSPSLAKLVSQALQQAGVSDEKGNKKV"
     gene            493129..494094
                     /locus_tag="CND01830"
                     /db_xref="GeneID:3257122"
     mRNA            493129..494094
                     /locus_tag="CND01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656982.1"
                     /db_xref="GeneID:3257122"
     CDS             493299..493778
                     /locus_tag="CND01830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512669.1"
                     /db_xref="GeneID:3257122"
                     /translation="MTTTSHTSSSIADQAIDLIPQLSAATGKDFGTTLAQFSQYAFEL
                     STASEAEKIYATSVLKEAWSQLNLDKVTDHQVPEIVKVWARRKPQEGEVIRAQVKSAI
                     SKAKETLESFKGSSISDGRLRDGLSDLVNKFCFDALSDCNNTATATNYVSHFFFFLY"
     gene            complement(494075..498998)
                     /locus_tag="CND01840"
                     /db_xref="GeneID:3257146"
     mRNA            complement(join(494075..494313,494369..494684,
                     494738..494900,494951..495113,495163..495344,
                     495395..495600,495653..498248,498305..498998))
                     /locus_tag="CND01840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570246.2"
                     /db_xref="GeneID:3257146"
     CDS             complement(join(494122..494313,494369..494684,
                     494738..494900,494951..495113,495163..495344,
                     495395..495600,495653..498248,498305..498926))
                     /locus_tag="CND01840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570246.1"
                     /db_xref="GeneID:3257146"
                     /translation="MATYIPHHLVHVHLPAPPSIPASIPELRVPVDEPIPIPDEAYEE
                     PLHPDHAVSVVHDTANNILARNIFNGYVLELRPFGPTIAKQRQNIETGSEIVRIFFPE
                     PLRALSPGLIRLSNEEDRLFIIVISQANVIYRLNFPLGTFRQGTDDRFIFTTQGEEWL
                     EDWEVPEHLIGACGGVGATTVLNGDTVVLGGGDGGIVIVTRSGNYSPDSGHWEATHYR
                     ASSKFRLPSLFSRSANSAEQIVSFSEFVKEGHVKIIYTLSRDRKLRAWNAETGACLRT
                     VDVRSSSQAVTLRGSDNAAFNSEDGSVSMIRVVQHPFASSRYSHLVVTFFSTQHSASS
                     AGSFVVFRASTNSYGVSDLSFAGEKPCSPASAGSELRGLEILAPVKLHGVDSGWRLWA
                     VWDRDGSPVCEVVTIDDVFQFTTYIEANNSPLLSDWQVVVAPYNVERFDAAYFDNLLP
                     PTPPNPAEPEDNGDIPATFIQHLFHPGRFSTLTLQTALEDYTYQLSRKSNRAQVSGPI
                     SSLSKRFGATVGSQLEIEVNPDTGAPVVDVYRKQLKLEWLGIWASVRDLDRQSRWPVS
                     TSTIGQSLFVLTREGVSVPVPEEAAGVVGRLGKSEIEANEFLNLPEGALCRVYPSLGW
                     SDARIAVLSVTMSGEYIAGLLKSREAQSDDSDVPSTGSLLDVLIRNINDTLSAGLQGP
                     PELVAGSFWDDFLDPVLTEEERMNIRRILSETSSVNRGLVQCVEILEDTSFALYSSEA
                     NSGPSSSFSGLGNALLSSTLSQIIESRYGLAQNILFTSLFYLADSFDPLDDSEKSEEL
                     IEILARVMVAYHRYRVLKWVAGQTGEEAGERKQAAKVQKASRSKRKLGDDGLIDVSGG
                     LKIKEMEDNEQDTDRFTTEYSLLHCLTARSLAPEVPGSDMSISVLLQAAMNVLDQIHL
                     LSSNQVDIAAQSPDVVLGNKIFIDGHPLLAGAYSDLYPLSSGIAYLKGRAYLEAGVLE
                     GAMEYLQKAAAGCKDGSLTSILPSASGPNSLSSYYSEVCDAFKAHGISRAAASFGQLA
                     IDTAPTNAPPSRDLWTKVFMANLELSLYEEAYAVLTSLPFMDMKRDFLGHLISEMCEK
                     NEVGRLNSLGFIGFQTDVEELLRFKARNSDPLRRPNYYKVLYSWHVTRGDYKSAGEVM
                     YLQGRRFAEGSGSKYPTFELSAMQARSYLAAINALSLVEKRNAWFSVPGAPTKSLKGL
                     KRRKMSSYIPEEEFTKGKSPVDIITLEDIEMEYTVVLSQLRISSHIPDIYDHGVAVSP
                     QEIVGLFVQRGMYDIAQSAASSLKVDMTDLFQSLATRCVELSRLQEHAGDISAAAFLQ
                     TSPITSRLQGPPATLALHYLRVALQRHDSLKTNWRYREAVADTLFELNKDKRQGWNMP
                     AWLVQWEMERSPEGWIGRALRWGWVSEALDWSIENLRQATPPELLPKEKSGAVYIPYN
                     LFDRVLAAAGQGDEIEEALVQQKSKILREEVSRRLKGLESLRM"
     gene            499208..500663
                     /locus_tag="CND01850"
                     /db_xref="GeneID:3256967"
     mRNA            join(499208..499871,499918..499949,500004..500290,
                     500340..500458,500513..500663)
                     /locus_tag="CND01850"
                     /product="phosphoprotein phosphatase, putative"
                     /transcript_id="XM_024656983.1"
                     /db_xref="GeneID:3256967"
     CDS             join(499281..499871,499918..499949,500004..500290,
                     500340..500458,500513..500614)
                     /locus_tag="CND01850"
                     /codon_start=1
                     /product="phosphoprotein phosphatase, putative"
                     /protein_id="XP_024512667.1"
                     /db_xref="GeneID:3256967"
                     /translation="MDPRRRHNQRPPPPSSSLPPNPATYNAPPNSYGGSYPDTRQYQG
                     HNGAHSTPQGYRSAPPPQPPYGAFSGEQRAFPPSNMPNYPPSGPPDPRMRPSQDPRSR
                     LSGPQGSYNTPTPPSGHTPPSLPNYGTPPISAPTIPLPSQQSHQQFYTPPSGPTPSLP
                     GAMPAGVISEPANGFVDKDVPQGRRRPLFCVVCASNNNRSMEAHYVLNKNSFRVVSAG
                     TGSAVRLPGPAIDKPNVYRFGTPYDDIYRDLESQDPQLYTRNGILPMLDRNRKVKKAP
                     EKWQELKSVLADVVITCEERCYDAVCDDLLTRSGEYNRPIHIINIEIKDNPEEAHIAG
                     QSILELARAIEASDDLDSDIDAILNAHGDKHPHTLLHTVGFY"
     gene            complement(500578..503411)
                     /locus_tag="CND01860"
                     /db_xref="GeneID:3257322"
     mRNA            complement(join(500578..500920,500971..501203,
                     501263..501342,501403..501418,501490..501553,
                     501614..501729,501783..501883,501935..502017,
                     502075..502285,502349..502441,502501..502532,
                     502592..502692,502767..502938,502990..503012,
                     503087..503099,503162..503288,503344..503411))
                     /locus_tag="CND01860"
                     /product="phospholipid transporter, putative"
                     /transcript_id="XM_570242.2"
                     /db_xref="GeneID:3257322"
     CDS             complement(join(500809..500920,500971..501203,
                     501263..501342,501403..501418,501490..501553,
                     501614..501729,501783..501883,501935..502017,
                     502075..502285,502349..502441,502501..502532,
                     502592..502692,502767..502938,502990..503012,
                     503087..503099,503162..503271))
                     /locus_tag="CND01860"
                     /codon_start=1
                     /product="phospholipid transporter, putative"
                     /protein_id="XP_570242.1"
                     /db_xref="GeneID:3257322"
                     /translation="MRLPWVKKNVDLEPKTGDEPHDSNFIEKKLGLSKKGAIFAAGAS
                     LFSDGYANASIGPATTIIKTYVYPDLFESRPVNSRLLPAIAFAGIIVGQLSFGWISDK
                     VGRKFGMLLCTGIVFVFSALQAASKGVGGAQGTINALIAYRFLVGIGIGGEYPTGSVA
                     AAENTEDPDIPKASQQRLFVLATNSMIDAAFVISYFVCLVLLWIFGMNHLNAVWRMTL
                     GLGCVPPLFLFYFRLKMKEPESYEKYSMKHTRIPYWLILKRYWVKLAAVSITWFLYDW
                     ITYPFGLYATPITDAADPNGTLYTSIGWGCLINFFYLPGTLFGAFIVDYLGPKYCMIF
                     GLCMQAIFGFVLSGCYNLLTQPHRIAGFAILYGFFLSFGEVGPGNNLGLLASKAIGPT
                     AARGQLYGIAAAVGKVGAFIGTYTFPQIQASFGKHGQYAEDTGVFYLGSALALVSALI
                     TLIFIPNIQPDAMHDEDIAFREYLEANGFDTSKMGLKDTASDVEVGDGSRDEKENKTP
                     NESIETHALAI"
     gene            complement(504288..505924)
                     /locus_tag="CND01870"
                     /db_xref="GeneID:3257399"
     mRNA            complement(join(504288..505469,505524..505639,
                     505698..505716,505795..505924))
                     /locus_tag="CND01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656984.1"
                     /db_xref="GeneID:3257399"
     CDS             complement(join(505394..505469,505524..505639,
                     505698..505716,505795..505838))
                     /locus_tag="CND01870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512797.1"
                     /db_xref="GeneID:3257399"
                     /translation="MSEEHEHHVIGGYKATLANPKTSEEAKAHARRAIEEYEKKHKSG
                     GGSTEHDHRVAGGYKAALHNPKVSPEAKQHAKEVLKEHDV"
     gene            complement(506781..509349)
                     /locus_tag="CND01880"
                     /db_xref="GeneID:3256927"
     mRNA            complement(join(506781..507071,507121..507367,
                     507420..507511,507565..507721,507773..507872,
                     507925..507989,508041..508119,508183..508257,
                     508316..508405,508462..508533,508587..508689,
                     508751..508829,508880..508967,509021..509038,
                     509100..509349))
                     /locus_tag="CND01880"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_570240.1"
                     /db_xref="GeneID:3256927"
     CDS             complement(join(506924..507071,507121..507367,
                     507420..507511,507565..507721,507773..507872,
                     507925..507989,508041..508119,508183..508257,
                     508316..508405,508462..508533,508587..508689,
                     508751..508829,508880..508967,509021..509038,
                     509100..509126))
                     /locus_tag="CND01880"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_570240.1"
                     /db_xref="GeneID:3256927"
                     /translation="MSDDEFMMDDIADDEEYDFDYDDDDDDVEEGAVGDVENQYYKAK
                     ALKEDDAQGALKAFRTIVDDQPEKGEWGFKALKQMTKMNYLRLHEPEKALETYRELLG
                     YTKSNVTRNYAEKTINNILDYVGGEGKHAAKAPKVPLDTLEKFYEVTRVACDEAKNER
                     LSTKCNLKLAKLWLDRKEYTRLHPILQSLHATCAPAANSVSSDDQSKGSLLLEVYAME
                     IQMYSNLKETRKLKAIYNAAMQVRNAIPHPRIMGVIKECGGKMWMQEKAWGKASEDLF
                     ESFRQYDESGSAQRIQVLKYLVLNTMLMGSDINPFDSQETKPYKNDPQIVAMTNLVSA
                     YQRRDVQEAESILKANQATITNDPFIDHFVGDLLTSLRTQYIVDIIKPYTRLELDSLA
                     DKLNIHRSEVESLVVSLILDDKIKGKIDQANGILVLDRFGMAQRKRYQALGTMAAELD
                     ILAGKVESEKLGVKDGGARAWVGSQAIFG"
     gene            509485..510724
                     /locus_tag="CND01890"
                     /db_xref="GeneID:3257088"
     mRNA            join(509485..509589,509634..510258,510312..510724)
                     /locus_tag="CND01890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570238.2"
                     /db_xref="GeneID:3257088"
     CDS             join(509577..509589,509634..510258,510312..510696)
                     /locus_tag="CND01890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570238.1"
                     /db_xref="GeneID:3257088"
                     /translation="MTRSHAKNNTTQSTLTHYERSLLRKDGAARRIGGDSFKPLDACY
                     LCLSQVTDPVACSRGHIYCRECCLSNLISQKASIEAQKREMERWEERERTEREEAKAK
                     ARERVVQDFEKGMALGSTGGRGIVRNEEAEKKGENGVGSKFKLDESIVEKVAREAEEK
                     AMKVLEEEQTEARKAKLAAFWLPSLTPEAKMGPMKDIKLQTLCHVGAQPHPISRKTLL
                     PVILTYPPNSKVKPICPSCSKELSNANTSFLLSSRSPLASTDIGGEDGRKKKKQKKDR
                     EDPLVCGHVICQTCTDTIVKPQGRCSVCEAKVEEEGRIPLGKEGTGFAAAGGAEVRKS
                     VTAFRV"
     gene            complement(510696..512565)
                     /locus_tag="CND01900"
                     /db_xref="GeneID:3256852"
     mRNA            complement(join(510696..510985,511041..511232,
                     511286..511545,511601..511775,511831..512294,
                     512358..512371,512443..512565))
                     /locus_tag="CND01900"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_570236.1"
                     /db_xref="GeneID:3256852"
     CDS             complement(join(510767..510985,511041..511232,
                     511286..511545,511601..511775,511831..512294,
                     512358..512371,512443..512486))
                     /locus_tag="CND01900"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_570236.1"
                     /db_xref="GeneID:3256852"
                     /translation="MPSNSPYLPILWACISSWYYGFHLSELNFPALSLTCTSPSSSSL
                     IPQCLYLSESLYAFTTAIFTVGGLLGSLSNPWIVSKYGLKGGISLTGWINLFGATAMT
                     LAPHWIILAAGRFVTGVSSGLAISLVPPYLSIIAKSSKELVHRSGQIGTMNQMAIVLG
                     ICSAQAAGLLLTGEKGDVPGSWRYVVSISGFISVLQILASQTISVSSEEHSRPTQSSA
                     FDPESESRPQLHDEAASPLLPSSQQTVQLNLRQILSNPSLRGPSLLCAAIMALQQLSG
                     VNAVMFYSTPVLRPLLPTSVGLVGIGITIVNAIMTVPAMLLMDYLGRKVLILASIIGM
                     AATSILLAIGLNGHHQIMSAISIIAFVASFSIGLGPVPFLLISELVPPPAVAALSSLA
                     VSTNWVTNFFVALFFLPLRDLLSSPPDPRSPESGREGEGRVFYMFTAVLLMGGIMIGR
                     GLRTN"
     gene            512770..514490
                     /locus_tag="CND01910"
                     /db_xref="GeneID:3257414"
     mRNA            join(512770..512826,513290..513446,513500..513645,
                     513693..513805,513860..514007,514061..514136,
                     514189..514224,514310..514490)
                     /locus_tag="CND01910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658475.1"
                     /db_xref="GeneID:3257414"
     mRNA            join(512770..512826,513290..513446,513500..513645,
                     513693..513805,513860..514007,514061..514136,
                     514189..514224,514331..514490)
                     /locus_tag="CND01910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570425.1"
                     /db_xref="GeneID:3257414"
     CDS             join(512808..512826,513290..513446,513500..513645,
                     513693..513805,513860..514007,514061..514136,
                     514189..514224,514310..514397)
                     /locus_tag="CND01910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514329.1"
                     /db_xref="GeneID:3257414"
                     /translation="MSDPNDVWKDSSATNGAPVDSYARESSPRRETRGDDARSPRRDR
                     SRSPARAPERADRGRGDGPNTVNQGNNLHVSGLSRAVTERQLEDLFSQIGKVAKVQIM
                     VDPHSQESRGFGFVMMESPEEAQAAIDQLSGQNVEGKSITVAHARRGRARTPTPGRYH
                     GVKADSRPQHSSYDRPYQPRSYDSRYYDRPPPRAYDERDRYDRRDRYDDRRYDDRYAR
                     DRYDDYYRSSGGAPDSYYYRSERDSRYERREERPRYDERPRY"
     CDS             join(512808..512826,513290..513446,513500..513645,
                     513693..513805,513860..514007,514061..514136,
                     514189..514224,514331..514397)
                     /locus_tag="CND01910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570425.1"
                     /db_xref="GeneID:3257414"
                     /translation="MSDPNDVWKDSSATNGAPVDSYARESSPRRETRGDDARSPRRDR
                     SRSPARAPERADRGRGDGPNTVNQGNNLHVSGLSRAVTERQLEDLFSQIGKVAKVQIM
                     VDPHSQESRGFGFVMMESPEEAQAAIDQLSGQNVEGKSITVAHARRGRARTPTPGRYH
                     GVKADSRPQHSSYDRPYQPRSYDSRYYDRPPPRAYDERDRYDRRDRYDDRRYDDRYAR
                     DRYDDYYRSSGGAPERDSRYERREERPRYDERPRY"
     gene            complement(514482..518137)
                     /locus_tag="CND01920"
                     /db_xref="GeneID:3257260"
     mRNA            complement(join(514482..516713,516765..516838,
                     516895..517089,517158..517311,517374..517526,
                     517611..518137))
                     /locus_tag="CND01920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570465.2"
                     /db_xref="GeneID:3257260"
     CDS             complement(join(514611..516713,516765..516838,
                     516895..517089,517158..517311,517374..517526,
                     517611..517769))
                     /locus_tag="CND01920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570465.1"
                     /db_xref="GeneID:3257260"
                     /translation="MPRTEETQYPGAGTLYVYSASPHRGISPSRSNKRRQSPSAWATI
                     PTKWEDIVTIKEEPVTMATPDSLLQNGIAEFTYLPYSSEGVLGRGKFSTVYKVTGSDG
                     NYHALKHTPLYPHHPLISARLLREPTLLAELPRHPCLIGVEGWVRTEGHFYLVEEYAT
                     NHVPLPTHPLPITPSRAAYILDQLVSCVRDTLHEKGRVCHRDLKGDNILVDADSGDII
                     ILDLGLATRFSMSQPKLSTCCGSPAFHSPEIVMALSRPPGEITYYGPELDIWCIALTL
                     LSLLLQVRFPLGPKHTSPYVMRERAMDRLQELDELYPRHSPWRPRPLSRSARMNGYDR
                     ANTQDTDVDFEKHEWRRVRKAMDDFLDIDGVRRMEKFRAYEIGDKTRQKVASYEVKEV
                     EKKFKLINFIPTEVKYTLPIFLEEEEIIKKKTGVISFSNPLGESERRVKSYIKYLLRS
                     AGILYHVLPPQQISNSATMPTPPQSSDPSSSPSFILQIVVPLPNQPSSTASSTAPLSP
                     SSLTGWFPSIFSFRQGLNKPSGASPAGRSVSVPPIKKSHSPSPVLLGDKAGSNRRDKL
                     LRCYIKVEFENNQRSPLSDRDRRSRASSETFISLREGLDLTTLHQVSLSSTNSTSTSA
                     TPAQSNSTVHTTPRPAHPQRSASACRHPQARPHPRRAASLAPASKDALSTHRTNAAVG
                     MMNMTVPPSPLSRNVSLGSSPSDSETPASRIFNRPPSRASSISRKASGARPSLLLSHA
                     HSSFTLPNQYPARLSSIESKIHIHLSDQRAYSVLVKALDIKHDGALGMHHGVGDPALS
                     PMSVRRPSLAPSVTEGVEIPNGGLEEELELEPERGRARSKDDGSSLLFGYRNGNVPSP
                     LSPISTSTKLPLATTTIIDALTPVDIRLEGNANRGHRPRDHFEKRAPRDTSRGRGLLN
                     MLFGKSGDIKVSRSSSVPPLASGEIMTPPLW"
     gene            complement(518453..522883)
                     /locus_tag="CND01930"
                     /db_xref="GeneID:3256903"
     mRNA            complement(join(518453..519275,519326..519622,
                     519673..519763,519812..521681,521734..522363,
                     522707..522883))
                     /locus_tag="CND01930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656985.1"
                     /db_xref="GeneID:3256903"
     CDS             complement(join(518635..519275,519326..519622,
                     519673..519763,519812..521681,521734..522344))
                     /locus_tag="CND01930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512733.1"
                     /db_xref="GeneID:3256903"
                     /translation="MVVTVIAPHDLHRNSPSNAADALSSGLSPISFDQRDRGHNTGYK
                     LSPESSAVISSPPQPTHMSLPRRSDTFPPSLESDELDHAGPSHATSRPIPPPPNPRRH
                     RSGILMSRVRAASGSSIKMKSAVSGSKSHGDLMSVVERIDDDLVEDDEMEELDEEADF
                     DKDESLRRRRLRGRSNDGWKRIVSEGGRHESTDEGGEASFWDNSARYYHHLHSHPSSR
                     TGSITASPEPSPVASHSASPIIVPRSLSLPQHGIGPPLQGTSKSLSPNQQFLQSRLPP
                     TFPNCPNGTVQETNFQEHFCPAAMVFTPTTQEWKDFQAMPEWKTLHESKEETSFSGGS
                     SEDAAQNQHSRHASLESDSDKFLSARPALRSTISAEYLGPEDYHTPDPGSPSGKSGEI
                     DDSAKPSFKPNIISASPIIYPTDRMASSVVPFDFSSTAEESQLPDGRIMSHGALGLEN
                     TAPTLSSNDHVVRNSDHPPPPVRWNSIGNRDSLRAVHGPEAPTLPRTKTKRELEREKL
                     LKMVDEELEAENQLSKNDGWGGGVQQIGNGLGLDHVKSNSTGNIQSVKLVEEEKGPIP
                     DVRIDPDALERPSSADPLENSKLGMQPPNPFDSGFGQAQSKLNQKASLSPTHPFKPSP
                     LNAEPIVAEDAHSIPSTTSVTPHDTTPTGEIPPPIFPEPPATSLDSIRDYARGLAPPG
                     SPRTGDAVPPKSPRSTRKRDTNRVSLVAGRVVQPFTLPASTSLPASSKPPESPSLQAF
                     SPFRSPALSRPSSATLQHHSFSRLDSTLSIAPSTGVPSECGTPTEEKAGGMGGRGIDD
                     YVILKEAGKGAYGLVMRAKLKGPKGEPVGDEVIIKYIIKARILADCWKKHKVLGPIPV
                     EIHVMDQLRHLLYTPPKQMNPWDPARSRSGATKPDGASRSDNEVVSTLETPGSPGSGS
                     ENGRLYTSTQKHIAEEIKSSPQRGHPNICKLVDFFEDKEFYYLVMPCFGNGMDLFDRV
                     ESQPSGLESFEVRSLIGQLSDAVQFLHANGIVHRDIKDENVVLDGSGHCQLIDFGSAA
                     HWRPGKKWDTFSGTLHYASPEILRGEMYGGKEQDIWALGVVTYVLLVGETPFSELPDE
                     VLHGLAPDSKAYAALMDRCGAGHEEEGEESDGGGKLRDAADFVMRCMEPEVGDRPSAE
                     VLLEHRYLRGRDGWVGKKGWIKV"
     gene            complement(523007..529366)
                     /locus_tag="CND01940"
                     /db_xref="GeneID:3257226"
     mRNA            complement(join(523007..523668,523715..524124,
                     524246..524423,524472..524594,524645..524865,
                     524917..525125,525175..525299,525353..525470,
                     525527..525635,525686..528362,528412..528466,
                     528521..528665,528727..528776,528826..529008,
                     529078..529366))
                     /locus_tag="CND01940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656986.1"
                     /db_xref="GeneID:3257226"
     CDS             complement(join(524035..524124,524246..524423,
                     524472..524594,524645..524865,524917..525125,
                     525175..525299,525353..525470,525527..525635,
                     525686..528362,528412..528466,528521..528665,
                     528727..528776,528826..529008,529078..529318))
                     /locus_tag="CND01940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512732.1"
                     /db_xref="GeneID:3257226"
                     /translation="MTQYGETPSLPYARDESSTSQVQSAYPAYPAEAYEHQEAFVDEE
                     DDFSADVDVGAALQYWTALRHMGGKGKQKEESEEDRTSKSPWRLRSKLKTVTAGLFIC
                     LNLGVDPPDIVKTNPCAKTECWIDPTQLPAPKAIDAIGRNLHQQFETLNPKVKYKAFL
                     DPSIEDTKKNCISMRKTTKDERVVFYYNGHGVPRPTPSGEIWVFNKNYTQYIPVSLYD
                     LQEWLGSPCIYIWECSAAGNILNNFIKSAERRDTEARHAAAQAGHEDLPRTSYTEALH
                     LAACKANQILPMSPDLPADLFTCCLTSPIETALRHFVLQDPLRRNTGLSPDDPRSRIT
                     VDLAMRIPGDLKDRRTPLGELSWIFTAVTDTIAWLSFPRDMFNKLFRQDLLVAALFRN
                     FLLAQRIMSAYHCTPTSIPEIPDTHNHPLWESWDLAVDACLAQLPGIFDQLGEPEPGK
                     PLTIPPGMYKPSTFFAQHLQAFEVWLQHGATVSNKRSGRNRNDVVPRSPPEQLPIVLQ
                     VLLSQSHRLRALILISRFVDLGPWAVHLSLSIGIFPYVQKLLASPAIELKPVLIYIWA
                     RILAIDQSCQIDLLRDSGFTYFTQILAAYPQQGSLVIPNANEHRAMSSFILSILCRDF
                     RQGQTACLNTHVFDACVARLHEDDWLLKTWCLLCIGQLWADYDEAKALFWQSQRQGEL
                     LSALRSTSVEVRAAALYAFGTLLGASAISIETPAKGGGGTGAQIGLSDVQQLELEAGV
                     AFACMMSVKEDASPLVRKELVVVISCVVREWRGWLVCAAWVYYEQEAALVAAEDDKPM
                     PKDVVSDTLEQWTMNEDKHPEEHQHNLTLLSSFKVLFETLLDLSVDPHTEVALTASTV
                     VDYIIALLMDSPFVRVEGSAIRSIIRQHSRPRNATRQSSTTQLERSKLSHLNGVPPNL
                     TRTSTDLDKSAADSTSSLKRNSSVANALRSLASITGFSAPETQSEEPLSTEPRQEIPT
                     APDLSTSAYISPYPEAGHERVQPDSHPASTSSTGRNPSSLKYLNTHMSTRSSLGILPS
                     RLDQTPVEAYQVLEALTEEDMERLRMRRMRGREAGGDMDGRYGNNGLARSTDLGLGMV
                     AKEVKDDVLPLRSGYFDWAMDYFKTPQMKAPDADEPGSQTYNEQAWKHQRNEQMVERS
                     RANEEFAATHSWNMEAGTLHNDAWPLQLAFHSYDPVLAVTDDTDKICLWDWQNKVKLN
                     KFSNQNIGGSSISSIHFVNEMASSLMLTASTEGSIRIFRDYETPGETALASTFRAVSE
                     TYPVAHSSGLLTAWEQQKGHLLVGGDMKVVRLWDATVERHLRDIATQAGSNLTAISSD
                     EPDGNVFVAGFGDGVVRLFDKRAEDAGEVVLRTWRQHKIWIQSVHLQKGSMRELVSGS
                     MDGEVRVWDVRKPDEPLYTLPRRNEGLMALAVHTGAPVLARTTAITPYSTKQDLEITG
                     FKNPLQPRRLAKISIPVPPAYNTPRHRAVDFLPSSASLVFHPVEMVVAAGGFDTSGTV
                     KLYRCPAPDLPLG"
     gene            529756..531588
                     /locus_tag="CND01950"
                     /db_xref="GeneID:3257412"
     mRNA            join(529756..529877,529946..530095,530239..530345,
                     530406..531057,531113..531588)
                     /locus_tag="CND01950"
                     /product="expressed protein"
                     /transcript_id="XM_570427.2"
                     /db_xref="GeneID:3257412"
     CDS             join(529833..529877,529946..530095,530239..530345,
                     530406..530745)
                     /locus_tag="CND01950"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570427.2"
                     /db_xref="GeneID:3257412"
                     /translation="MFGLKKKLSAIIPSEARAHLQNILTVEWEDGNKTVLVDVPDADH
                     PSEVEMSGMGGTYGRLADDDEDDISSRPAQRTRKSFHKSSSYTTKSKTLPRIPQQPNL
                     ARPNTNPFGGDCQPSPQTPCNSTHTASPYSLTSPQFTSSTFIHPDTYGQNSSYDQGQS
                     SKGKEGNSRTARRMDNADDLLSGGDFSGIDFPASSSRTRDPGSSVQRGTNPFR"
     gene            complement(530875..532849)
                     /locus_tag="CND01960"
                     /db_xref="GeneID:3256940"
     mRNA            complement(join(530875..531219,531274..531614,
                     531667..531677,531729..531860,531909..532313,
                     532369..532439,532491..532849))
                     /locus_tag="CND01960"
                     /product="expressed protein"
                     /transcript_id="XM_024656987.1"
                     /db_xref="GeneID:3256940"
     CDS             complement(join(530956..531219,531274..531614,
                     531667..531677,531729..531860,531909..532313,
                     532369..532439,532491..532700))
                     /locus_tag="CND01960"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512731.1"
                     /db_xref="GeneID:3256940"
                     /translation="MRRVIIHPLLRPLIALPILLLIMHALKAQWYRLGKGKGKSMSKT
                     SDTGVQNEETEYPNPNGQRIVVGHFMLGNTYPFQPEDWERVFSLAQDTSLDGLALNIG
                     PEEWQLSQAQVAYNILSSRPTPSNARPLKLFLSLDMNVLSPSPSELSTLIIKVISSGR
                     DSQMRWDGKVLLSTFSGHSLGDDGWIDVLRLVERGLGEEVTFWPAFFMPPEDFLGKSY
                     VDGAFAWNNAWPMGNHTINLEEDRPFLESKIPYMAAVSPLFFTHYGTEGEFGWNKNWI
                     YRSDDLLLPSRFLSLLSLPNSRSPSIVQLISMNDYGESHNLFPVMGAQPGSDSWTSGM
                     DHEGLRWISKYFLQRWRDGKGEVEGIDEVKLVLWYRTKPAVMETEDSVGRPRNADWAQ
                     DLINLFIIIPSSSPSSRYMLQIRNGPHLHRRHLSCEKLNLLTVPFVPGQVTYEILENE
                     KMIIQGEGKAIEAEGAWNFNMWSGGVF"
     gene            533056..538284
                     /locus_tag="CND01980"
                     /db_xref="GeneID:3257421"
     mRNA            join(533056..533732,533785..534828,534901..534928,
                     534981..535127,535305..535412,535459..535563,
                     535614..536259,536307..536379,536461..536557,
                     536605..536695,536748..536892,536957..538284)
                     /locus_tag="CND01980"
                     /product="expressed protein"
                     /transcript_id="XM_024656988.1"
                     /db_xref="GeneID:3257421"
     CDS             join(535334..535412,535459..535563,535614..536259,
                     536307..536379,536461..536557,536605..536695,
                     536748..536820)
                     /locus_tag="CND01980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512723.1"
                     /db_xref="GeneID:3257421"
                     /translation="MPNIDFNLKTHDNAFENDDVFDSSFSFMNIDTSMDYYLASPPEG
                     AKSPGTSGNQPHEGAKEPSDDRFSLSPLTMNDQAMQPLDISNTVYSYPPYALTYQHQQ
                     AIGITGANIGSHHPVIYQPYRPGTSGDFTKRPLRSPESPSLSSSPHGSIESSRLSFSA
                     PNAASPSLVSPGSLSGSIPDPSPTHSYAGYHAPFYSSAPSVGMPGTGMSRGNISPTGP
                     GLSMVAGFPYPTSMVSQQQGSETGPMRSQRSRTRGKKVKEEDVDDDDDDHSSKGLGLT
                     NEHEDRVPVSNKREDVRRARIESEQRRRDELREGFKRLKDALPITNQRSSKSSLLDRS
                     VAHIQAIEGANRYLLAQLEEQQKECAKLREILHGEVMQRNVSDSPDQPGQRHH"
     gene            complement(538300..539351)
                     /locus_tag="CND01990"
                     /db_xref="GeneID:3256839"
     mRNA            complement(join(538300..538468,538526..538694,
                     538763..538842,538918..539011,539072..539090,
                     539146..539351))
                     /locus_tag="CND01990"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_570234.2"
                     /db_xref="GeneID:3256839"
     CDS             complement(join(538457..538468,538526..538694,
                     538763..538842,538918..539011,539072..539090,
                     539146..539314))
                     /locus_tag="CND01990"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_570234.1"
                     /db_xref="GeneID:3256839"
                     /translation="MKLAPFLIPFIATTVTASLAGEALSWAGQLVGGGRGALATGDGP
                     VRTENSWSYVDCGLATDAIQLKSIKVHPDPPVPGKNLTVTVEGDVLETIEEGAYVDVT
                     VKLGLIKLLQKEFDVCDEARHANASVQCPVQPGPYTVTETVELPQEIPKAKFSVLVRG
                     YTVDDEDMVCLDLFVDFMKK"
     gene            539510..541075
                     /locus_tag="CND02000"
                     /db_xref="GeneID:3257196"
     mRNA            join(539510..539940,539991..541075)
                     /locus_tag="CND02000"
                     /product="expressed protein"
                     /transcript_id="XM_570232.1"
                     /db_xref="GeneID:3257196"
     CDS             join(539536..539940,539991..540257)
                     /locus_tag="CND02000"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570232.1"
                     /db_xref="GeneID:3257196"
                     /translation="MARPTAGNLQATRTLRHLYRPGVASQSCYGARYQSTPSPPRRPS
                     PYRLLQPHAFLAEFAPLHVNGWRVDALQSAEKLLEADKVEEVLDGAETVEKSGDLQGR
                     RLVRVFELGEGKEGWRKLIKFVGHVGQVVEDQDHHPTIHISPLSDYNPPSPSLLSLQT
                     QSQSQTGYIVELSTHTHTPLPPYPLPSKGSKMKPGVTGKDIKLAQKVEEVYEEVIGRV
                     EVKKE"
     gene            complement(540394..543565)
                     /locus_tag="CND02010"
                     /db_xref="GeneID:3257103"
     mRNA            complement(join(540394..540803,540864..541058,
                     541102..541379,541434..541780,541828..541879,
                     541933..542137,542199..542301,542363..542416,
                     542455..542492,542540..542781,542836..542935,
                     542988..543118,543166..543287,543327..543342,
                     543390..543565))
                     /locus_tag="CND02010"
                     /product="expressed protein"
                     /transcript_id="XM_024656989.1"
                     /db_xref="GeneID:3257103"
     CDS             complement(join(540463..540803,540864..541058,
                     541102..541379,541434..541780,541828..541879,
                     541933..542137,542199..542301,542363..542416,
                     542455..542492,542540..542781,542836..542935,
                     542988..543118,543166..543287,543327..543342,
                     543390..543535))
                     /locus_tag="CND02010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512662.1"
                     /db_xref="GeneID:3257103"
                     /translation="MSVTSTHSQNSISPGAVPDAPGAHSAQPQTEAAGVDLRVRFARA
                     CDRCRHRKIKCDNEHPCGKCAAAGVTCTSGMSRATGVSRRRASRTSFSDTRNHHEAFI
                     EKEGSPSNREHRSNNKGRKRRRDSEETDKIGATGNSKTSNVLDHLDTAHFFLSQEGMT
                     RFAGSTSGLPVLEATRRMLQKIPDPVNDAQSPMGEPNWSWLSSLLEDGEGSSKSGRES
                     FLRRQERDEPEYFPGRDHASEQGGEDIFARISEIIPPDLMASLVQTYFAVVHPVWPII
                     HIQSFFADFYKWTSYSFAALVVSMCMLATRYTNDPRVLAEPDISASAGFQYFELFRQL
                     RAQASTEDNVIQAIQSLFFAAQYHCVDNVPHQVAQGLFAEAAARLLDGGLHREISDIA
                     LGDSLEKETRTRTAWACYSWDKQLAAICGKPPLLRIWDYDVSLPEVFEETQSAFAELP
                     ENQDEKLSAIFIQQILLSVVLEKTLTSCTHHPEFDNCEMLNRWARSMRPEVEDMKALD
                     DSMRLLNEWREALPPAMSDRSIAGRLASPMYSVEYEQIAVIEQTIEMLIAGRKLQLAT
                     LAKTRENTSTTRLESARDAILEAGKHTLASAVKMGSAKMLGKCDILLAYRILMAGRFL
                     LASLLSARADCKAEQEEEATRAVRAAIVLLRHFSDVFPISLGSAEVLEETCRVCRVDI
                     SLPTAATPGHPRHNLYAWHRPLRLRDKHSNEKDGCRSQVRSPTNVMSGDAAADAIASM
                     FSPVDAAFGLGSLPLPFPEIGTEGERQPDFSWLPPGGSVPYYFPSHPSE"
     gene            complement(544228..546745)
                     /locus_tag="CND02020"
                     /db_xref="GeneID:3256991"
     mRNA            complement(join(544228..544663,544716..544826,
                     544891..544960,545013..545169,545220..545666,
                     545738..545795,545882..545942,546004..546076,
                     546139..546196,546262..546642,546701..546745))
                     /locus_tag="CND02020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656990.1"
                     /db_xref="GeneID:3256991"
     CDS             complement(join(544435..544663,544716..544826,
                     544891..544960,545013..545169,545220..545666,
                     545738..545795,545882..545942,546004..546076,
                     546139..546196,546262..546443))
                     /locus_tag="CND02020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512660.1"
                     /db_xref="GeneID:3256991"
                     /translation="MSQDPYTTKASDVNMDDNTSTDKNVSLSRVVTALEPEQVQVVDG
                     VWGTLDESAPNYRSLGWIRASVLMIKVQIGLGVLAIPAVLHTFGLIPAILIIFAVAVA
                     TTWADYVVGVFKQNHPEVYTLADVGYIMWGPIGREVFGAVYWIQLTAVAGAGLLSISV
                     ALNAMSGHGTCTIVFVVAAAIINILVSSIQTLDRISWIGWIGLVGIMSSVIALAIAVS
                     VQDRPSAAPATGDWSPDIVLVGNPSFSAAIGALSNIIFSFAGAPNFFNIVAEMKNPRD
                     FNKALISCQTFVTAAYLIIGCVVYHYCGQYITSPALGSAGILMKKVCYGLAFPGLVVG
                     CVLNTHLPAKYIFVRLMRNSKHLSANTIQHRVIWISCVVFNCTVSFVIAEGIPIFNDL
                     IGLIGALFATPNAIIFECMMYIWDVYYCADKYPSQHTWKQRSIQAFNVIIMLLSIFAM
                     VAGTYAAAVTIRDDVASNATSKPFSCDDNSG"
     gene            complement(547579..549763)
                     /locus_tag="CND02030"
                     /db_xref="GeneID:3257038"
     mRNA            complement(join(547579..547811,547872..548052,
                     548107..548283,548330..548525,548565..548848,
                     548902..549105,549152..549202,549265..549523,
                     549574..549763))
                     /locus_tag="CND02030"
                     /product="Methylmalonate-semialdehyde dehydrogenase
                     [acylating], putative"
                     /transcript_id="XM_570225.2"
                     /db_xref="GeneID:3257038"
     CDS             complement(join(547635..547811,547872..548052,
                     548107..548283,548330..548525,548565..548848,
                     548902..549105,549152..549202,549265..549523,
                     549574..549640))
                     /locus_tag="CND02030"
                     /codon_start=1
                     /product="Methylmalonate-semialdehyde dehydrogenase
                     [acylating], putative"
                     /protein_id="XP_570225.1"
                     /db_xref="GeneID:3257038"
                     /translation="MLSRQLTRNLFNKRAASTLAADINAAQDNGRWKGTSTLGGDAKL
                     LIGGSWESSKTDKWSEVHDPSTQHLISKVPHATSAEMKRIVDVAENKFYEWSESSVLT
                     RQRIMLDLQGLIRKYHKDIARNIVLEQGKTFADAMGDVTRGLQVVQMATNIPTELLGR
                     NIEVSRDMDTLTRIEPLGVGAAICPFNFPAMIPLWSVAMAIATGNTLILKPSERDPGA
                     SAIIAELCEMAGLPSGVLNILHGGVDAVNFICDEPRIKAISFVGGDKAGKHIYDRAGA
                     LGKRVQAQLGAKNHAIILPDANKSALKAVAGAAFGAAGQRCMALSVLVTVGDADWLPG
                     LVEEANALKMGNGFDEAADLGPVISPQARERIEQLIESCEKQGGNIVLDGRGATVKDY
                     PNGNWVGPTILEATTDMDCYKNEIFGPALVVVKTRDLDEAIELVNRNPYGNGAAIFTQ
                     SAVSSRKFEKKIEAGQVGVNVPIPVPLPMFSWSGNKASVLGNASLYGPLGLNFWTKTK
                     TITSLWREDAKEDKAAVAMPVHH"
     gene            549963..552078
                     /locus_tag="CND02040"
                     /db_xref="GeneID:3257422"
     mRNA            join(549963..550260,550315..550451,550490..550673,
                     550712..550832,550889..550987,551035..551475,
                     551514..551668,551727..551777,551827..551904,
                     551958..552078)
                     /locus_tag="CND02040"
                     /product="4-aminobutyrate transaminase, putative"
                     /transcript_id="XM_570223.2"
                     /db_xref="GeneID:3257422"
     CDS             join(550121..550260,550315..550451,550490..550673,
                     550712..550832,550889..550987,551035..551475,
                     551514..551668,551727..551777,551827..551904,
                     551958..552018)
                     /locus_tag="CND02040"
                     /codon_start=1
                     /product="4-aminobutyrate transaminase, putative"
                     /protein_id="XP_570223.1"
                     /db_xref="GeneID:3257422"
                     /translation="MLTRSLHTTIRISGRRQYATAIAAARLVPSQPQKPNVVTNTIPG
                     PKGKELSAAIGKFQDPRAHTLVADYNKSCGNYLVDADGNVLLDMFAQIASIAIGYNHP
                     DLIKLAKTDKFASAAMSRPALGSYPPVDWADTVNEGILKVAPKGLNQVFTTQDGSSAT
                     EGALKASFLSYQAKRRGNRPFSDEEIESVLENQSPGSPELSVLSFKGGFHGRNLGSLS
                     LTRSKPIHKLDMPAFEWPACQFPDIKYPLAENTEHNQKAEAAALAHVEETIRVWSNKK
                     PIVAMIIEPIQSEGGDRHASADYFRKLRQIAKKHDIYFIVDEVQTGVGATGSFWAHDK
                     WELEEPADFVTFSKKTQASGFYHNLSTRAPFAYQAYNTWMGDPIRALQAREMFKVIER
                     DGLIENVARVGDYIYKNLEHYEASGNILNLRGKGQGTFIAFDLPSPKERDQFISQMRL
                     QGVNLGACGSQSVRLRPMLVFEQSHADLFLEKLRNVLK"
     gene            complement(552391..553276)
                     /locus_tag="CND02050"
                     /db_xref="GeneID:3257347"
     mRNA            complement(join(552391..552486,552544..552701,
                     552751..552924,553003..553276))
                     /locus_tag="CND02050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570457.2"
                     /db_xref="GeneID:3257347"
     CDS             complement(join(552466..552486,552544..552701,
                     552751..552924,553003..553051))
                     /locus_tag="CND02050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570457.1"
                     /db_xref="GeneID:3257347"
                     /translation="MSKASKVSIVDPSGPAPSKFASNMIVSGKTVYLAGAVGTDKSGQ
                     FIPGTIQDRTRQALRNAEERLQYLGLDLSDVVSVTIFLSKYEKDFASMNEAYIASFPT
                     DAPLPVRTCVGVAALPAGTDIEMTLIAAKRD"
     gene            553525..555592
                     /locus_tag="CND02060"
                     /db_xref="GeneID:3257136"
     mRNA            join(553525..553747,553804..554047,554095..554176,
                     554229..554279,554332..554436,554501..554760,
                     554817..555193,555251..555343,555393..555592)
                     /locus_tag="CND02060"
                     /product="Aldehyde dehydrogenase (ALDDH), putative"
                     /transcript_id="XM_570221.1"
                     /db_xref="GeneID:3257136"
     CDS             join(553625..553747,553804..554047,554095..554176,
                     554229..554279,554332..554436,554501..554760,
                     554817..555193,555251..555343,555393..555545)
                     /locus_tag="CND02060"
                     /codon_start=1
                     /product="Aldehyde dehydrogenase (ALDDH), putative"
                     /protein_id="XP_570221.1"
                     /db_xref="GeneID:3257136"
                     /translation="MSATVAEVTFNTGLYINGLWKNGRGEPLLSVNPATEEVIAEVQT
                     ASKEDVDEAVKAARHCFETAWGTEVSSQLRGQLLFKLADGMEAAMEELAKLEYLDSGK
                     PLAWCKADIEDSVACLRYYAGSADKIQGSMIELDDKHKHALARKEPIGVCAQIVPWNY
                     PLLMMIWKIAPALAAGCTIVFKPAEQTPLSTLKFAELFELAGYPAGVFNLVNGLGRTT
                     GDALSRHMDVDKIAFTGSTITGRRIAIAAAESNLKSVTLELGGKSANIVFDDANLQEA
                     AKWAAFGVYENMGQSCSAGSRVLVQESIYDQFITHFKAAAEAFKVGDPADPDTFQGPQ
                     VNEAQFRKVLDYIESGKRSGAKLLTGGSRHGSRGYFIQPTVFGDVTMDMKIAREEIFG
                     PVASVIRFKDEADAISIANNTEYGLAAAVHSQNYARVQRVTRKLKAGTVWINQYVALS
                     HQVPFGGYKQSGWGRELGLEGLEPYLITKSVHHYYGGDFEWPIKI"
     gene            complement(555857..557221)
                     /locus_tag="CND02070"
                     /db_xref="GeneID:3257100"
     mRNA            complement(join(555857..556106,556160..556276,
                     556340..556559,556620..556748,556815..556920,
                     556976..557221))
                     /locus_tag="CND02070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570455.2"
                     /db_xref="GeneID:3257100"
     CDS             complement(join(555985..556106,556160..556276,
                     556340..556559,556620..556748,556815..556920,
                     556976..557043))
                     /locus_tag="CND02070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570455.1"
                     /db_xref="GeneID:3257100"
                     /translation="MDKRTYLRNDLLAGKPGIGMWLTLPGSALAKTVATIPGFNWILI
                     DAEHGQITDRDYFDLTNHITTEGVSPIIRIPSDEPWLIKRALDSGAHGLMIPMCHNPD
                     VAKKVVSSSKYAARGTRGCGSPFTQIIFGVPESQYEATCNDNLMVIVQIESAEGVKNV
                     ESIAAVQGVDVLFVGPFDLAKSMDIEFGGEEHEAAIARTLKACKDNGKKAAIFCMSGA
                     QSRKRLQQGFDMVSIATDTDSIIREFSRQLEDMKA"
     gene            557396..559190
                     /locus_tag="CND02080"
                     /db_xref="GeneID:3257105"
     mRNA            join(557396..557495,557553..557725,557778..557880,
                     557933..558170,558211..558378,558431..558505,
                     558555..558885,558941..559190)
                     /locus_tag="CND02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656991.1"
                     /db_xref="GeneID:3257105"
     CDS             join(557604..557725,557778..557880,557933..558170,
                     558211..558378,558431..558505,558555..558885,
                     558941..559016)
                     /locus_tag="CND02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512658.1"
                     /db_xref="GeneID:3257105"
                     /translation="MNRQVLNNGVYMLSDLEEESKKTLPQMVHEFYNGGAMDMITCRE
                     NVEAFNQYRIRPRILVDVGNIDMSVEVFGQKVAAPLGFSPTAFQKLAHPDGEIATSMA
                     ASKAGIPMCLSTYSTTSIEDVVTAGQGAIPYVMQLSVMKSRDANLEIIRRAEKAGCKA
                     LFVTVDCAVLGRRLNEARNNFTLPDHIELPHMPADCDWRNLVVEDDRLKYDASCTWKT
                     LVDWARSHTKMQIWLKGVYTAEDVALAIEYGIDGVVVSNHGGRQLDSVTATLDALPEV
                     VEAAAGRIPVHIDSGIRRGTDIFKALALGADHVWIGRAVIWGLAHDGEAGVSLAVNLL
                     LDELRTTMVLAGCANVKQITRAHLARKGLDGRLHKL"
     gene            559648..561258
                     /locus_tag="CND02090"
                     /db_xref="GeneID:3257084"
     mRNA            join(559648..559788,559852..560037,560103..560348,
                     560398..560603,560656..560782,560841..560953,
                     561001..561258)
                     /locus_tag="CND02090"
                     /product="expressed protein"
                     /transcript_id="XM_570217.2"
                     /db_xref="GeneID:3257084"
     CDS             join(559761..559788,559852..560037,560103..560348,
                     560398..560603,560656..560782,560841..560953,
                     561001..561036)
                     /locus_tag="CND02090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570217.1"
                     /db_xref="GeneID:3257084"
                     /translation="MKVIVLGASGFIGHRVALAFVQAGHFVWGQTRSESIAASTLSPN
                     EILPIVCDPHSPEGQKKWGDLAKDVDIVVDCIAASGPDNALASFKTFLSAVKDRQKWG
                     PKPTYIYTAGHWVFSRGAGGLDKWTDERRPAKAALNSPTIWRNQVMEPVLSNENVNGI
                     VIAPTCLYGRSGSYFAYYHFDAALAAMEKGQEEFETIAKDDSRLLTIHHDDLADLYVR
                     VGERSPACKGQVFIAANPSPESLKEILNSVVRVTGLKGYKAKEATDAYEKFWVSTLLA
                     KPSLGTALTGWRPKRLPLTDGMDIYWHSYVASKKREE"
     gene            562010..566541
                     /locus_tag="CND02100"
                     /db_xref="GeneID:3257415"
     mRNA            join(562010..562276,562638..562886,562935..565493,
                     565540..566541)
                     /locus_tag="CND02100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570429.1"
                     /db_xref="GeneID:3257415"
     CDS             join(562219..562276,562638..562886,562935..565493,
                     565540..566354)
                     /locus_tag="CND02100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570429.1"
                     /db_xref="GeneID:3257415"
                     /translation="MRSPSKRGDLEAKYDVVLDFPNLELHSAAASGNVGLVHYALTHG
                     QPVNSVLHGVLPLHAACSGGSLSVVRMLIEQGADVNAPRLPRRYSDGKKGTAPSVGTA
                     GSTPLHFAAANGHAPIVQMLLACGADPSKPDKNGHTPEDLARLSSHENVVRVLHAFQR
                     LQTLDAESRSSKSEVTEPLSPRESHTNLEQAEQASAVVGSRKGKERAFSLSSVKSDGS
                     SAVRMKKSVEALWKRGSKTSMTSATEQTHTHHHRAPPPPRLCLPGEFSTPLDKLSSPF
                     EIDTPTSPSPQKGDHNPLCNSAPPSTNGSDGSPKSLNRQLSNDSQSNLSSIALHSPPA
                     RTPSTPRSRHNSLSSHRPSLPSIIEKAAHPGQTFRAAMKGHQDKDDGLHTALSGGSKS
                     RGRFSHGDLKKSTKHQAHHHVHGLKNFFRLGTNRERSPSPPAKNEFAKPIAGEELDLG
                     MERLKRASLDLERRDIPTLDDRSQGSTSAPPTKSKFFEEESSTFDSSLTSSSTSSSQL
                     PAVFQPPRLPPRRNSPPASVTPVINVVPSLRPRTGSEVIAPSPLANEWADNDSDGQRD
                     TFKGIRRARTEVIRQPLSSPRPNSPTEKYSPTSPGKPRAYTLPGLSTPISNSKPSVNG
                     IGKTDDLDLRKMAAEGSIRECEKKKDQEEKGGDAEDEEGDGEEWHDALTTGDDEERAL
                     QEGHDEIIRLTASDNADIRSASLRSRASKSGRIRSGSIGSVTTDASHISSPPSTFRIS
                     NISDDPDPLRRPKPAPLPQPSLRADSRVRGFSISSNSSGASAAAHSNLQTVSTPSTSL
                     TLPSALSVTQPVSGVVVSGGSGGFPPVPEHEAVSHPSIRRRLTSRTISSQAEAQEAMK
                     QSENEILQLAQLPPSLDSSRDLAAVLAAYGESHEMVKKFAEEERKEQEDQDEAFNVRT
                     TVEGDQESFHTADSGRTKTSKISLDSKGATSPDRGSVGKQLPSPLTPLIGVDVPRNNS
                     HLSSIYDKRAAAYRERMTALTSAPLPSLASVSHHQRPPSVSRTSRQRASSAHETWLDV
                     GPKSRLRSASGNLPMGHSIHGGGFRDRSNPTSATTSEIGDEKAEGEEGEERYPHISGP
                     VPVMSNVQPGQRTRRGSNASTASHKAHNYTLPPSIHPQPSRKGLSAGTRKYTPAANSG
                     GTAIGLGPLAPTPYASLFSHRFSGQPLNDDESDDEEQENGDFTVIENDWRGGRVISLD
                     EVGAGTEKKKWNGLKKLGRHHK"
     gene            complement(566618..568714)
                     /locus_tag="CND02110"
                     /db_xref="GeneID:3257082"
     mRNA            complement(join(566618..567036,567087..567303,
                     567353..567465,567515..567649,567706..567811,
                     567863..568022,568081..568171,568223..568549,
                     568599..568714))
                     /locus_tag="CND02110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570453.1"
                     /db_xref="GeneID:3257082"
     CDS             complement(join(566728..567036,567087..567303,
                     567353..567465,567515..567649,567706..567811,
                     567863..568022,568081..568171,568223..568549,
                     568599..568682))
                     /locus_tag="CND02110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570453.1"
                     /db_xref="GeneID:3257082"
                     /translation="MSLNTRKQERDFTAEVEALQAEAEQLAKNGKLEEAIEKITVLEK
                     QTRNASDMSSTSTLLVLIARLCWEANNLDQLNNQLALMSKKHGQLKEPVVRMVDEAMA
                     WLPALKEQKEQGNFRSGKDRWLELVKTLRDITEGKIFLELQRARLTVMLSAYHEALAE
                     TAPKEAPPTPETSPSTKPEDKDKSKAEPVTAKEHLDVAADLLSDLQVETYSTMDKREK
                     TEFILEQMRLESMRGNWVRVRVGSRKINRVYLKDKDTQDIKLRYYDLMVQLALQDDEY
                     LEACQAYQEVWDTEEVKNDSAKELSVIENIMIYVVLASYNNEQSDMLHKLYANTALQK
                     APLHFDLLKCFVTKELMRWSGIEGIYGPALRQSPIFAPGSTLGKKIGVTEKSQKDAEK
                     FDNPGDARWDQLHKRIIEHNIRVIASYYTRITIQRLTELLDLPLLTTERTLCKLVTDK
                     SVYARIDRPAGIVDFRKKRNVNDVLNAWSGDVSKVLDLVEKTSHLVSKEYAMHEAVKG
                     KKISA"
     gene            complement(569300..570614)
                     /locus_tag="CND02120"
                     /db_xref="GeneID:3257230"
     mRNA            complement(join(569300..569769,569826..569995,
                     570047..570054,570102..570172,570220..570614))
                     /locus_tag="CND02120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570451.2"
                     /db_xref="GeneID:3257230"
     CDS             complement(join(569448..569769,569826..569995,
                     570047..570054,570102..570172,570220..570431))
                     /locus_tag="CND02120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570451.1"
                     /db_xref="GeneID:3257230"
                     /translation="MAPTRPPNVEMATKRIKKEIADLAKEDLGSIILAPEETNILHWK
                     ARIPGPVGSPYEGGVFDVDIRVPHDYPFSPPHLQFMTKVYHCNVASNGAICLDLLKTA
                     WSPALSLYKVILSLSSLLTDPNPADPLVPPIASEYRNNRRKHDATAREWVRKFALPKS
                     NPPPAQLKPKLQPPALRRTISRSLPDSTSPAPPPQLAGQRRVILEVGDSDDEGDIQVL
                     GDSSRGNSSQPAAVTTNGAGRQKRARTSGQGGSAGDAIVIDE"
     gene            complement(570712..572146)
                     /locus_tag="CND02125"
                     /db_xref="GeneID:36392822"
     mRNA            complement(join(570712..571303,571351..571675,
                     571731..571893,571948..572146))
                     /locus_tag="CND02125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658476.1"
                     /db_xref="GeneID:36392822"
     CDS             complement(join(571027..571303,571351..571675,
                     571731..571893,571948..572097))
                     /locus_tag="CND02125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514330.1"
                     /db_xref="GeneID:36392822"
                     /translation="MSYQYSNPYRGYYGQSEPPPQPYENHVPVKEQFKVLFTGLPAGL
                     TSQDLYEALTKPPLRLPRTTRVFNMHQPDGHFLGIAVVSVDTQVDAERLRVEYNGKVI
                     DHNYRLSVHHILPLGHKYPSFNAAGSSSANPSQGLQHTRPRASSSARKANRALTENAE
                     MPSSNANQSGSKGKQKARVSVPNKKENGKPLGLKLLDRIGKANKPSNQMDQIALLERQ
                     RANLQKSHLGGPGKAFAMRIQPPVPSKDTTKKHRRSKADKAAAKSNLGAASKVSRAKK
                     KLNDSAMDVDEDLTFENTANHGQGYWRK"
     gene            572311..573912
                     /locus_tag="CND02130"
                     /db_xref="GeneID:3256905"
     mRNA            join(572311..572466,572558..572742,572794..573667,
                     573721..573912)
                     /locus_tag="CND02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_570214.2"
                     /db_xref="GeneID:3256905"
     CDS             join(572370..572466,572558..572742,572794..573667,
                     573721..573749)
                     /locus_tag="CND02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570214.1"
                     /db_xref="GeneID:3256905"
                     /translation="MSAKTAPSVPHGTYSLDLSSLNHPEDELIAMRYAFKPASVTHTT
                     PGTYYPSQGSSTSQPAQVVFDVKNGSQVFDVREETMKGRECVMIFNEENNTFELHPLS
                     TTLHLTVNRNASHTYATSTSSTSSSSSLPLAAKLHTAQEDPPEISSQAEDEEAGKGMP
                     RPTKRAKTTVAEKSERDKGTSPPHEDLKNLKGNRGVGKGGKSLPRNKPLESAPIPVIG
                     SARTRSITTNVKNKGGKGKTTGAKSKAKGKKAETTPRSKVKSAEYIEDSDEEIGASEE
                     VQLPPSSARKPRARGKETREQAEEEEEEEDDMDEFANLLGQSLAEGGDYNDADAEGED
                     EFEEVLTQQLQQQYAQSDAGLGYDDEDDEESESEDEDDELGGARLVVRQSGVMDDGSE
                     WI"
     gene            complement(574301..576761)
                     /locus_tag="CND02140"
                     /db_xref="GeneID:3257283"
     mRNA            complement(join(574301..575288,575343..575482,
                     575551..576250,576304..576586,576632..576761))
                     /locus_tag="CND02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_570212.2"
                     /db_xref="GeneID:3257283"
     CDS             complement(join(574473..575288,575343..575482,
                     575551..576250,576304..576586,576632..576675))
                     /locus_tag="CND02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570212.1"
                     /db_xref="GeneID:3257283"
                     /translation="MSQMGSVSGWYTNAYAGTFRSSRLRAPSLLPNRQIPAPIQQTLV
                     IDAAHNVHTGADVQGENGKSKVKRRETVFGPDVGEDDEPGWTDGAKEEISVDVVKKWV
                     EKTKADEGLHPTTTLQALVNLKRPTLLLQQVEQSEPVEETNKHDGITPIAYEHQKGER
                     EETNFAPPLHTLKFSYDATTPSVRISLLLYPTPQPPIEGKESILEDHEPRLLYDGLHP
                     GGFGQVFELPKKFAIDLRSAIQVPTEEKEEEGDDGKKDTLVADGNPAEQVHQLDVGTQ
                     GQQENQGRRRFGLLRSNRADSGGLEESQIEMTNQGEGQKEGEAKEEKKPIEQGMRVLI
                     RIDGVGPQGESLKRRNAQLTHILITGTWVNDPNGSENPQGGKRVWVVKVARREAVIGT
                     HTFLLKEIFGLSQASSSPAYPPTSDDPYASTPNECIVCLTSPRDVVLLPCRHLVVCRE
                     CAVGMVEFGAGNRVARREEMDSAETGQNGDASGENGTGGGASSGGNVPQVAGGTTATG
                     RERRKKKVKGWYCPVCRQPYTSLLRLALPEASNVPARPSSRASVRTTRTTKSLAPTLP
                     DGAERMLERLRPEGAGDSDEDADAANEAQIDEPERPRFVLGEDKEEIEHHENLEKSPD
                     PAMVSTAVPVSTPASVSDGEHSVGEGGPKGWREVAA"
     gene            complement(577068..579233)
                     /locus_tag="CND02150"
                     /db_xref="GeneID:3256855"
     mRNA            complement(join(577068..577566,577618..577878,
                     577929..578443,578509..578598,578656..578675,
                     578750..578810,578879..578927,578995..579233))
                     /locus_tag="CND02150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570449.2"
                     /db_xref="GeneID:3256855"
     CDS             complement(join(577240..577566,577618..577878,
                     577929..578443,578509..578598,578656..578675,
                     578750..578810,578879..578927,578995..579096))
                     /locus_tag="CND02150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570449.1"
                     /db_xref="GeneID:3256855"
                     /translation="MLATFNFWWMAAFLIPFTALEVEAVVTGEKWCNSYLCVTGKHDS
                     SQKLDQYTLEPPQGKSITRDDFGWIAIGFGSTMANTPMVITWPNSDGTITLSQREASS
                     NVMPTVVLSPSRKATLKSSLSYSNSSSTSITFTVPSNSSITNQTSLIWAYSRKNPGNS
                     AVNAMIKQHTASGNTKLNLLSTLMNSTNTTINSGADSESPSDTTSRQALIAHVACGAV
                     ATMALFPAGILVPRIARGLTEKRWWFPVHGAVNGLLGFGLVVAAFGIAKANFSGGYNS
                     THRKLGLALFVLCIFQTLLGLFTHFYQRVHRLQTTAGRGPTNFIHMVLGLVIVAVGWS
                     TVWEGLDAEWGMYSGTGKPGIGWKAGWGLIVALASIAYLGGLYLLPRQSSFEHQRRLW
                     ASSLGHPPPSVQKSSSTIRQSTRTNGESMNMAYLLSDNGYGDLPDNRPPPPPPPRLLP
                     PPPTHLMRLPPPPIPPNRPAVAQY"
     gene            579388..580112
                     /locus_tag="CND02160"
                     /db_xref="GeneID:3257235"
     mRNA            join(579388..579555,579611..579835,579885..580112)
                     /locus_tag="CND02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656992.1"
                     /db_xref="GeneID:3257235"
     CDS             join(579471..579555,579611..579835,579885..580012)
                     /locus_tag="CND02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512655.1"
                     /db_xref="GeneID:3257235"
                     /translation="MTKFPAALKPAARSAYREVLRAARITFQGDSTRHHALLTALRAT
                     FSSPTLTPPPSASSPPVIPISEESIGVDDVAKRITEWKELARFLKRNVVQGVRSDDGA
                     WKLRVTEHTELGDNASVKNPPKLPTTPFPNRNRRKCSDAAPAS"
     gene            complement(581520..585226)
                     /locus_tag="CND02170"
                     /db_xref="GeneID:3257101"
     mRNA            complement(join(581520..581626,581676..582284,
                     582337..582550,582596..583033,583084..583346,
                     583395..583589,583640..583919,583969..584345,
                     584395..584533,584579..584978,585028..585226))
                     /locus_tag="CND02170"
                     /product="116 kda u5 small nuclear ribonucleoprotein
                     component, putative"
                     /transcript_id="XM_570208.2"
                     /db_xref="GeneID:3257101"
     CDS             complement(join(581579..581626,581676..582284,
                     582337..582550,582596..583033,583084..583346,
                     583395..583589,583640..583919,583969..584345,
                     584395..584533,584579..584978,585028..585049))
                     /locus_tag="CND02170"
                     /codon_start=1
                     /product="116 kda u5 small nuclear ribonucleoprotein
                     component, putative"
                     /protein_id="XP_570208.1"
                     /db_xref="GeneID:3257101"
                     /translation="MSTEDYDEFGNYIGGDLDSDDESDVSISPAAPPPAAPGPSAGPS
                     ASYAPLEGFDEDEAMEDEEPGMAMQLHGVDGSTGQQVVLHEDKKYYATAEETYGPDVE
                     ALVQEEDLQPLSEPIVQPIKQKSFTVQEKGLPETRFDRNFMIDLMDHPSMIRNVMVAG
                     HIHHGKTSLLDMLVFETHKMTWDADQQTRYTDTHILSRARGISVKSGPMSLVLQNSKG
                     KSNLINIIDTPGHANFVDEVASIARLTDGVVIVVDVVEGVMHGTEQVIRHAMQEKLKM
                     VLVVNKMDRLILELRLPPSEAFFKIKHTIEEVNSIIASIDPDDSFRHSPERGNVAFSS
                     TQMGWCFTLKTFANMYADTFGSFDIDEFSLRLWGNIYFDSSTRKFTRKPADVESKRSF
                     VHFILEPLYKLYTQVLSADQETLKETLADLQITLKPSVYKMDVRPLLKVVLEAFFGPS
                     VGLIDMITEFLPSPQGGAEAKIRHTYTGPLTSNLADSMISCDPQGPTVVHVTKLYHTA
                     DAEHFRAFGRVMSGTVKVGQVVKVLGEGYSLEDEEDMISAIVDGIMIDESRYNVDIER
                     APAGNLVLLSGVDASISKTATIVSKDVDDDLYIFRPIKHMTASVLKVAVEPVAPSNLP
                     KMLDGLRKVNKSYPLVTTKVEESGEHIILGTGELYMDSVLHDLRKLFSEIEIKVSDPV
                     TKFCETVVETSALKCYAETPNKKNKLTMISEPLEAGIAADIEAGRVSMKMTNKERGKF
                     FESNYQWDLLASRNIWAFGPDENGPNALINDTLPSEVDSKLLSSVKESVKQGFQWGTR
                     EGPLCDEPIRGVKFRILDASLAQEPIYRGGGQIIPTARRVCYSSFLLATPRLLEPVYY
                     VEVQAPADCVAAVYTVLSRRRGHVTKDIPKPGSPLYTVKAFIPVLDANGFETDLRTAT
                     LGQAFCQMSFDHWSVVPGDPTDSSIQLRPLEPAMGQSLARDLVLKTRRRKGLSDSIAV
                     SKYLEDETIIAISASGNADLLG"
     gene            585317..586406
                     /locus_tag="CND02180"
                     /db_xref="GeneID:3257279"
     mRNA            join(585317..585615,585680..586076,586128..586406)
                     /locus_tag="CND02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_570298.2"
                     /db_xref="GeneID:3257279"
     CDS             join(585376..585615,585680..586076,586128..586339)
                     /locus_tag="CND02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570298.1"
                     /db_xref="GeneID:3257279"
                     /translation="MSARPTVLTSLFKSLGLRALHTTRPALFLPTPELPPNPTSAEAL
                     GFAPQGDRKRQLPQDLKVEVPASANRNVSALKDAGKPGRERRQRATPNPNTDADFFSG
                     TSSDSPVPLRRPNARARRTKSVSPDLVAGAESALPPDVQRRKRRDRTPKDGKIRTERP
                     KRVDPVREFREKRAMLPKRHLVVDVVDHSPEGMFGKQRLIGQTFNRNVGFGSPRHPIP
                     LEASQFVTDLPDTPIPVLSTIPAKAHYQAIQLAEWSAALNATMQGDAKTALPEVVSNV
                     IGVDRQ"
     gene            complement(586364..587348)
                     /locus_tag="CND02190"
                     /db_xref="GeneID:3256916"
     mRNA            complement(join(586364..586716,586785..587198,
                     587252..587348))
                     /locus_tag="CND02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656993.1"
                     /db_xref="GeneID:3256916"
     CDS             complement(join(586450..586716,586785..587198,
                     587252..587269))
                     /locus_tag="CND02190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512798.1"
                     /db_xref="GeneID:3256916"
                     /translation="MTTSITDARHSILHLTPASTLALSFDDPPETGWSVMPGFDESIP
                     VPLHLEPPRSDGDEILPSQMHPSYPLGRPTYGKGKGVSGKGGRKVGNLLGTVDAWGRG
                     MRAEAGAVGGLWGGGRGEVWEETGLEGVVEQEKRREVPPGMAGAKRPPTPPPPSLRPN
                     QLPLPRSIHLRRMLERQQVREEMQRPQEGFDAPVPNETYDNSHQQGVDAAAEGQRHVG
                     DIGGSQEWEGESGE"
     gene            complement(587729..589367)
                     /locus_tag="CND02200"
                     /db_xref="GeneID:3257215"
     mRNA            complement(join(587729..588511,588566..588811,
                     588860..589175,589238..589367))
                     /locus_tag="CND02200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570297.1"
                     /db_xref="GeneID:3257215"
     CDS             complement(join(587792..588511,588566..588811,
                     588860..589175,589238..589260))
                     /locus_tag="CND02200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570297.1"
                     /db_xref="GeneID:3257215"
                     /translation="MGGGDLNMKKSWHPVLLVNQERVWKAEKVANEEKKMLAQLRKER
                     EEERQLEELHRLQEASTGKKRVEKLDWMYAAPSTEGGALGGARIGERDMEEYLLGKKR
                     VDEVLGQGDKNIGAASREFIALQNANTARDTAAKIREDPLLAIKKQEQAALAALMNRP
                     DIRKQLRAAKKAKETKGREGESKEERKARKRAEKEERRKSKHRYHDSRSPPSDYYDDR
                     DHRRHRDSYDSQDRENRRTYRDRSDRSRTRSESPKREKKEKDYSNRDRDYRRRNDTTR
                     GSFDESPRKGGGNRWGSHGPDGYRRSDHRDDGFRERQRGDRIPPPRHLSYNHSTPDVR
                     PSSPPSSSAAPVNRNTSTLEDQRAARLAAMSASADELYSSRSKSLAARAEEERREQEK
                     DEKMRQKYGKEQASANFFSQQSQLGLGEALQRRGGKGLLKDI"
     gene            complement(589473..591331)
                     /locus_tag="CND02210"
                     /db_xref="GeneID:3257419"
     mRNA            complement(join(589473..590155,590214..590276,
                     590325..590398,590468..590502,590556..590637,
                     590694..590739,590795..591009,591077..591185,
                     591230..591331))
                     /locus_tag="CND02210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570431.1"
                     /db_xref="GeneID:3257419"
     CDS             complement(join(589739..590155,590214..590276,
                     590325..590398,590468..590502,590556..590637,
                     590694..590739,590795..591009,591077..591185,
                     591230..591265))
                     /locus_tag="CND02210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570431.1"
                     /db_xref="GeneID:3257419"
                     /translation="MLSSNTALTVAKYALGASVTATTLAIGGLWYFQRSLIYPSGFPE
                     GSRIVVPKPIEVGCPYEDVTLTCSDGVKIKAYVIMARRKPLMMSELRGLSPAERKEKA
                     QMEMEAWAQEMGDEKAIEYSKSRPTIIIFHANAGNMGHRVPLARHFNVDFKCNVFMLS
                     YRGYGLSEGKPSESGLQIDIQTAMKYVQAHPILGQTKIILYGQSLGGAACFYAASKHR
                     DTVAGVIVENTMLSFQTLVPLIMPQIPRFLLPILLTEHWDAHKTVPLIPSTTPILFLV
                     GKRDTLVKAEQMLALRKLRGSGITRWREFDGEHNDTCLQPGYWEEIGKWLKEEIEDDG
                     VEVVDQNDRGEKNSLKVTTEDAAL"
     gene            591308..592638
                     /locus_tag="CND02220"
                     /db_xref="GeneID:3257189"
     mRNA            join(591308..591690,591748..591861,591915..592121,
                     592175..592638)
                     /locus_tag="CND02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_570296.2"
                     /db_xref="GeneID:3257189"
     CDS             join(591597..591690,591748..591861,591915..592121,
                     592175..592584)
                     /locus_tag="CND02220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570296.1"
                     /db_xref="GeneID:3257189"
                     /translation="MSSKDSASNSPFLYPFDPASPLFVLKGILATGTFGAITGASIGA
                     LQSKNPYTLGTNMTINMSIAGLAFFTVREYVVSPLLLIIEATPSHSRRLLDLQLSERQ
                     RSKLPQVVSIGQMRTDRVLDSALAGALTGGVLSAAFRGRATFGKAAFTSALITSALQV
                     SANQLRVMRLSYLAKSQTRMSSLDTASPSEQEPTATFDALKSSMPSLEPTSPPSLPER
                     MMSNLAKVLPVRKLSNEEYLATLEKKRAEVDKRLEEIAEEEIRMYEWAQKQQQRPT"
     gene            complement(592568..594263)
                     /locus_tag="CND02230"
                     /db_xref="GeneID:3257416"
     mRNA            complement(join(592568..592804,592864..592945,
                     592992..593206,593260..593315,593365..593585,
                     593668..593878,593977..594115,594178..594263))
                     /locus_tag="CND02230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656994.1"
                     /db_xref="GeneID:3257416"
     CDS             complement(join(592650..592804,592864..592945,
                     592992..593206,593260..593315,593365..593585,
                     593668..593878,593977..594032))
                     /locus_tag="CND02230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512724.1"
                     /db_xref="GeneID:3257416"
                     /translation="MASSEVLHPKAVAVITGAASGIGLAAALRYAKEGASIVLVDIDP
                     AALDPAVEKVKSVEGVGTVFGVRVDVGNVKEVASLRDRVLEEFGEVHILMANAGTSTK
                     APTFSLGTPLEELQSHWNKVLNTNFFGVLNTAQAFAPFMVKQENSSVIIITGSKQGIT
                     CPPGNAGYNVSKAAVKTYAEQLSHELRSDPDSRCTAHLFIPGWVFTSLTGANNIGATK
                     PPGAWTPEQTVDYMVDKVFGEGDFYVICPDNETPTSLDKARIQWSMDDVIQNRPALSR
                     WHPSYKARFEDFIQSKQGLAARSRSRGRPAQRDGSQVPSVVSIPSETDLLAFRRN"
     gene            complement(594335..596880)
                     /locus_tag="CND02240"
                     /db_xref="GeneID:3257401"
     mRNA            complement(join(594335..595622,595669..596196,
                     596258..596562,596622..596694,596745..596880))
                     /locus_tag="CND02240"
                     /product="expressed protein"
                     /transcript_id="XM_570654.2"
                     /db_xref="GeneID:3257401"
     CDS             complement(join(594414..595622,595669..596196,
                     596258..596562,596622..596694,596745..596792))
                     /locus_tag="CND02240"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570654.1"
                     /db_xref="GeneID:3257401"
                     /translation="MPKATRKKKEKKADFVKAKLKLGKGKKQASNTTDTSFKARSIAL
                     PGQEALNRALQISEGAGPSEPTTANGLTLEDIFIRLRHPNSVVRKEALGGLREILQVD
                     VSREVGKVLRALGGLVADDDAAVRKGLLGLLDWYLAHLSQSILSPHLPLLVLQASSAL
                     SHIFPEIRLDACKLVHLMLQYVPSHVVSSWPYESSNILEGLRLAVGLGGEKGVNSQIG
                     RLTGGAKLVTMKAMREFVRIGLENGMTQKWGGGYLEDRQSSRGKFKVVKEESGLENVQ
                     LEGWLVGTRMAKLVGDGDAWELGRLGSLGGKGDEEGVVSVLSQLYIQLHPLLLSTFLE
                     NAPTAFSPSMASVTPASEDIPLALCVMTASLTELLADAILTRATPDANTPELRQVKNC
                     ISDFHRRMTGWFPFNSRTAPTPSGVTPGFELSLAYARLAVLLSPRPVDLTFTKHSTKR
                     GKEVRWRERVKATEEAWKTMRESERAKGKGKIGQNQWAMEEVADWVVEVLEPKKDVLA
                     PSLTPEAYSALLPIVWALLAQPPCLASDDTDIPSHVGSAFISHLIRQGSTSPIREIGE
                     EFLIALILVHEKKYPILPFYIVPQSPLRPMIKGWFEGIPKTLFELGTKNQSASERLLR
                     FLLVIGSRGEGAYEQPYSLIDPATFPSLTPKLAPFWHLQHPSKGSIPGAWTKFNSGEV
                     KRLGLDVAMVWKQWNGLRLSDAIGRVCGHDQWGSYWRR"
     gene            complement(597053..600243)
                     /locus_tag="CND02250"
                     /db_xref="GeneID:3257191"
     mRNA            complement(join(597053..597597,597648..597836,
                     597886..598512,598561..599201,599250..599522,
                     599583..599902,599947..600243))
                     /locus_tag="CND02250"
                     /product="cleavage and polyadenylation specificity factor
                     subunit, putative"
                     /transcript_id="XM_570295.2"
                     /db_xref="GeneID:3257191"
     CDS             complement(join(597118..597597,597648..597836,
                     597886..598512,598561..599201,599250..599522,
                     599583..599902,599947..600116))
                     /locus_tag="CND02250"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     subunit, putative"
                     /protein_id="XP_570295.1"
                     /db_xref="GeneID:3257191"
                     /translation="MITLTPLSASAAETSPSEPICYLLELDDARILLDMGQRDYRASS
                     QQCSWDYEEAVRDLAPTLSLVLLSHSSSNYLSLYPYARARWGLTCPVYATQPTVEMGR
                     VVCLAEAESWRSECPVDSEKVAADDGSKKPLRGPFVPTVEEIHEAFDWIKAVRYSQPL
                     HLGGDFSHLLLTPFASGHTLGGSLFKIRSPTSGTVLYAVGINHTSERHLDGMVGVQNG
                     PTGYADGVLRPDLLIVEGGRSMVVNPKRKEREAALIDTITSTLESNHSVLLPVDPSPR
                     LLELMILLDQHWTFKRTPKVKQRRYNEPPADLWPYPLCIVSKTAQDMVAFARSLIDWM
                     GGVVKDSAGDMVDVGRGKRARGARMALGSEYGVLDFRHVQFFLNTTDLLQTYPLTRPK
                     LVLAVPPTMSHGPSRFLFTAMANTEGNVIMLTGRSEEQTLARDLYNRWERSQTTGSKW
                     GEGKIGHLTQLEGKLQVEVDSKVPLSGAELEAHVESERLQKEKEAAHKAAVDRSRRML
                     EADDLESDSDSESEADGHAGDITVRRTEGANAYAGDGEDVRTMSFDIYVKGQQMRSGR
                     GAEMARFRMFPFVERKGRKIDQFGEGLDIGQWMRKGREIAEEGETEEVREAKKRKEEE
                     EEKAKQAPEPPSKYVSEEVGVELKAMIGFVDMEGLHDGQSIKTIISDLQPRKLIIVRS
                     SKESTQNLISFLGSVTGFTRDIFSPSLTEEIKIGEHVQSYSLTLGDSISSALAKKWSD
                     FEGYEVTFVDGKIVLPAGSTIPILETPSLVGPLVKTEAEGDDADDEAKPSAEELAAAS
                     APPISSSAPLPLPTSTFIGDLRLARLKHRLSLLNPPIPAEFAGEGVLVCGPGIAQEAQ
                     GAASVVSVRKIGEGKIVLEGCIGRVYVEVRKALYGGLARVDAA"
     gene            600314..605472
                     /locus_tag="CND02260"
                     /db_xref="GeneID:3257139"
     mRNA            join(600314..602162,602225..603555,603608..604611,
                     604674..605472)
                     /locus_tag="CND02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_570293.2"
                     /db_xref="GeneID:3257139"
     CDS             join(600464..602162,602225..603555,603608..604611,
                     604674..605340)
                     /locus_tag="CND02260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570293.2"
                     /db_xref="GeneID:3257139"
                     /translation="MFTSPKYYPASHPSSRSASRHDDRPASPQTKAQVRSEAIAKLKR
                     AASLPRNADGRRPIQRHAGARTDDSSGDAEGSPGILPISVEISSLSRPDAPPRPTNDE
                     QEMLSPSPVQITFDHASIHPSVDHMHMQRSASASPSHNMTCNDYPSPTNGVNSERHAM
                     QLAQPYLPSLAPRSINSLQQQVPLAGRDTPSPLPTLGELRTLQRSNSQAARAQAMSKL
                     TGGKGATMNDDVSLHLPLRSLQRAGTLGANTNRTLRTPSRRRAEFSKPVAQDGHQATA
                     FDEPRPRLQRSFTVSSSNMGEERRSAVGRRMVERLAERRAARQKEEEEVRRLWEERKA
                     ATDPIGKGQAHDIGRPGTDEQEQFQVTSSVSKTYDDGGVQIQAPTVASSNLLSAPERP
                     VSGVTMQSAQFEYEDHLRRSLSSRTARGAVGVISEPVPPMTVPSVQSEATEEDTEQLN
                     TPTLPQNPMNHHPKSQASGASVPDLDAPLLPPHPPFITPTRHIAHDSTSTIQGSSNSP
                     GGSSTPGGSSILSGLDSMMFVTGGTGGHYAQLTSQGEVNWPVEAAEGSDWGTPGKEMH
                     QTTLISSPTSSARIDRPRSSTSEIFSTQVSETGGAESDYRSPNSHNSYGMPSTGSAMS
                     SWEEVGRTDDQVSKAPANHSNHARSESVGAKMKRTMKSAMRKHSQSRSSMTSSSPPVS
                     PRRGSGASAAPSQGSVPRIWPKGEPLASNRIANHHPSVSSLSVSQANSATASSSNLIQ
                     HQLSSGPSQVSLLPRANLNDPRIHISKLSPFPGIEHLESRSAGLEESPGEKPKLMQQV
                     SDSVIPSHSSVLTPGGTPAPENIYALPLVARAEANKRLSGESVTKRNWLTKALTSPRS
                     SLSRKISYGDVRNRGNPLGQGAMVISSGVDPFASPPMGAVPTSSTPSIPSSMSPGGKS
                     NAASPTVSTVPEMNEDRTRAATLVRLREGESAPGMIQERVQMRKEALLPKKTIDILRR
                     MDEVLALGPEHPARPEMLDDPPRKFLMSSQILQVVNADIVKDRFLFLFTDLLVIAKPI
                     LVHNIHATLDTQFTVKNIVSLDKLLVTAPNGESPAESGRHPVVDQFVDKFKQDPVEAC
                     RYVVEKCSPAVDLATLAGLILRTSELDKTQVGLLLGNNEGLTRAFVDRFHFRNIRVDD
                     ALRMFLLSLRLPTDHISCETLLKVFAERYYVANHDHLTYNQELAIELVLTIMKFNDAL
                     YSTFGFASANNVITREAFITAFRSKDPHGLVPHDLLSQIYTSLRSMRLTQALASNEVR
                     FERWAVITLPHTSTKLTYNVWSEKIYINIPAPDTKLRIKLLGEGLEFDPPELDFANKT
                     EESFKLKGTSLGMKTLLLVRVGDNAALYGSLGSTRQFTVERAFMRHTFQIAFSNHRGL
                     KREYCFSTNSSASCQKWRELLEKHIKETKRAKSMKGSSSRDVVRQTAEAVSFQVLRDA
                     LICSEETAQPTQKNAALRLGGNATALSEQDVESRSRTGSISAAYAQFALKEEYELGPL
                     QRTRGEKDMDKASEKVNTRTGKELVLLCRQNSLMPGLLKLLHAGAEHGPDDGQAREGV
                     GRDENVVRSKGKRV"
     gene            605596..609769
                     /locus_tag="CND02270"
                     /db_xref="GeneID:3256859"
     mRNA            join(605596..606024,606077..606489,606540..607151,
                     607198..607278,607328..607519,607568..608356,
                     608403..608492,608543..608728,608779..608912,
                     608972..609418,609471..609769)
                     /locus_tag="CND02270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656995.1"
                     /db_xref="GeneID:3256859"
     CDS             join(605841..606024,606077..606489,606540..607151,
                     607198..607278,607328..607519,607568..608356,
                     608403..608492,608543..608728,608779..608912,
                     608972..609418,609471..609591)
                     /locus_tag="CND02270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512725.1"
                     /db_xref="GeneID:3256859"
                     /translation="MPPSNTLAALMASPATSGGDATVMANGQTLPDISLGSLGSSFKS
                     DEEGYVQQIGSSDPPSKANRRRSPETSHFQSISTSSPPRGALLTVSPPPTVRKSSSQS
                     ALSNTQAPRRPRVLHRRTSNSSIESDDISGPLEARYGKEEDTDDEAILSALSLASPKK
                     EYGAGKGRGYVVGTSARNGRHSVAAGELNGPMTLRDQEKQLEETKKEVFNLQLENHFL
                     KERLSNMAPEHIEGALKENVKLKLEILTLGKELKKLKKLVMQQDKDLAAAARESGKSQ
                     EAREFEKLWGQEKERRKAAEQEIKILQEEMGADGINELRSKLEDAEASEDVWRKRTEE
                     LEAELEDQKALNEDQIEQLERFRDAADRAHDEIERMREELKDAKSLSESVGLGKGREA
                     RLAQKVQELEQENASLQADLSIAKKGVMTEDDAELLEERLNELQDKVAAAQLELDNRD
                     REVDELNAELDAKVREHEKELQQVAEEWRDEVLEARTQIDELKDALDAREQEIKEIRD
                     SLLEREEHLTGALEEIQELQAAKAITHDRLEETLKNIERDNVEKDAELMDANREIEEL
                     GQRVYELEEALEDHRAREANLSADLRSADEEFENAKAHYEDLINVLKEARRKIQEEKE
                     EALTRLGQEREERRSDREGIKRELDTENSRLRQALSEKETQASRLQFELDAARERIDL
                     RDRDLSQVERKLHDLEDERRKLGDEHTSNRFGLELEIDRVKRDLQRCEDELDIAKREL
                     EERNENLRDRDIELATMLDKQRDIENKLSSERQGRLNISDKLDQTLKTAKQHEREANL
                     LRERIEELEPLLTETQQERFQLQKQSETQRQERSELLLRVFKDVNKFLGVEHHTTPAN
                     FALFRDTLLQRLKSMMSVRTEFEKKLKDTEASVDQRMASLKRQLEEKWRTLDQFEAAV
                     KKLELTKREWRSKFAIKEGELQAVQARNNELHSQISSLKSDTASGSSSQVRSLTERAI
                     AAEKRAQTASNQLASLEERLAEYQTRYGQAESKWEARVKEYENRLRIAGEKIKTEKQG
                     GKERAVQLEAQVRELEKQVQEARKRNQRAENVVASAAHLLPGYDERAGRTPW"
     gene            609842..611266
                     /locus_tag="CND02280"
                     /db_xref="GeneID:3257433"
     mRNA            join(609842..610043,610094..610356,610417..610603,
                     610656..611019,611073..611266)
                     /locus_tag="CND02280"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_570275.2"
                     /db_xref="GeneID:3257433"
     CDS             join(609906..610043,610094..610356,610417..610603,
                     610656..611019,611073..611149)
                     /locus_tag="CND02280"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_570275.2"
                     /db_xref="GeneID:3257433"
                     /translation="MLLRPPLFTKLTKTSRLIRPILTTRHFRTTPLTMGDDQPKIITA
                     YPELTDIKAQHQSLPGKDVDMDPLAEFTKLETWDDDGKPYLKEYTGSGKLKGKKAIVT
                     GGDSGIGRAAAQMFAREGADVTIVYLPEEEQDAQRVKKAIEQDGQQCLTIAHDLMQAD
                     LAADVVKQHMDKFGKLDILVNNASKQIMSQSIAEIELENVESTFRSNILAMFALTKAA
                     VPHLKRGSTIINTSSVTAFKGSVAMVDYASTKGAIVSYTRSLAVQLAPQGIRVNGVCP
                     GPVYTPLQPASRPPDNMEGWSVGGPPLHGRASMPAEMGPAYVFLASSDANAMTGHFLH
                     LNNGQWLG"
     gene            complement(611247..612495)
                     /locus_tag="CND02290"
                     /db_xref="GeneID:3256973"
     mRNA            complement(join(611247..611552,611607..611770,
                     611826..612034,612096..612189,612245..612281,
                     612337..612344,612407..612495))
                     /locus_tag="CND02290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570447.2"
                     /db_xref="GeneID:3256973"
     CDS             complement(join(611412..611552,611607..611770,
                     611826..612034,612096..612189,612245..612281,
                     612337..612344,612407..612410))
                     /locus_tag="CND02290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570447.1"
                     /db_xref="GeneID:3256973"
                     /translation="MDYQNRAGANKGSGGVAGASETAVDRRERLRKLALETIDLAKDP
                     YILRTHLGTLECRLCLTLHVNEGSYLAHTQGKKHQTNLARRAAKDNKDQTLMIQAPTA
                     AQQVKKKVFVKIGRPGYKIIKIREPVSQRMGLLFTVSLPEIKAGERPRRRFMSAFEQR
                     REIPNKAFQYLVLAAEPYETIAFAIPSKEMVDVDEDPESTWEHWDADEKVYSCQFLYK
                     "
     gene            612617..614292
                     /locus_tag="CND02300"
                     /db_xref="GeneID:3257022"
     mRNA            join(612617..613222,613279..613360,613411..613889,
                     613948..614292)
                     /locus_tag="CND02300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570433.2"
                     /db_xref="GeneID:3257022"
     CDS             join(612645..613222,613279..613360,613411..613889,
                     613948..614191)
                     /locus_tag="CND02300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570433.1"
                     /db_xref="GeneID:3257022"
                     /translation="MSLFPSAFESGVSKISPTLASAGKGGKKTNKRKHSDANAGLGQA
                     QQVKQADANFEKLMRKFEGGEAIGKEEGKESMGVVGKKRNKKNKSRQVNDEEIVHSTP
                     RAKGDKPKPKPTPKSDQAKLNQAAKQNQTDTPPSKKSKANKITPGFKLEPVQLPIPIP
                     PPSKGTKLKVGGEGNLTEMQKDMQAKLEGARFRWINEQLYSTPSTEALAMMRKDPKIF
                     ADYHQTHRLLTSAWPSPPLPHMINLLSSLPSGTVIADLGCGDAGLARALVPQGKIVMS
                     FDLVGDNGVLGAETTESNAAGGWVVEADFLEKVPLPGRPGGLDYGVSATEESEGKGKR
                     KNKKKGSRKRDVASSEIVDAVVCCLSLMGTNWVGGISEACRILKQGGTFHVAEVTSRF
                     TSTEAFVSTVESFGFELEEESQPSTHFTLFRFTKNSEVPLGPVKGQEGWEERVRKGEE
                     ILRACVYKKR"
     gene            complement(614268..617952)
                     /locus_tag="CND02310"
                     /db_xref="GeneID:3257004"
     mRNA            complement(join(614268..615333,615410..617624,
                     617666..617952))
                     /locus_tag="CND02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_024656996.1"
                     /db_xref="GeneID:3257004"
     CDS             complement(join(614450..615333,615410..617624,
                     617666..617728))
                     /locus_tag="CND02310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512729.1"
                     /db_xref="GeneID:3257004"
                     /translation="MSPPAALADRRAHRLAPATKKPRMPLTTEPSLNARGTAAHDRTD
                     GRRRAKQVRDDTPTAPAQAHRHSAASHAHRRQRSSIALPSGAVSQAPVRPSVVGVYGD
                     QPEQTATTPPTPMLEKSPIPQEDEQEQGKGHDGEYEHVAARLSAFSFASKPAAGPFPP
                     QRRQPARLGSQSILGHELVSSPLSSPTSPRRFSNTSSRPPSLLLARPPSNALSPPRSA
                     AGPSSPPAQTKKKRHSHTRSNSISLPNIKLQNAASRPSSFNVLHSPSVGSPVSPTSPH
                     GESKPSRLAGLNSQRLKFEPSGRGAEAEKEKEESRRRALEKLTGSESRSTSPFVESPV
                     AEISLPDLDDEDSSSVASSNRPLSGAFGQPTFSWSNQPSFSFLPLPLGSSSPSPLSAS
                     PFSGASPADGQSADTPERCSGQSFGLPHGSLSMSGPKEDPLDYGMEVNDASIGKRPTM
                     NRQLSALQEVDESEEDEEKMLGNVQEEAEEEDTAAPVVPTIPPENAPQDPESAVSPSG
                     LRELRLSSSISSPRHYKTPSSSDRYSFPQSLTSPPPSAGSIGSSSPTKSYGTIGRGRP
                     NRSNSDAGMSNHRGPTPKRTTSNAGSRGSISYKKDASSSGSKELGELIASPSLTSGST
                     VSGGNNSSIKGIWANTVTRGMRPCPRVRLTGDAGSGRVLTEVNEMEEEGSLERRRSAS
                     ARIDLARSSIESGRPSSELSRDSLDRSYWSDVQLDMERENESLRDELGFWKEKCRTLE
                     ERLDSERKESVVLRERVRKLGDRLSSISSLPTERSDIYSQSQQAAESRLIAQMREQLF
                     TLTGKLQQEHRAKEMALVKLNDLRGHVAAQGHHQLTGRTEQDEDSGDEILLSRSATSR
                     ETTPSLTPPQTDLPTSPALASPKPFTIDKVDDSESSISKRFTPDFTRLKSWGFPATPP
                     TGSDNVPDSKEKKRESFFGLSNPLRRASSDDGPRISEGIDLPPFVVDENTPGVFPALV
                     AGDLPTLGGGVNVRAVSDPTSLQSYGRDTLSDLPGIGPAQFRIPTITVNDGGAFRAAG
                     VMCSGILDFRKGCRCCVGDVVEV"
     gene            complement(618480..621691)
                     /locus_tag="CND02320"
                     /db_xref="GeneID:3256882"
     mRNA            complement(join(618480..618650,618725..618986,
                     619048..619124,619192..619683,619754..620012,
                     620078..621030,621085..621411,621459..621559,
                     621607..621691))
                     /locus_tag="CND02320"
                     /product="vacuolar (H+)-ATPase subunit, putative"
                     /transcript_id="XM_570271.2"
                     /db_xref="GeneID:3256882"
     CDS             complement(join(618600..618650,618725..618986,
                     619048..619124,619192..619683,619754..620012,
                     620078..621030,621085..621411,621459..621559,
                     621607..621634))
                     /locus_tag="CND02320"
                     /codon_start=1
                     /product="vacuolar (H+)-ATPase subunit, putative"
                     /protein_id="XP_570271.1"
                     /db_xref="GeneID:3256882"
                     /translation="MATNYPSLFRSEEMSLVQLYIPSEVAHDTISELAEMSNFQFKDL
                     NPSLTSFQRPFTPRLRRLAEMARRLRFFRSQITSLSPPLGVPPLAAVPPFTTVGPRAQ
                     NAYDELEEKLKEHERRLNEMNKSWEELGRRKSELEENKCVLKETAGFFDEAGHRHTEI
                     RTSMEDSSDAAPLLEHAAEYGTLPGESGLSGFDLEFVAGTIDRARMPTFERILWRVLR
                     GNLYMNYSEIEEPFVDTVSGKETFKDVFIIFAHGQELLAKIRKVAESMGGTLYNIDSA
                     TDKRSDALRQVSARLEDVDNVLYNMGQTRRVELSKIAESLEAWTDAVMREEEIYKTLN
                     LLSYDQGRKTLVAEGWCPSRDITAIQLGLRRAMDTAGTSVPAILSELRTHQTPPTFHR
                     TNKFTEGFQTLIDSYGIATYQEVNPGLYAVITFPFLFAVMFGDIGHGILMFLTAAAMI
                     FWERQIAKNGVNENVETFFFGRYLIVLMGIFSVFTGFMYNDIFSKTLHLWQSGWEWPS
                     NSTGLIEAEPTGNIYPFGMDPMWHGSDNALIFNNSYKMKMSIILGVIHMTFAICLQVP
                     NHIHFKKPLNIYAEFIPQMLFFHSIFGYLVVCIIYKWSVDWSQSVTSPPGLLNMLIYM
                     FLSPGTIEPGTQLYAGQGFIQVVLLLIALVCVPWMLALKPYMLWKEHQRIVAQGYQGL
                     QGQDNGGMHGRDSIGAESRAEEEEEVGMAVAESSDEEHPFEMGDIIVHQVIHTIEFCL
                     GCISNTASYLRLWALSLAHAQLSEVLWSMTLQLAFDFNGGLISRAVFLFVMFAVWFGG
                     TVGILCVMEGLSAFLHALRLHWVEANGKHYMAGGYPFTPLSFATIGQEEDI"
     gene            621842..624874
                     /locus_tag="CND02330"
                     /db_xref="GeneID:3257167"
     mRNA            join(621842..622129,622182..622279,622341..622435,
                     622482..622578,622626..622718,622766..623141,
                     623211..623301,623354..623718,623770..623885,
                     623939..624153,624207..624375,624424..624874)
                     /locus_tag="CND02330"
                     /product="transferase, putative"
                     /transcript_id="XM_570434.2"
                     /db_xref="GeneID:3257167"
     CDS             join(621846..622129,622182..622279,622341..622435,
                     622482..622578,622626..622718,622766..623141,
                     623211..623301,623354..623718,623770..623885,
                     623939..624153,624207..624375,624424..624776)
                     /locus_tag="CND02330"
                     /codon_start=1
                     /product="transferase, putative"
                     /protein_id="XP_570434.1"
                     /db_xref="GeneID:3257167"
                     /translation="MWKVIYYLNLALYTILLISTSFLAVLIAIVCSLTGRRLNTNYFV
                     ARTFYCIAGTILGWKFQVEGEQYLWELSGEHGGGKANEKGRSMVMVGNHQSFVDILYL
                     GRIFPKHAAIMAKKSIQWIPGLGWFMMMSGTVFINRSNNKSAIASLQHAGEEMKRKRI
                     SLWIFPEGTRHNTPEPELLNFKKGAFYLAVQAGVPIVPVVCENYNHLFNGKSHFRRGT
                     LRIKVLPPISTTGLTAADVPGLIERTRNAMLETLQEISTPSQSTSQAGSPDPLLGRSG
                     REREDYYTSGSPAPPQSVPSTAEIGTEEEAEAAVEDAIGREEADNGERHVPVVGKNNK
                     EDETMSSPRRLVIAMVSDFFFPVIGGVEGHIYSLSVELMRRGHKVIVITHSHPDRLGI
                     HYLEPSLKVYYLPYLPIASSASLPNFLLFLPYFRHIILTENIQLVHGHGALSSLAHEA
                     VIHAPLLGVKAVFTDHSLFGFGDAVGVLTNKLLGAALRCVDEVICVSNTGRENTVLRA
                     QLDPSIVSVIPNALEAEHFKPDPFRADPDWITIVVISRLVHRKGIDLLISSAPQICAL
                     FPKVRFIVGGDGPKMVELEQMREKYELQGRVELLGRVNPGDVRDVLTKGQIYLSNSLT
                     EAFGISIIEAASAGLFVVATKVGGVPEILPQDMIEFCRADEDDVIRALTHAIHTIQSS
                     RHSPWSAHIRVRDMYSWSHVSSRAEIVYLRAMSRPHREIGERMRRYLELGPVFGVVMC
                     CILAVEHYFFWLLEWWNPRDKLRQVISFPGVERFEDRGKNNKK"
     gene            complement(624853..628007)
                     /locus_tag="CND02340"
                     /db_xref="GeneID:3256911"
     mRNA            complement(join(624853..625249,625303..625812,
                     625863..625888,625940..626663,626708..627064,
                     627112..627394,627444..627532,627670..627755,
                     627811..628007))
                     /locus_tag="CND02340"
                     /product="allantoicase, putative"
                     /transcript_id="XM_570443.2"
                     /db_xref="GeneID:3256911"
     CDS             complement(join(624944..625249,625303..625812,
                     625863..625888,625940..626663,626708..627064,
                     627112..627394,627444..627532,627670..627755,
                     627811..627874))
                     /locus_tag="CND02340"
                     /codon_start=1
                     /product="allantoicase, putative"
                     /protein_id="XP_570443.1"
                     /db_xref="GeneID:3256911"
                     /translation="MLTPQQIPLEEFDSNIKSNYVEVSSSALGGEVVACSDDFFASCH
                     NLIKPTPSVSMKGQFGPNGALYDGWESRRHNPAYDWVIIRLATPLTSLHYVDIDTSHF
                     NGNEAPQSQVFALSLPSDGSTPMWTQGNPGWVEVLPVVDLGPNSRHIFEVGKAGKEGK
                     WGAVMVNMMPDGGMARFRAYGLPQGPSLPKSLPANYQSLQPTNLLSPLIGGRIISCSD
                     AQFSPPGNLLLPGRGVDMSDGWETRRSQENRGKYAPGGPLAGQERKEWAVAKLGVPGI
                     VRWVEVDTAFHPGNYPKYCAVEATLSSDEDLSSASWTTIVRKTPCGAHRQHYLPLEPN
                     VPPTQVFSHIRYSVFPDGGTKRVRIFGHPLDPTSPDAQGALEKARLEPMIIPALPLTP
                     EAFKPYGQVVQGFSLPTSAPKGIHVNIANQGTAFKFHRLAKPAESYAPGLLQKGGIHV
                     GAVKASSKMDIKNGKRIKVELLERHRHTSQAFVPMGAEPGKEGKQGAFVVVAALNGPD
                     DKPDLSTVRAFLATAAQGVNYDEGIWHHSLLTVGGDLNYAIVEAQMSVPNEIRDCEKV
                     VPPSELHVEVPPYPFTHPSTASVSAAHVVGHQTNSVLPSLASLLPGKALKPVPITPEN
                     FAPFGHLITTTPSSSHTDTERAPDGLTVKHNRLAPVISTYPEETGAVTGIAVFRATKK
                     VGLERGKVFDVRYMERHPYTSQTFVPMGKGEWPGHGEAALPPGGEFLVIVAQNGPDDR
                     PDPSTLQSFLLPAHQGLSYSPGTWHHPVLVLDSTLDLMCVETQIATGVHDSDGRDCEL
                     LSWEGEEVFGRVAVPE"
     gene            629718..630603
                     /locus_tag="CND02350"
                     /db_xref="GeneID:3257097"
     mRNA            join(629718..629862,629917..630236,630290..630603)
                     /locus_tag="CND02350"
                     /product="expressed protein"
                     /transcript_id="XM_570435.2"
                     /db_xref="GeneID:3257097"
     CDS             join(629814..629862,629917..630236,630290..630466)
                     /locus_tag="CND02350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570435.1"
                     /db_xref="GeneID:3257097"
                     /translation="MRLLSWIVLPLIPFVSAGVSTIYWPVSNPDPSNPWVIGEKNLLA
                     WTTGSGTGVQSFDVQLHNSNRSVMVGFLPIALRVPMERLPSGYKNYGGEMEVDLGSNI
                     PTGDGFYLLFMNTYHGEVYAKSKKFSIYASTPANFTSADLPTATVTATLSEAPNPTQQ
                     WAITLNGVDQDATATATSTSS"
     gene            complement(630583..631376)
                     /locus_tag="CND02360"
                     /db_xref="GeneID:3257073"
     mRNA            complement(join(630583..630904,630958..631044,
                     631096..631376))
                     /locus_tag="CND02360"
                     /product="co-chaperone, putative"
                     /transcript_id="XM_024656997.1"
                     /db_xref="GeneID:3257073"
     CDS             complement(join(630800..630904,630958..631044,
                     631096..631263))
                     /locus_tag="CND02360"
                     /codon_start=1
                     /product="co-chaperone, putative"
                     /protein_id="XP_024512728.1"
                     /db_xref="GeneID:3257073"
                     /translation="MPDETSQTLRQLKIKTGVVKRLHKEESSYIQEVEDQQKVVEKLK
                     ADGADGADIRAAERVLKDSEMMVPRTRRSLEEAFQALEDLVNALGSDESIAGTQEFRE
                     AFSQLQQVEVDWKTDGN"
     gene            631537..632933
                     /locus_tag="CND02370"
                     /db_xref="GeneID:3257476"
     mRNA            join(631537..631692,631770..631872,631970..632093,
                     632148..632289,632342..632599,632649..632781,
                     632832..632933)
                     /locus_tag="CND02370"
                     /product="eukaryotic translation initiation factor 3
                     subunit 11, putative"
                     /transcript_id="XM_024656998.1"
                     /db_xref="GeneID:3257476"
     CDS             join(631602..631692,631770..631872,631970..632093,
                     632148..632289,632342..632599,632649..632683)
                     /locus_tag="CND02370"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit 11, putative"
                     /protein_id="XP_024512677.1"
                     /db_xref="GeneID:3257476"
                     /translation="MVTAVSPENLKEWHTPSTRPDVIHELIHGVDRYNPSNLPFMEDY
                     LATELKEGQYDLFGNLAILKLYQFNPQHSNPDVIINILIKALAATVSGPDFNLCLEML
                     REPSAILHDIESADEALVIVMPYLQRLHELSRTCQFTKFWQEINSDSEAAKILRTRYL
                     PQHASPLDDFRFIFSASIASCFRRISLSQLSRWLDIPSDKVGEWCSKVEWTVEGQDAV
                     IPNNGQNDVKAGVVKENVQLGQLTKLVAAAGY"
     gene            complement(632907..634528)
                     /locus_tag="CND02380"
                     /db_xref="GeneID:3256909"
     mRNA            complement(join(632907..633076,633134..633512,
                     633569..633852,633902..634215,634274..634528))
                     /locus_tag="CND02380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570269.2"
                     /db_xref="GeneID:3256909"
     CDS             complement(join(633008..633076,633134..633512,
                     633569..633852,633902..634215,634274..634379))
                     /locus_tag="CND02380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570269.1"
                     /db_xref="GeneID:3256909"
                     /translation="MPVVRFPTLAEPVSLGALQLNTRVIMASLTRNRSIPTTVPNEDN
                     VKYYAQRAGPGRSGLILSEGTLIAHQGTEWENAPGIWDEEHANGWKKVTDAVHDKGGL
                     IVAQLWHTGRVCHPDMIEQKRSGDPVWAPSDVGARGGKFRTLPGKPGYISDPTPIPDP
                     TYILDQYSKAAEMAKLAGFDGVELHSANGYLIEQFLSDVSNTRTDKWGGSVENRIRFG
                     LEAAKRLIDVWGADRVGVKISPCGGYNDTYNTTGDSRLETFKTYISRLDSLGLAYIQL
                     MVAVLGDDHHGGKPQGFPHDIIGTYGPLIKKSKLVVNGNYTPESGEEVVKSGKAAAVV
                     YGRNYVANPDFVKRIQQGLPLAEINMKGLYTPAVEGQNGSGYNDYPDAE"
     gene            complement(635221..636338)
                     /locus_tag="CND02390"
                     /db_xref="GeneID:3256887"
     mRNA            complement(join(635221..635722,635865..635968,
                     636037..636089,636140..636160,636214..636338))
                     /locus_tag="CND02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_570267.2"
                     /db_xref="GeneID:3256887"
     CDS             complement(join(635638..635722,635865..635968,
                     636037..636089,636140..636160,636214..636271))
                     /locus_tag="CND02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570267.2"
                     /db_xref="GeneID:3256887"
                     /translation="MSKLIGRLLVGLACLALFHAAFSTYEHLSILKALSRPTSGLPLS
                     IVIEAFVSLICFIIGIVYATGELKDVTYRGELAHRTIDDSDARMGFMKLSKRGKAIFG
                     DLDR"
     gene            636456..646782
                     /locus_tag="CND02400"
                     /db_xref="GeneID:3257282"
     mRNA            join(636456..637060,637131..638078,638134..641659,
                     641716..641863,641910..642249,642302..642471,
                     642538..642640,642681..643355,643418..643695,
                     643749..644147,644185..644467,644529..645161,
                     645211..645696,645749..645878,645948..646483,
                     646540..646782)
                     /locus_tag="CND02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_570263.2"
                     /db_xref="GeneID:3257282"
     CDS             join(636713..637060,637131..638078,638134..641659,
                     641716..641863,641910..642249,642302..642471,
                     642538..642640,642681..643355,643418..643695,
                     643749..644147,644185..644467,644529..645161,
                     645211..645696,645749..645878,645948..646483,
                     646540..646575)
                     /locus_tag="CND02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570263.1"
                     /db_xref="GeneID:3257282"
                     /translation="MLFLPSFTAISVTLLILVLSSLVVHLHILPLLLRTFTQVRVSSF
                     SVISITGLEWRNEHEQEDIIPTLRIERARWTWGGIKGDVTGLVVLRIEGVSWRIKNNP
                     SGDLKNGRPSVQHRSPSRFKNRLITFILRLLIHHYPSIARLVSIQLVNCRVIFDDLDG
                     IELTWKELGFGVKVEFRGMAEEAAVSTAPEREAPFRSLSSISFKDEYDIPPSFPTTAM
                     STPSRHTQSLSGSPVMHTSFALPPLAEPCEASLPPSPGKKAQTTPRLSSPKPFHSRMS
                     RTANKIWTRATGRMYGSVSFNIYIDTIRCIDPRNSPPPSAKPSIPDLKSSTARRSQFI
                     SFRPLKRCHPVYDLHSSDAGVSTLVALDERSSVRLSLGFGPKKGLLGEDTLSAVYEMG
                     KLRTTIEAVEKANKLLNKSKKNKQMEKKGMNRWSTHGTARVILRAMQSTKVSFAHITL
                     LHHLHNPSPIMPSLSQSHLSSISSLDLSSSPTGDRYTIILELSEIRCALSSADSSNND
                     RARNAFGTNSSPESIIRGVGAEFGWKSIELQCIAPGESSNDKSQLFAIRQAQVIGFSS
                     WRPEGWNREELLFASDPNIALVVCQADVASVDCAGDLQLLHELEAAWKATYPKSPTSS
                     PPPSSESPIISHEDPSGWLPPRLRMVFDVGDIMAVLADRVSENTTTLTFALAGVHSSC
                     YTSFSDIIARRRDRVATKEAFKEEEELQQRREENDELDFAVHPSMLPAALRRRSTANK
                     AELRDNLSISMRCDATVKMEPIRVKMTLSGDKVYELAEIGRIYGTVTGDILGRLKVKP
                     DGTESSSFDWSSISCGLDVGIQEGIDVDLWKEEVVEALIGMGEAHQRRPKDDRQPSPS
                     EGKKTTTILDKLPSGISARLSLGKVNVFLGVRDPNPECALGLTRGLWFRTVLKLEYAY
                     HKTVIQSLPWRHTLTTPRRAKLRLPEDITTQSLAFGAKLRSTGGSAALVSINTEETYF
                     QPIYNGEMFIKKGGFKKGVLRKDPPKAREDDEFVGWGFQRAKQLRAMDEGKFANNVPP
                     FEMRGTEQARRPWLRIPRSHTSFAAQQPAPGSDIEYKITTRMESPTLISDLSHIYCHL
                     LAGLMVKRVSAAWRSGSGKSQVTQSALPSNNLNLSIDVSIPGMTAHFAFPLQEQLFMY
                     SSGITFSKQPYKGMVFTAEQLLLYVPSPRIIGSWEELGRIKQFALALSDPHLPLVISP
                     RIESFRVRIPFSYKLNSLILNINVTVKACKLLFRTVSGKIPFTTVFKPCAEQPKNVPT
                     FSFSVGYISLEIKDDPVETSLNLIWRAGLVEQAKRNALEDNFAKKLLLISDPDTQPEV
                     QEDTRTGSGRRMLVLTKKHSVGPERARWALDLLVSQSWIRRIRAAKHEQARREVLALQ
                     AISGSGVNIKLPIRVVSSSRTAPLFRAAFHEVNLVITKPGLDRKQIIDYMGKMSAPFS
                     DDVNFSLMVPLNIRWSMAEAKCTLRDYPLPLIRVQRVNKNEQKPAFYMETTMVIAEEL
                     ADDDSVMYVPVKVIPEGCGHNGASPFVLEIAKTIMPVKTYAEPKFKISSKKTTEFTWG
                     NSYQPAIQDLMKVIETLSHPPRDPSPRVGFWDKFRLVLHWKPIVDFVGPCHLHLKGSF
                     DPYSVSGLGSGFCLAWRGNTQLLIDQPNADKEAIQILADELVVAIPDLAPFHDGAAIG
                     NNRNHRHDHHDHARERDILDDTDVVPLERRYTKPCAQFVGGVRVGFGFKLERTCRPWS
                     CQHGCGDTENLLHRQCREFTFLQHQQVILRSPEAIAKAEKRLGRKVDSYEGFRSDFIH
                     FSVSLVAPNGNGSAHRTQEETPDSVNSLHFAPKASHHFLSWWKLFSHQMSLPIRHGKL
                     FPDSPPPSKKFGRSLGTIKYRFDLRPVYISHMYSQVSKDHSTTGKSESLGIKARFGRF
                     RADAHQRAQEKIERHEKLGRSTVVVHKPFYAGDILADDLKVKGVRAHFVERIKGDNTP
                     PSDPLPRASALPPETRHWYNYCDFIDVDRKPSDKDPRIELADFGDCPHLFYCKRVKAR
                     ASTSHDDSGSQASSSLGVESSKFGHEATHHCYLGMADCVRDAQRSITQKRINELQARL
                     DSYPPPQDDENQSDRAVTLNRINVLVKHYEDLEKETRHLSDETLEYSKQTTTTTFERP
                     LSGAAFQDMIHIHGPRLVLTDGSRNIGFKYLYMMGDRKKEEYYTSYASLRGILDTYQQ
                     RVRRRARPETEVFEDEQTKNTSADQQMVNDLIRWLSDKPALDSLHTDDNAEEGSLRAH
                     RGLPDDCDVKPNRHVLVFKPQIALRSESDPNAIVLLSAEEFSFKQFKVIDSNAIDDMM
                     ADVLDRNYISMQGLQGFYPTTEALKRERTQLGMPRGLDFIPLEIFLDVKSEATDYDRV
                     LQKSDIMVSIDKFNNIRMPRGLEWPDTLDEYGEPIKHLRVHQDYTAIIAPMLTVTANS
                     RNFEALYVIVTDLLMYEDPGHKDRSEAIDDFTRTFDAADRDLGKLVTDINALQTHMRG
                     LLELQHGYESNFERLNDTGKEELFKIRSELQVGYENMYTINALIRATSAKDDARAAMK
                     TSTKMDVRIGGVAWHMLRESRLETMAKVDINGAVFSMLTSKNGIMDNAMVIGDLKALN
                     GKWNTLYPEIIIRDDPSKKKIKKPFAAVYWSTRPSIGGIPIFPYVNIEFVNIRFKLEE
                     RVGLDVMDYLFTDRTRRRQISGTAVKPPGGNGASSTTPTSSIFRGAGMTSMDDLGGKR
                     GEPLGIENGPLPRSRSQVSLLSLPQSDRDPVSIKRIEDTKEMRLRASTNKMFGTFRLQ
                     GMGFNLSYKSDDTRKHGTFSMPDCVDFRFKTPEMVYVSKVWSMEDLFEHIKRDVKSSA
                     WSQSGDIISQIFKKTSLFRSKERLKQAASVTALAEKAHKGKGSHQHPPKSPSNLRYAF
                     KNSSNSPEPDEDLIRTISRVMSHEAVPPEEKRRSKSVHRGYSNNLDIRSEPSEGSSQR
                     HAHLRSTNDHSPNSGKRSVEEVPETEEKGGGRIKGLLGKLKSKHLVGKDKEPRSSEDS
                     SGSSLRKSTI"
     gene            complement(646252..648574)
                     /locus_tag="CND02410"
                     /db_xref="GeneID:3257435"
     mRNA            complement(join(646252..646580,646638..646838,
                     646885..647097,647147..647223,647276..647446,
                     647508..647521,647598..647751,647814..647846,
                     647900..647941,648010..648122,648187..648574))
                     /locus_tag="CND02410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024656999.1"
                     /db_xref="GeneID:3257435"
     CDS             complement(join(646784..646838,646885..647097,
                     647147..647223,647276..647446,647508..647521,
                     647598..647751,647814..647846,647900..647941,
                     648010..648045))
                     /locus_tag="CND02410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512679.1"
                     /db_xref="GeneID:3257435"
                     /translation="MDVQTLFNVKDRVVLVTGGGRGVGEMIAHGFIANGAKVYISSRD
                     ASACEKTAKRLTELGPGQCIAIPADLSKYDECLRLAGEIERREEVLHILVNNSGVTWG
                     ESFHSYPDSAFTKLLTLNVQRVFTITQKLVPMLEKAYQQENFVGRIINIGSINGVSVP
                     GLETYAYSASKAALHQLSRHLASRLGPTITVNTLALGPFRSKMMKHTLDNFENELAEA
                     LPMKRIGAPENVVATCLWLSGPAGDWITGTVVPVDGGSLVASNSKL"
     gene            649088..652918
                     /locus_tag="CND02420"
                     /db_xref="GeneID:3257172"
     mRNA            join(649088..649289,649353..649528,649602..652105,
                     652161..652918)
                     /locus_tag="CND02420"
                     /product="elongation factor 3"
                     /transcript_id="XM_570261.1"
                     /db_xref="GeneID:3257172"
     CDS             join(649289,649353..649528,649602..652105,652161..652647)
                     /locus_tag="CND02420"
                     /codon_start=1
                     /product="elongation factor 3"
                     /protein_id="XP_570261.1"
                     /db_xref="GeneID:3257172"
                     /translation="MAPAATAAASSGKGSFDLATLFVADKAARDEAGLALADAVKKSG
                     VEFFTQIGFNDAIVKALNDKKSQSAREGACEVISTLCENGAAQLLEPHVISSAENTPF
                     PALLEAFADKVAAVKTAAIAAVKAIVQSMNPWASFVLLPALLNLIRTSGKWQIKAGSL
                     EILQQLITSAPYQMGEAMPDLVPVLAGAVWDTKSDVKKAAKATLEKAVSLVENKDIEK
                     FVPALVKSLLNPIEEVPKTISLLSATTFVSEVTAPTISLIAPLLIRGLDERPTATKRK
                     VCVIADNMSKLVDSEYTVRPFLPQLLPRLIKTAETIADPEARSVANRAIVTLRRIGKV
                     PVESDGSDLPPLPVAEGPHLATNFVALVKKHGGVSVEQTNPGLAYAGVLAASLVNHHN
                     FDQKTWESTLPPYLKLALPSYDSLPAVRELLQKKADEAETDDAKFPDEEEGEDLCNIE
                     QFNLAYGAKILLHHANMRLKRGHRYGLCGRNGSGKSTLMNAIINNQVEGFPPPTEVRT
                     FYVQHDIDGSEAEISILDWVLSDKRLLATPEEIKSTLESVGFDEVKQKNSIGSLSGGW
                     KMKLALARAILFKADILLLDEPTNHLDVLNVDWLINYLTSLTRCTSIIVSHDSDFLNR
                     TVTDVLHLNNFKLKRYPGNLEEFVKHVPEAKSYYQLDVAEDYQFKLPNPPLLDGVKTK
                     EKSLLKMRNVSFQYPGSSIQQLYDISLQVSLSSRVAVLGPNGSGKSTLVKLLTGETEP
                     NLGGQVWKHPNLVIGYVAQHAFHHIDNHLDSTPLEYMLWRYQTGEDLEEMHKANRVMT
                     EAELAKMKEGATVIKDGVKRIIDELVARKKLKQSYEYEVSFKGMSSAENIWISRDELV
                     ARGFEKKVMELDTREAQRLGLMRPLVRREIEKHFEDFGLDAEFVSHNSMRGLSGGQKV
                     KVVLGAATWRRPHIICLDEPTNYLDRESLAALIAALKNFEGGVLIITHNREFSESICT
                     EVWAMREGHLEASGHNWVEGQGSGERIDKKAGDDDEVEYDALGNPIVKAKKEKKLSAA
                     DKRKAKKDRMARRKRGEEVFSDEEL"
     gene            654255..657103
                     /locus_tag="CND02430"
                     /db_xref="GeneID:3256864"
     mRNA            join(654255..654490,654563..654736,654807..655391,
                     655459..655543,655595..655821,655873..656142,
                     656198..656595,656648..657103)
                     /locus_tag="CND02430"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_570468.1"
                     /db_xref="GeneID:3256864"
     CDS             join(655107..655391,655459..655543,655595..655821,
                     655873..656142,656198..656595,656648..657029)
                     /locus_tag="CND02430"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_570468.1"
                     /db_xref="GeneID:3256864"
                     /translation="MSVHLEYDDKKDAAYDYTQQVAPADAVPSSSDVEDVEVKSGLKR
                     NLKSRHMAMISLGGVIGTGLFLGTGSALANGGPLGLFLGYATMGSICYCVMICLGEMI
                     SFLPIPGGHIKLAERFVDPALAFTMGWNYWYNWVIILPAELSAAAVLINLWNDTINNA
                     LWISICLVVVVAINFLGFFGECEFWFASIKILTIVGLIILGIIITAGGGPDHTSIGFQ
                     YWRNPGPFVQYEGISGSLGRFLGYWAVLTQAAFSYIGTEIVAIAAGEAKNPRRNLPRA
                     IKRVYIRILVFYLGGTFIIGLLVPSNDEGLALNSGNALASPFVIAIRRAGIPVLPSII
                     NACLLTSAWSAASSDLYTSSRALYGLSITRQAPKIFSRTTRRGLPWVSISFCALFAAL
                     SYMSLQSTAGEVFGYFSNLTAAAGLMTWWGICFIYIRFEKGLRVQGIARSSLPYSSRL
                     NYRASAAWYGIIMITIILFFSAWSVFLKDNWSTSTFVTNYLPLWLFPILWVGYKYIKK
                     THFVRASEMDFVSGLQAIEAECHDETPPSTILGKFWDFLM"
     gene            659406..662139
                     /locus_tag="CND02440"
                     /db_xref="GeneID:3257112"
     mRNA            join(659406..659744,659798..660017,660072..660132,
                     660188..660348,660404..660749,660797..661256,
                     661311..662139)
                     /locus_tag="CND02440"
                     /product="peptide transporter, putative"
                     /transcript_id="XM_024657000.1"
                     /db_xref="GeneID:3257112"
     CDS             join(659741..659744,659798..660017,660072..660132,
                     660188..660348,660404..660749,660797..661256,
                     661311..661957)
                     /locus_tag="CND02440"
                     /codon_start=1
                     /product="peptide transporter, putative"
                     /protein_id="XP_024512735.1"
                     /db_xref="GeneID:3257112"
                     /translation="MTTHANAIQDFEAAPVPSAAIPSSEDKTSAAGPVTLSYGDKKDS
                     LPDVSVGDAGAIDYITEEVEPTDEEFAVLKKVHGKMPWVCIAMCAIELSERASYYGIT
                     GVVQNFIKNPLPEGGNGAGAVAPGAAGTNQSAGALGRGSVQSSACYNAFVFLANVFPI
                     MGGILADTRWGRFKTVAIGTAVGAFAHILMVVVTIPQVLRTGNGLGPFLVSFYILSFA
                     AGFIKPCLATLLCDQSPVKKPVITTTKTGERVILDPQTTVQRYLLIFYWCINVGGFFA
                     IASSYSARFVGFWLAYLLPGIVYMLMPIVLVVCYKRLYKAPPQGSVTLEAMKVLYLII
                     KKGGFVKMFKGGEEFWQTAKPSYILAKEGSVDTSKIFWDDLFVDEIRQSIAACGVFAL
                     IPIFNLADGGIGSQENDMSTAMTLNNAPNDVISNFNPLTIIVATPIITYGLYPFFDKI
                     GHPIKPMTRMAIGFILGMANMIYGAVIQWKIYSISECGWYASTCDTVTSISIWAQIPL
                     YSLPAIGEIFVNVTSYELAYTRAPARMKGLVYALCLFNQAISSAIGLACSNAIQDPYL
                     IWPYVALAIACLICAVLCPTYFRHLNDPVRTFADPARQAGKLQELEPLTAARASQNEL
                     NEKADEKA"
     gene            662603..664410
                     /locus_tag="CND02450"
                     /db_xref="GeneID:3257075"
     mRNA            join(662603..662730,662788..662993,663043..663432,
                     663484..663670,663720..663794,663842..664410)
                     /locus_tag="CND02450"
                     /product="dihydrolipoyllysine-residue acetyltransferase,
                     putative"
                     /transcript_id="XM_570444.1"
                     /db_xref="GeneID:3257075"
     CDS             join(662658..662730,662788..662993,663043..663432,
                     663484..663670,663720..663794,663842..664350)
                     /locus_tag="CND02450"
                     /codon_start=1
                     /product="dihydrolipoyllysine-residue acetyltransferase,
                     putative"
                     /protein_id="XP_570444.1"
                     /db_xref="GeneID:3257075"
                     /translation="MLSFAQVAKRSAAVSFRRQAVASRTLRTSAPSNVLSKFAMPAMS
                     PTMTEGGVAQWKKKEGESFSAGDVLIEIETDKATIDVEAQDDGIMAKIIAQDGTKNIA
                     VGTPIAIIGEEGDDLSQADALAAESQSESAPSQKEAAPKEEKTAPKEEKSESSTTPAV
                     GVPGEQKSGAGDAQTSPAKAPEHPSKGDRPKFFASPLARKIALENGIPLAEIKGTGPN
                     GRIVEADVKNYKPSAAAASTPAAGKSAAVPADYEDIPTSNMRRTIGKRLTESKQQLPH
                     YYVTVEVNMDRVLKLREVFNKAGESKTKLSVNDFIVKAASLALADVPEANSAWLGETI
                     RTYKKADICVAVATPNGLITPIIKDVGAKGLATISAETKALASRARDGKLKPEEYQGG
                     SFTISNLGMFGVDEFTAIINPPQSCILAVGKTTTKLELAPEDPKGFKAVQVMKVTLSA
                     DHRTVDGAVGARWLKAFREYMEQPLTFML"
     gene            665222..666371
                     /locus_tag="CND02460"
                     /db_xref="GeneID:3256958"
     mRNA            join(665222..665857,665914..665996,666059..666371)
                     /locus_tag="CND02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_570446.2"
                     /db_xref="GeneID:3256958"
     CDS             join(665585..665857,665914..665996,666059..666146)
                     /locus_tag="CND02460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570446.1"
                     /db_xref="GeneID:3256958"
                     /translation="MFFTYLAVVFFSSLSLIRGSQAAPAAHKSEILQPKAFINQGTHV
                     YPRLEFTTRFSTCIPPDTDVRIKWEGGSGQGVELYYIPQWPGQIEYFPNDIAKTKSPQ
                     YVWRTPKVGEYPEGTTFIVGINDVVPHIGADWYDLTGLLKFGCSR"
     gene            complement(666212..667611)
                     /locus_tag="CND02465"
                     /db_xref="GeneID:36392823"
     mRNA            complement(join(666212..667029,667085..667183,
                     667238..667611))
                     /locus_tag="CND02465"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658477.1"
                     /db_xref="GeneID:36392823"
     CDS             complement(join(666308..667029,667085..667183,
                     667238..667469))
                     /locus_tag="CND02465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514331.1"
                     /db_xref="GeneID:36392823"
                     /translation="MRRRSSPLPYLPSEDSHPLIVATNRSRFLFIRIEPEANFRLDCP
                     PRRFCFCFRCLAFCLCKMRPFLQILCGTAFLSAAFSLPMVEERSLEKRDYIGLWNGTG
                     PVVTDVKQVKILNCWFDACTLAVLISSQYWVENMIRYGNGAPMANVSWPQDGTVQVQV
                     WNPDTLEPVIEIATVANKSQTEDHPDGNWWHDALSQATKLLGTQVSFAGILPNGTYDS
                     TAGSATIGLKILTGYDTASNLTSEYADADEFWNDLARANENTPVIFNTVSSADLGITT
                     PQLGDSHDYAVFNGTVKHDGSKTIWARNSWGSTDEFKLEDVYSNTFQIIHLKNWDKLE
                     WTSDLWSSNFAVPNEG"
     gene            complement(667664..669881)
                     /locus_tag="CND02470"
                     /db_xref="GeneID:3257469"
     mRNA            complement(join(667664..668207,668271..668577,
                     668630..668650,668710..668773,668823..668901,
                     668955..669096,669149..669227,669276..669381,
                     669433..669518,669571..669637,669694..669881))
                     /locus_tag="CND02470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657001.1"
                     /db_xref="GeneID:3257469"
     CDS             complement(join(667712..668207,668271..668577,
                     668630..668650,668710..668773,668823..668901,
                     668955..669096,669149..669227,669276..669381,
                     669433..669518,669571..669637,669694..669803))
                     /locus_tag="CND02470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512676.1"
                     /db_xref="GeneID:3257469"
                     /translation="MPDPAASSSNMYPRGMNPRLRYIKSYWWPYKTFVKQRWIGRQLL
                     EVITTEFRDRSMEYYRHALESGVTRVNGVVAQPDLILRNGDRIDNTVHRHEPPVTNDP
                     ILVLHIDREREFIVISKPGSLPVHAAGRYFKHTVLEMMESDYGLKCYSVNRLDRLTSG
                     LMILALSGKAASKLAREFVEGKVKKEYVARVKGKFPKEEITVDKPMMTVDRQMGLVII
                     TPEGKDAVTIFNRIAYDPVRDQSVVRCRPQTGRTHQIRVHLQYLGHPIANDPLYGVPS
                     VWGPSLGKGGVDLTPSTNGISQADALKARAGTSTPQNIDTNREYDNIDLNSPIRLSNQ
                     AREIIAKLRRQKDDAEDWIRWSEVIFSAKKAQEDLESESKSSTPQVVPRLAGRQEALK
                     LPDPLPDDTPSPLKPPVYLPPGFCTECYVPVPDDPDPETLFIYLHALRYTTEQLGTWE
                     TPMPRWASADWDGDWRGWEEGAILPNALEEDRRKMEAKAAKKADSDLSSNLEEKALTP
                     VALAEGSVQD"
     gene            669995..671276
                     /locus_tag="CND02475"
                     /db_xref="GeneID:36392824"
     mRNA            join(669995..670092,670146..670177,670226..670489,
                     670542..671276)
                     /locus_tag="CND02475"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658478.1"
                     /db_xref="GeneID:36392824"
     CDS             join(670001..670092,670146..670177,670226..670489,
                     670542..670951)
                     /locus_tag="CND02475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514332.1"
                     /db_xref="GeneID:36392824"
                     /translation="MPKNAAQNEKTCAVCSQHPPKYRCSSCLLRYCSVSCYKTHKTQC
                     NATAQQPSTVHPTEPLGSEIGILSQAAEGAAPEHGLNREGHSTNNASLRPLTSLNWPP
                     EPDPGLFTDPLLKDDPKPLRHEELLRIAQSTSLRALLVDQTLISILQLLDTLPPPARH
                     SALSKLLGFDPQSLSNTSNTLINGRDSPPPLDELLGALARGVGDTAEEAVQDGGWWLN
                     GPKNKVWITEREKKLMRLFAGSVCLAIDGKIEDGDLVWGQGELAWDV"
     gene            complement(671030..675944)
                     /locus_tag="CND02480"
                     /db_xref="GeneID:3256931"
     mRNA            complement(join(671030..673237,673296..673828,
                     673882..674629,675425..675944))
                     /locus_tag="CND02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657002.1"
                     /db_xref="GeneID:3256931"
     mRNA            complement(join(671030..673237,673296..673828,
                     673882..674629,674719..675944))
                     /locus_tag="CND02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658479.1"
                     /db_xref="GeneID:3256931"
     CDS             complement(join(671411..673237,673296..673828,
                     673882..674629,675425..675463))
                     /locus_tag="CND02480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512674.1"
                     /db_xref="GeneID:3256931"
                     /translation="MAVYTDQLQPWEENQSPSPTEVAENPYELALAPLRTSSLQVRSP
                     GPPSPVNTLHSRLSGDPDSPPPAWKRRSSINRRPSISSEHQRQLSASSTNNSLKSAGD
                     HTGTQNTSPRAARSPAESVHSAQSTSPTSSRTAPPSRRHPNLAMTIAATRPPATTLSS
                     VVSHESSEGSSLSLGDDLALPNPAFRRRVAEGANSARSSTVSSQDLNSLTSEELWTLG
                     QEEVPDMSNPMRTAAERPLDTVRRLSTIADTDPVYHTGLPSEVIWPPGPPPEELLYRP
                     VRNKSFTSIQNSTKRLSIRRSSRRTSAADISTSTLTKGKIKPGAQSLPVSPVAPHKIN
                     MLSSAHSSSTSLSSHQAITPNKSYPALGHSKSGPPASFYSKDFINSLAPREGGYAVAA
                     TIGGVASPAGSISNDKRRTSYVDSSISRTRAPLARSAGMGRWSLDGGENYGRPYLTSS
                     AATTSSNLTAPPLTSNQADVHLSEPRGKAHSQVPDGALPPAINLHGAATQSSLVSGAM
                     QRSSPNPSPLSQQTHAQDVMSTAAGDTAEDSKVNGNTPVQYPIENAANAINKPSTFEM
                     SIPAGPLATESATPPLTNKKSKKQLAKDAKAQRKAEAQAAARARAEQMRQELARKQQQ
                     REEEQRKKIEIKRKEKEEKVKRKAEKKEKKNGFLRKPASSALRKAETEPAVASSRAEA
                     QRDEVDASTTTSKPAPAITSSSTTSFPVMRSMLNVNKLSTARPEASESGQSSPSSTPA
                     GQSPPSFRTGEEQGDNSKKPEVKLKRSFFGTIKKRFSYSAGDKEGVSPMPSQRERRFT
                     AVADRHEAGKTGYEKQEADGSLKLRPEKDGLIAPPPRQTSLMAVASDSSIHRRTDTVS
                     EETSEVIAGESPRTVRPNSTLMSSPSSSPSSGRHQIPRKPISTEGTLGNKILDQSSFS
                     EAPDPFPIEHNASPLEHIHGDDQISRVIPFSTATAANSGTHLEFSSPAPMPVTPSTSG
                     DSQLSYMHSHASHNSNVTPVTSVSESEALSDENLRMGKESRDSQLLGGQIPPQREGSD
                     ETVLAIKVDPTSSPIIAV"
     CDS             complement(join(671411..673237,673296..673828,
                     673882..674233))
                     /locus_tag="CND02480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514333.1"
                     /db_xref="GeneID:3256931"
                     /translation="MTIAATRPPATTLSSVVSHESSEGSSLSLGDDLALPNPAFRRRV
                     AEGANSARSSTVSSQDLNSLTSEELWTLGQEEVPDMSNPMRTAAERPLDTVRRLSTIA
                     DTDPVYHTGLPSEVIWPPGPPPEELLYRPVRNKSFTSIQNSTKRLSIRRSSRRTSAAD
                     ISTSTLTKGKIKPGAQSLPVSPVAPHKINMLSSAHSSSTSLSSHQAITPNKSYPALGH
                     SKSGPPASFYSKDFINSLAPREGGYAVAATIGGVASPAGSISNDKRRTSYVDSSISRT
                     RAPLARSAGMGRWSLDGGENYGRPYLTSSAATTSSNLTAPPLTSNQADVHLSEPRGKA
                     HSQVPDGALPPAINLHGAATQSSLVSGAMQRSSPNPSPLSQQTHAQDVMSTAAGDTAE
                     DSKVNGNTPVQYPIENAANAINKPSTFEMSIPAGPLATESATPPLTNKKSKKQLAKDA
                     KAQRKAEAQAAARARAEQMRQELARKQQQREEEQRKKIEIKRKEKEEKVKRKAEKKEK
                     KNGFLRKPASSALRKAETEPAVASSRAEAQRDEVDASTTTSKPAPAITSSSTTSFPVM
                     RSMLNVNKLSTARPEASESGQSSPSSTPAGQSPPSFRTGEEQGDNSKKPEVKLKRSFF
                     GTIKKRFSYSAGDKEGVSPMPSQRERRFTAVADRHEAGKTGYEKQEADGSLKLRPEKD
                     GLIAPPPRQTSLMAVASDSSIHRRTDTVSEETSEVIAGESPRTVRPNSTLMSSPSSSP
                     SSGRHQIPRKPISTEGTLGNKILDQSSFSEAPDPFPIEHNASPLEHIHGDDQISRVIP
                     FSTATAANSGTHLEFSSPAPMPVTPSTSGDSQLSYMHSHASHNSNVTPVTSVSESEAL
                     SDENLRMGKESRDSQLLGGQIPPQREGSDETVLAIKVDPTSSPIIAV"
     gene            676686..683468
                     /locus_tag="CND02490"
                     /db_xref="GeneID:3256902"
     mRNA            join(676686..678033,678085..678420,678468..678741,
                     678790..680615,680664..680802,680855..681043,
                     681107..681280,681334..681773,681827..682107,
                     682158..682358,682430..682729,682787..682928,
                     682984..683110,683171..683468)
                     /locus_tag="CND02490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657003.1"
                     /db_xref="GeneID:3256902"
     CDS             join(676733..678033,678085..678420,678468..678741,
                     678790..680615,680664..680802,680855..681043,
                     681107..681280,681334..681773,681827..682107,
                     682158..682358,682430..682729,682787..682928,
                     682984..683110,683171..683308)
                     /locus_tag="CND02490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512673.1"
                     /db_xref="GeneID:3256902"
                     /translation="MGSHSDTEGSTDATQQHSSPTPNPEPTIEGPPDNPQPDSAESEL
                     VGLGIQSGSAIKELPPYPEKDDSHNSEVMHEPPLNPEDISVSPPLPPPKPERAVPTRT
                     DSKETLEDVELSRENTPSVARGGDMAFKGSVNVSHSHTSLPSIVAPSLPPTPSRQQAY
                     ARPPSTIQGHRSRRSSTATTLSLSNFGPNSPGPQLSTVLITPPLQLLVSSKEAKKSPS
                     FHAAAQRALDLCQSSEGANAAYLHPREIFEPLRLAISNPQTTSVPILVTSLDLLSKLI
                     SHSFFAEPHGPPPGLPPLPDLITHTITLSYSESSPPQVALQVVKALMAIVLSTDKGML
                     VHQSSLLKAVRTVYNVFLLSNDAANQVVAQGGLTQMVHHVFGRVIRPDIKNATPESGR
                     GSVSENEARRRSGVMQESTTAGSLPSTPAPERHDSVNGKMTLESFAAENPNDSIPVDR
                     APITDSVNHDAAAEADIEVEAPRLPQHTVSIPVPASVADSNGAPSNQQAGQGIDEEGG
                     SFDAMGRPIPTEQLFVKDAFLVFRALCKLTMKPLVTDSEKDLRSHAMRSKLLSLHLVL
                     TILRSHSDIFVNPLVCIPSNSSLEMTPFLQATKQYLALSLSRNALSPVNQVFELSVEI
                     FWCMLKDMRAQLKKEIEVLLNEIFIPILEMRHSTIRQKSIILGVFIRLCHDPQALVEI
                     YINYDCDRSSLENIYERLMNIVSKIGQTHFAPPSKEELAQGGSSKQTSGSSGPAIPPS
                     LSTSALGEGVGHNAPHYAGMPPEIKLRRQSLECLVAALNSLVAWSTSNPGTKAGNLEE
                     NHSTTDAVGRHHASGSVSGSIAELVAPTPIWPTDSSLKSSVSGMASGMNTPDLGEDDV
                     GKFESAKQRKTNLLEGIKKFNFKPKRGIAYLLEQGFIRSNSPVDIARFLLTNEGLNKA
                     MIGEYLGEGDDENIATMHAFVDMLDFSNMQFTDALRMYLQSFRLPGEAQKIDRFMLKF
                     AERYMHSNPSSHFANADTAYILAFSVIMLNTDAHNKNLKQKRMTKQEFVKNNRGINDG
                     KDLPEELLAGIYDEITTNEIKMKDEVEIPQPATSGGLASVGRDLQREAYVAQSENMAS
                     KTESLLKAMVRQQRRGVVRPTDHYHTASRLEHVRFMFEVAWMPFLAGISAPLQETDDM
                     DVVDLCLEGLRSAIRIVCLFDMELERNAFVTTLAKFTYLSNVAEMKPKNMEAIKSLLD
                     VAVTDGNYLKASWKDVLVCVSQLERMQLISSGMDVPDLNRTVTTSTDKRKPSSSKKKV
                     PTEEVAEESRSSQVTVAADMVFSTSKNLSGSAIVDFVKALSEVSWEEIQSSGSSARPR
                     MFSLQKLVEISYYNMGRIRLEWSNIWLILGEHFNQVCCHNNPNVSFFALDALRQLAMN
                     FLEKEELSHFRFQKDFLRPFEYTIVHNKNSDAREMVLQCLQHMLQSRVQNLRSGWRTM
                     FGVFSAASKVVTERVCSYAFELVTLVYRDYFSLVVKYGSFSDLTVCITDFCKVSKFQK
                     ISLQAIEMVRGLVPTMLQCPECLLPQLGDEGKVQHGDDPMVKYWLPVLHSFYEIIMTG
                     EDLEVRRLALDCLFDTLKTHGSGFSVDFWNIVCQQVLFPIFSILRAKSDIRFKSPEVL
                     SIWLSTTLISALRDLINLYTVYFEVMQRYLDGLLDILVACICQENDTLARIGTSCFEQ
                     LLEQNVRKLSPEKWMLIVSAFVQLFKTTTAYQLFDPVMCSEIEPTGNMDENDAPFQKF
                     VAPAPLEPATDKPPSLPSTISYGEQRRIFKQVIVKCVLQLLLIETTHELLQNGEVYNT
                     IPAEHLLRLLDVLDDSWSFARKFNADKELRMQLWKVGFMKQLPNLLKQESSAAATLVN
                     VLLKMYNDPREAHRATRKDVVKRLVPLAKEIIGDFNLLDAESQPRNVAAWTPVIGDIL
                     QGCCILEIDSFEQHITTFYPLVTDILVKDVSLDIRIKATNYLRRVGEVRGLIEKQ"
     gene            683481..686510
                     /locus_tag="CND02500"
                     /db_xref="GeneID:3257098"
     mRNA            join(683481..683830,683895..684084,684236..684528,
                     684589..684722,684783..684957,685018..685057,
                     685117..685208,685275..685401,685473..685844,
                     685899..685971,686050..686089,686158..686510)
                     /locus_tag="CND02500"
                     /product="expressed protein"
                     /transcript_id="XM_024657004.1"
                     /db_xref="GeneID:3257098"
     CDS             join(684053..684084,684236..684528,684589..684722,
                     684783..684957,685018..685057,685117..685208,
                     685275..685401,685473..685844,685899..685971,
                     686050..686089,686158..686222)
                     /locus_tag="CND02500"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512672.1"
                     /db_xref="GeneID:3257098"
                     /translation="MAPLERQKAYACFGVGLSLFATLALSSPFHQKPLSYDSVESIKG
                     CFSPSDLSSSSPNDNPPYVPHINYAAFDKDDDGSTPPPDYMTLYPLHVFGSREERVNL
                     MFFSDGYTVGEEEKFVKDASKLKDDIVSHGGAMSHVAHLLNVWATFVPSNGSGIGSHD
                     RPLEGASFGLYRPGAELRAVFVNNPRRARAACRWFRENKAKQGGCDQPILLGNDPLYG
                     GLGGEFTVITASELNGPLVLRHELGHSIMDVGEEYDGGYAYFGVNSDRYKRRDALKWR
                     EFLTNPESSRIEDVRVPLQVYPWHDLDISSWEISFNSSNLISPQNGVSCYPTALLRAS
                     LSSIPYSSHVVLVLNGCTLDLADGFPKAWEGSSDRRWLEVPLTLETGLQPGCNTIKVA
                     LTDEGRRARAGQGGKMIASLEIIEYGGDGRFNHTEGFIGAFPTYAMDGRVRLRPTNEG
                     CLMRKIDHPTFCPVCAHYLGNRLENIIKNH"
     gene            686584..688062
                     /locus_tag="CND02510"
                     /db_xref="GeneID:3257052"
     mRNA            join(686584..686723,686805..687006,687114..687226,
                     687284..687370,687422..687462,687528..687669,
                     687728..687832,687907..688062)
                     /locus_tag="CND02510"
                     /product="hydroxyacylglutathione hydrolase, putative"
                     /transcript_id="XM_570448.2"
                     /db_xref="GeneID:3257052"
     CDS             join(686659..686723,686805..687006,687114..687226,
                     687284..687370,687422..687462,687528..687669,
                     687728..687832,687907..687976)
                     /locus_tag="CND02510"
                     /codon_start=1
                     /product="hydroxyacylglutathione hydrolase, putative"
                     /protein_id="XP_570448.1"
                     /db_xref="GeneID:3257052"
                     /translation="MLTPSARISAPRFSRQLSTSLISKMKVLPYKARSDNWMYLIIDS
                     SNEAAVVDPYDANKISGAVKEQRANVTSLITTHHHADHSGGNSKFLSLHPNLKVYAGS
                     TQSPGTNTVVKDGDTFTLGQDITVKCLHTPCHTQDSICFFLEDKKTGQRGVFTGDTLF
                     LAGCGRFFEGTPEEMHAALTKLSNLPEDTIVYNGHEYTKGSAKFGLTIEPDNQHLKEL
                     LKKAENDSCTTGKSTIGDEKNWNVFMRLDTPQAKQATGKTEAVEIMGRLREMKNAM"
     gene            688226..691258
                     /locus_tag="CND02520"
                     /db_xref="GeneID:3257258"
     mRNA            join(688226..688444,688502..688613,688664..688793,
                     688847..688968,689019..689155,689210..689231,
                     689278..689351,689407..690205,690270..690300,
                     690358..690432,690483..690554,690608..690758,
                     690807..691020,691072..691258)
                     /locus_tag="CND02520"
                     /product="lanosterol synthase, putative"
                     /transcript_id="XM_570450.2"
                     /db_xref="GeneID:3257258"
     CDS             join(688229..688444,688502..688613,688664..688793,
                     688847..688968,689019..689155,689210..689231,
                     689278..689351,689407..690205,690270..690300,
                     690358..690432,690483..690554,690608..690758,
                     690807..691020,691072..691133)
                     /locus_tag="CND02520"
                     /codon_start=1
                     /product="lanosterol synthase, putative"
                     /protein_id="XP_570450.1"
                     /db_xref="GeneID:3257258"
                     /translation="MPTITNTFISFPPFTDTFMAQYTPPATDLTAWRLKVSEDSHGQQ
                     KWVYLSDPAQRKEWPQMNIEKYWLGLDVEVPELEEPKTPLDAARNGYRFYKELQSEDG
                     HFSTEYGGPLFLIPGLIIALYVTGQSLRHEQAIEMRRYLFNKRRKEGGWGLHTAAPPT
                     VYGTVMNYVALRMLGMGPDEGPMTEIRSLIHKMGGATGIPTWGKVWLSILGAYEWDGV
                     GSVPPELWLLPDWAPFAPWRWWIHVRQVFTPMSFLYGTRFVGPFTPLVFSLRQELYVE
                     PYETINWPSQRSNISSYDIYSPHHPILDMAHQLLAVYEKLPHVPILSSRLPLRKVALD
                     KVYRMITYEDENTTYQTVGPVSKAFHIVCRFAREGPNSEAFKSHLSRIDDFLWLSKSG
                     LMMMGTNGSQMWDTGFMAQAAVETGLAEESEFKESVKGMLDWLDKAQMRENPKWYKEG
                     YRHRTKGAWPFSTPEQSYTVSDCTAEGLKAVLALQHLDYTPKPVGLDRMRDAVDTLLS
                     MQNKSGGFASYELTRGSTKLEWLNAAEVFGDIMIDYTYPECTTSVLSALKYFSKVDTE
                     YRAADIELTIRRAIQYIHDIQRPDGSWYGSWGICFTYATMFALESLGIAGETCANSDK
                     VRRACDFLVGHQMEDGGWGETYMSCVTGKYAQHDQSQVVQTAWAILALIYGQYRDKTV
                     IERAAKLIMSRQLKDGRWEQEDTEGIFNKNCAIDYPAFKFVFCIWALGRADKYLRS"
     gene            691473..694666
                     /locus_tag="CND02530"
                     /db_xref="GeneID:3257001"
     mRNA            join(691473..691913,692000..693103,693153..693853,
                     693923..694666)
                     /locus_tag="CND02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_570251.2"
                     /db_xref="GeneID:3257001"
     CDS             join(691661..691913,692000..693103,693153..693853,
                     693923..694114)
                     /locus_tag="CND02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570251.1"
                     /db_xref="GeneID:3257001"
                     /translation="MAVESVPVQPQAVSPTEMHIEKDALKSASAAVEEKKEDEVEALQ
                     EQVEAVNLGNVDDLHAACVEGKLQDVRALLSKGTDRLETLDVNSGCTPIVLAIRGNHH
                     DIVRELLAAGAIIPPPGLTNDPLMLSILYPQPVYGMPPQFMSIPPQDFYPQPNYFPSQ
                     NGETQRFPLRKDSASAPNGAPNGNGSASNLPPAEVSKSIPCRNFPNCKYGNACVFLHP
                     RPAHFYPGPGQNGFAPQGFEGYPPYPPAPAPYFMPNGNNFQSFAPSDAQPQVSDSAEA
                     GAQVDSASIAAVPAPTGAAPAPIPAPPHIPSAVAPVFVPGYQPADMMGSPPPPPFGLS
                     PMSPSMLGSSLPSIPPAEVFFATSPTNGFMPPPPMTGPHARRQSFGQGPQFGGQGKPF
                     GHGKKPSFSGGKPWTGNRPAGGKFGNWKDGNPPPCAFFSQGNCRNGEFCKFPHLDPDG
                     NDCRHPDVVRGVIPPLPPLSRQNRNMRAVGPGFAPFDPAFRQQQYQQQMQFLQHQRMA
                     AAQAQQSQAPAEPNDEVKPIVEDEAPATDAEKQATDSVPAAATSPAVTVLPAKPAVTM
                     PTLLRSASQPGVQRVHANGVPSRSHSPAPSNVSFHGNGHPRRAGRVPNVNGARSSSSG
                     PEKKPAQRVPKPDEFPVLGTPTSEKKEPVWGMSGKTAAQVLQAPAPVKPVVKVSQPIE
                     EDAQSVTMESESDSDTVLVSRKPSASATPATTASPDPEPKKAAISFASIAGAVAAPSV
                     ETAPVAVKA"
     gene            695693..697157
                     /locus_tag="CND02540"
                     /db_xref="GeneID:3256956"
     mRNA            join(695693..696506,696565..696753,696811..697157)
                     /locus_tag="CND02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_570452.2"
                     /db_xref="GeneID:3256956"
     CDS             join(696580..696753,696811..696834)
                     /locus_tag="CND02540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570452.1"
                     /db_xref="GeneID:3256956"
                     /translation="MCFAQNTFISSPVNHHSHSQSCSAPMCSYTDGNYPDDHVCECGS
                     CKCLVVTKNKLCVNCKKGNHA"
     gene            complement(697005..698386)
                     /locus_tag="CND02550"
                     /db_xref="GeneID:3257188"
     mRNA            complement(join(697005..697353,697410..697786,
                     697840..697899,697953..698386))
                     /locus_tag="CND02550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570477.2"
                     /db_xref="GeneID:3257188"
     CDS             complement(join(697192..697353,697410..697786,
                     697840..697899,697953..698313))
                     /locus_tag="CND02550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570477.1"
                     /db_xref="GeneID:3257188"
                     /translation="MSETLTKKQQKAAAFRSKQKAKKAGVEAPPDLPEEDVVEDAEAA
                     EEEQVLDQATKKRKRNVEDENAENVVTVEESEVSIKPKDHEKKKRKTAWDEEGDGESE
                     GKKGKGKKDAKQRFILFVGNLSFKTTKEEIQKHFEPAAGQLPSVRLLTTKATPTQAAK
                     SRGIAFLELPSSTVLQACLKLHHSELKGRTINVELTAGGGGSSEDRKKKIQERNQRVG
                     GQRERRAEREKETGGGEENDAFEGQPSGQKGDDEKKAKMRGGRRVKAKTSNAVAPVPS
                     TARHQSSNSFAPSRPPTKEYSGGKFQKKRWEPTGANSISVGQK"
     gene            698594..700883
                     /locus_tag="CND02560"
                     /db_xref="GeneID:3257444"
     mRNA            join(698594..699299,699364..699475,699531..700883)
                     /locus_tag="CND02560"
                     /product="expressed protein"
                     /transcript_id="XM_570454.2"
                     /db_xref="GeneID:3257444"
     CDS             join(699015..699299,699364..699475,699531..700789)
                     /locus_tag="CND02560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570454.1"
                     /db_xref="GeneID:3257444"
                     /translation="MRRPRESLDLLQDDETFSQSLGFRWWVNLHCIDAHHDMIFYHDI
                     TYSESSAWPKREQKGPSKVILDDPSLHVQGSVVYVWEGQFKGYHVSTEDLFIQVEERA
                     KKQYFSQEECFASGLLGTFDQIEQFKMANPYSHDHYYPSSMASIDDDRASPVFPDLTQ
                     HTTLGQNIGTALKSAHKIHFSSALPEMRITSPGPIKPNKAIDTEPGESDSDSPSHKNM
                     NLPGNYRRSPIGPQRLFSHNSTHYSNNRISLEAKLDAREANLLKREAFVKRREVEIVK
                     REHEFEQRLYSAEEASRKRDAKLSDREAILRACEERLGRKWDKLCDNEVEVFELKQNA
                     RERFQLLEEVEEINGFLRAKLEPVCQCIRTPHSPAWGTGNVIRPQVQLRYPVWVTVIG
                     KDRKDKAVRVLSITGIPTEANVARTAATEFKNWALPFGHIYRIRLNNNCSEKLSKWAS
                     TEAKLIDRYGFEMFFQRVGENTFVRFGPMLDIIFEPVSPNVDISTPVPIPFASASTGS
                     IPGNGQTSKIKKEKVKITPKFPPAIAGLARNQQKPVPEVSPME"
     gene            complement(700879..702164)
                     /locus_tag="CND02570"
                     /db_xref="GeneID:3257154"
     mRNA            complement(join(700879..701111,701179..701333,
                     701390..701565,701617..701697,701754..701767,
                     701823..702164))
                     /locus_tag="CND02570"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_570475.2"
                     /db_xref="GeneID:3257154"
     CDS             complement(join(700952..701111,701179..701333,
                     701390..701565,701617..701697,701754..701767,
                     701823..702085))
                     /locus_tag="CND02570"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_570475.1"
                     /db_xref="GeneID:3257154"
                     /translation="MSASYSPQKNPQHQQLSSEPPHASSSAWSGNLGEDPVFIGIVSA
                     VGASAFTLLGVMGYRRYWRRIKNADYVTSELLRRKTWVKGIVTSVGDGDNLRLYHTPG
                     PFFQYPLKIRSVPTTQKGLRNETISIRIAGVDAPENAHFGNPAQPHARESLEWLRATI
                     LGKRMRCQLLAKDQYNRIVAVPYISRRFWWDRPLPLMMLREGMAVVYKAGGADYGPWG
                     LDEMLKVEAEARNAKRGLWALKKFESPGDFKARMKLKSDVSEERPEGKLPSGWIALVK
                     RLMGRT"
     gene            702257..706110
                     /locus_tag="CND02580"
                     /db_xref="GeneID:3256865"
     mRNA            join(702257..702389,702447..702484,702538..702621,
                     702681..702775,702830..703085,703146..706110)
                     /locus_tag="CND02580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570456.2"
                     /db_xref="GeneID:3256865"
     CDS             join(702279..702389,702447..702484,702538..702621,
                     702681..702775,702830..703085,703146..705927)
                     /locus_tag="CND02580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570456.1"
                     /db_xref="GeneID:3256865"
                     /translation="MDVSSFFTRLLQVPKHPPSTARPDHLEDFDSAWQSIKETLEHPD
                     ERQLVRGISSTEVPVHLRHIVDALVYESNRTDEDTTGVCLEYFLKNDILAHLERLCEA
                     DRPHGIKAEVVKSINNLVVLLSERFLVHNAVHRPLRRLLRSCIGDEPEEKLDGTRVFG
                     AAGMANGMERGASNEDIEGDLVDLMCVLCSKMRAYPPLLLIFFHDRGWAQSNNNVSQV
                     DSNSNRARSPTPTTHTTLSELPTKTSSRATHQFEFLLFSYLLRFVHREGRLGDFARAG
                     LIFLFDIAFLTPGEEGGENLSSGPGNNGPDPLQEARDALGEFILDGDFADVMAAALGA
                     VYSLLPTKLQVPSISSQEVPEEDNKNISSGGMHLGSGMKRQDGEDNIQLSTDLHVRTQ
                     LDLLLKLFGFLQDIIRRCNSPILYADPHSGAVTVTHVLGGAIAGATLDAIHSSFLDNV
                     LYPSLLECSSHDGSSVAVLTYLDVLFSNLDDGPIVDRVLSFLLDIDLSDTCMPLPAVN
                     SKRERQETGAMRYVGRIPLKSTEYFASEGRFTLKDLILDNLCSGQWNSVTAALCLLQT
                     LLSNHPHQATRGLLSYIHEPAATALVRNPIPRSLNLQSPDASFLPKPVNFSDAREVEL
                     YGSLLSLLDPLQTSIEMSPGYVGYLADMQTALESNPSFRLAPILPFVDEEDVGETTFN
                     KASVNGGGGGGRLDGDDPIPHKLSPADPLLRAVLGEFEKFLCKTADENVAMTGVLTAM
                     ASCPYRALGGWLLYEKEASVGHMSLGGDESDSDASSDVSFSRHVSDGDRDPFVGRGSS
                     VDLPVIYQILRSLVKQISLLRRQVPQFDRLLSERRQGLLFADHLDEAMSIMLDVDRAG
                     STVFSSPSAKSGGNEASSLLTTRRKGGGGRSSALGLASSIKSFLTPKKKTGAPGTPGT
                     GTGTPGTPELGSHPRLGLFAGFSPSPLPPSTPPVFAAGPASGTSSPSSSLMSSAEPAP
                     APFKTHYDQTRQSVSLCLCDEREREREDADADAEDERGMIVTGVWGGKVKTTTTTTTT
                     PVWSGRHGKRRPDLIHLSSVPGKSGGAGGDGDVSFSMDPDEIDQLVKEEEDKQVSLST
                     VLDNCVILEEFLKETVALIVARRMLGVDQVGFI"
     gene            complement(705942..707758)
                     /locus_tag="CND02590"
                     /db_xref="GeneID:3257176"
     mRNA            complement(join(705942..706122,706172..706447,
                     706510..706626,706690..706821,706870..706966,
                     707010..707187,707226..707677,707731..707758))
                     /locus_tag="CND02590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570473.2"
                     /db_xref="GeneID:3257176"
     CDS             complement(join(706108..706122,706172..706447,
                     706510..706626,706690..706821,706870..706966,
                     707010..707187,707226..707667))
                     /locus_tag="CND02590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570473.1"
                     /db_xref="GeneID:3257176"
                     /translation="MLAYLHAAGMHNAYAALQHDAALADVDPRDRAVGLLEKKWTSVI
                     RLQKKVIDLENRNAALLAELAAAARPAAPGPFLPRPPPRHTLASHRAPVTRLAFHPTW
                     TLLASASEDATVKLWDWEAGDMERTLKGHTKAVMDVDFDPRGGLMATCSSDLTLKLWD
                     TANQYTNVKTLHGHDHSVSSVRFMPDGETLVSASRDKTIRVWQVSSGYCIKTFSGHAE
                     WVREAVPSEDGRWLVSASNDQTSRIWDFSTGETKMELRGHEHVVECAVFAPVNAYPAI
                     RELAGLKPPAPRDTRAKSPGVYAATGSRDKTIKLWDALSGQCLRTLVGHDNWIRALVF
                     HPSGKYLLSASDDKTIKVWDLANGRCTKTIEAHSHFVTSMTWGRAVGASGGIEKVNGD
                     ASSKEPRRINVLATGSVDQTIKVWTP"
     gene            707974..709167
                     /locus_tag="CND02600"
                     /db_xref="GeneID:3256876"
     mRNA            join(707974..708144,708186..708587,708632..708709,
                     708768..708783,708832..708870,708920..708938,
                     709009..709167)
                     /locus_tag="CND02600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657005.1"
                     /db_xref="GeneID:3256876"
     CDS             join(708036..708144,708186..708587,708632..708709,
                     708768..708783,708832..708870,708920..708938,
                     709009..709086)
                     /locus_tag="CND02600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512670.1"
                     /db_xref="GeneID:3256876"
                     /translation="MWTELAHIVRHASADPAIRVLVLSSTSDAAFTAGLDLNSQSLLA
                     APAADPARKALALHAHLRAFQAAVSSLSACRQPVICALHGFALGLAIDIAAACDIRLC
                     ASDTQFGVSEVNVGLAADIGSLQRLPKVTGNDSKVRELALTGRAFGPREAEQMGFVSE
                     VVDGGRAQVVAVAIEKAKVIASRSPIAVISTKHVLNHARDHTVEQGLQYVAAWNMSML
                     QSSDTAKAMSATRNKESVTFPGFSDAKL"
     gene            complement(709118..710367)
                     /locus_tag="CND02610"
                     /db_xref="GeneID:3257439"
     mRNA            complement(join(709118..709547,709602..709773,
                     709835..710367))
                     /locus_tag="CND02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657006.1"
                     /db_xref="GeneID:3257439"
     CDS             complement(join(709170..709547,709602..709773,
                     709835..710289))
                     /locus_tag="CND02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512668.1"
                     /db_xref="GeneID:3257439"
                     /translation="MRRIPSQVPSAVSRLLQGQVISSPPTWYNPALAHPPPQLPPYQV
                     KSRPRVSAKLPGGGSGDGGGQFIDTAPIPAGELERRDRLRGYKQRKGRPLKIAYEEDW
                     VRRQFFKDFPFEALRPVSMVEGVEIDVREKVGGEEWTSLEQRGLYPTVEDCIEFVINV
                     RNTRNVSISEAYALATEEFVSLRGRHQLATLAAEIEARHYGAEFKPDVFERAFNLEEK
                     ALESLRPFTASSSSSSGSSRVKYREQPRWQWSNTVPPSSIPGAGAGGFSRGQNYVAKW
                     KMPEPLRVGAQGQGDLLAAIPAAGEMPPAEGAEGVAEEDAKLEDLEMLKAALGSSKSA
                     "
     gene            complement(710447..713728)
                     /locus_tag="CND02620"
                     /db_xref="GeneID:3257065"
     mRNA            complement(join(710447..710753,710804..711271,
                     711328..711768,711822..712487,712540..712757,
                     712813..713048,713108..713216,713474..713728))
                     /locus_tag="CND02620"
                     /product="aconitase, putative"
                     /transcript_id="XM_570245.1"
                     /db_xref="GeneID:3257065"
     CDS             complement(join(710701..710753,710804..711271,
                     711328..711768,711822..712487,712540..712757,
                     712813..713048,713108..713216,713474..713661))
                     /locus_tag="CND02620"
                     /codon_start=1
                     /product="aconitase, putative"
                     /protein_id="XP_570245.1"
                     /db_xref="GeneID:3257065"
                     /translation="MVSSRYLVRGANSLSRQSMVAKRSMATVQSSIGDKKVEMSNLEK
                     GKFINYQRIENNLQVVRSRLNRPLTLAEKVVYGHLDNPHEQDIERGVSYLKLRPDRVA
                     CQDATAQMAILQFMSAGLPQTAVPTSVHCDHLIQAQIGGKADLARAIDINKEVYDFLA
                     TACAKYGIGFWKPGSGIIHQIILENYAVPGLMMIGTDSHTPNAGGLGMVACGVGGADA
                     VDVMADIPWELKAPKVIGVYLDGQMSGWTTPKDVILKVAGILTVKGGTGAIIEYHGPG
                     VESLSCTGMATICNMGAEIGATTSLFPFNHRMGSYLKATNRSAIAQYAEEFNHNLQPD
                     EGCEYDQRIEINLSELEPHINGPFTPDLATPLSKFAEEVKRHSWPQELKVGLIGSCTN
                     SSYEDMSRSAHIAREAASHGLTAKSQFTITPGSEQVRATIARDGMVDDFEKVGGLVLA
                     NACGPCIGQWDRRDVKKGEANSIITSYNRNFTGRNDANPATHAFVASPDLVTAMIFAG
                     DLTFNPMTDSLKGADGKEFRFSDPSGFELPAKGYDPGENTFQAPPADGTTVSVAVSPT
                     SDRLQLLKPFKPWDGKDIIEARVLIKAKGKCTTDHISAGGPWLKYRGHLENISQNCLI
                     GAINSDNGEANKILNQETGEFGPVPTVAAYYRDRDIPWVVVGDENYGEGSSREHAALE
                     PRFLGGRAVICRSFARIHETNLKKQGMLPLWFKNPADYDKISGTDKISILDLQNFKPG
                     QDIKVEITHKDGSKEQILTTSSINEGQWGWFKAGSALNMMASAAKARAEKQA"
     gene            complement(714655..716523)
                     /locus_tag="CND02630"
                     /db_xref="GeneID:3257130"
     mRNA            complement(join(714655..714935,714990..715073,
                     715142..715195,715252..715351,715402..715463,
                     715518..715747,715798..715937,716001..716253,
                     716307..716523))
                     /locus_tag="CND02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_570243.2"
                     /db_xref="GeneID:3257130"
     CDS             complement(join(714845..714935,714990..715073,
                     715142..715195,715252..715351,715402..715463,
                     715518..715747,715798..715937,716001..716253,
                     716307..716426))
                     /locus_tag="CND02630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570243.1"
                     /db_xref="GeneID:3257130"
                     /translation="MSFRAPNLIRSAAGRRASQTLNLRSQVIRRRFATEGGPEITKPS
                     SPRSSNTRYLLAGVGIAAVGAAYYFYGTGRTAHDSANKADTVVRGAVATVEAKTGLRR
                     GKDEYQKVYNRIAETLEKEGYDDGSLAPVLLRLAWHSSGTYNKEDGTGGSNFATMRFK
                     PEAEHSANNGLHVAREHMEKIKQEFPWISYGDLWTLGGVCAVQESGGPTIPWRPGRID
                     GFEAQVTPDGRLPDASQAQDHLRFIFNRMGFNDQEIVALSGAHAMGRCHTNRSGFEGP
                     WTFSPVTFSNQYFALLRDEPWQWKKWTGPAQYEDKNTKTLMMLPTDMALLKDKSFKKY
                     VDIYADNEEKFFSDFAKAFSKLIELGVPERQWAGEPWTLGTSD"
     gene            complement(717929..718969)
                     /locus_tag="CND02640"
                     /db_xref="GeneID:3257302"
     mRNA            complement(join(717929..718035,718089..718190,
                     718239..718301,718388..718551,718608..718969))
                     /locus_tag="CND02640"
                     /product="expressed protein"
                     /transcript_id="XM_570665.1"
                     /db_xref="GeneID:3257302"
     CDS             complement(join(718004..718035,718089..718190,
                     718239..718301,718388..718466))
                     /locus_tag="CND02640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570665.1"
                     /db_xref="GeneID:3257302"
                     /translation="MLEDDKRSRRRAQFARFFKDCQQNSKYSTFTRAPEKREHGTTVR
                     ASVPLPLYQLTVALYDFGHQRNVCSVYEICDNFDISSEEGSHIAGCP"
     gene            complement(722886..725626)
                     /locus_tag="CND02650"
                     /db_xref="GeneID:3257049"
     mRNA            complement(join(722886..723404,723463..723583,
                     723635..724000,724052..725335,725391..725626))
                     /locus_tag="CND02650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570472.2"
                     /db_xref="GeneID:3257049"
     CDS             complement(join(722986..723404,723463..723583,
                     723635..724000,724052..725335,725391..725582))
                     /locus_tag="CND02650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570472.2"
                     /db_xref="GeneID:3257049"
                     /translation="MADDFITTIDSDDEVSNYGEPSALPKIKDDELDPDFQFDLGGGR
                     SEGLDLWGGDEVQGVKKGNEPINVDDIIERKRGKPIRAFKDRKRKRDEDATSEDDLEE
                     DEEEEGDSNDDSDAAKSGDSEEDEMDVDMSEGDGDEEDENEIESLKREDESDEEEEEE
                     EDDYDEEGENEVVDSDSESEEETAAEIARKDAFFSSDPTTTDPTLPSSFTAMNLSRPL
                     LRALTSLQFTAPTPIQARAIPLALLGRDILGSAVTGSGKTAAFMVPILERLCYRDRGK
                     GGAACRVLVLCPTRELAVQCEAVGKALAEKGGLDVRFALLVGGLSLNAQAHTLRTLPD
                     ILIATPGRLIDHLTNTPSFTLSALDVLVIDEADRMLEAGFTDELEEIIKACPRSRQTM
                     LFSATMTDSVDELVKLSLDKPIRVFVDPKRNTARGLTQEFVRIRSDDSRSPSLLALCK
                     RTIREKCIIFFRSKALAHQMRIVFGLFGLKAAELHGNLTQEQRLQALNDFKAGTVDYL
                     LATDLASRGLDIKGVETVINYDMPGQLAQYTHRVGRTARAGRKGRSVSLVGEADRKML
                     KAAIKQAEADQVRHRIIPSEAVTAMKEKLEEFKDDIQEILKEEKEEKLLRQADMEIKK
                     GQNMVEHEAEIFSRPARTWFQSGKEKQASKSAGKDAYVGSFPSTGKSAEKEKEKLKRG
                     KYDGLSRRLKRRKMAIEEDAADAAAARKTEMGIRAAKKNALPKKITEPQPRLEKAGKG
                     KDKKKGKARRVTGGKGSAFDSEGKKSHEGMRAKPAKVNLEKGKKKGGKGKGRK"
     gene            725826..726869
                     /locus_tag="CND02660"
                     /db_xref="GeneID:3256872"
     mRNA            join(725826..726148,726203..726352,726414..726565,
                     726619..726869)
                     /locus_tag="CND02660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570241.2"
                     /db_xref="GeneID:3256872"
     CDS             join(725918..726148,726203..726352,726414..726565,
                     726619..726829)
                     /locus_tag="CND02660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570241.1"
                     /db_xref="GeneID:3256872"
                     /translation="MPTLILPGETVPIPSTSKAVVLGPGISQSTPTLQASSSTASGSS
                     SAQGYIATRLGMLHSGKGKERSQKLWIEGNSKRYIPAQKDIVLGIIIARHADGYRVDL
                     GSSQMAQLDALAFEGATKRSKPNLKVGTLVFARVMSASRDMEPELECFDPNTGKSDGF
                     GELKGGVMVNATLQLCRRLLDRNHIVLPTIASIFPFEIAIGLNGRVWMKAETVGETLA
                     MKRLIESVDDHIIPVEEKAIKEKLREYLS"
     gene            727177..731418
                     /locus_tag="CND02670"
                     /db_xref="GeneID:3257015"
     mRNA            join(727177..727315,727363..728125,728174..728369,
                     728423..728526,728583..728940,729017..731418)
                     /locus_tag="CND02670"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024657007.1"
                     /db_xref="GeneID:3257015"
     CDS             join(727234..727315,727363..728125,728174..728369,
                     728423..728526,728583..728940,729017..731302)
                     /locus_tag="CND02670"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024512666.1"
                     /db_xref="GeneID:3257015"
                     /translation="MWWPFQWLFIYVLGGLTFVPLVVVIIVVYAIKYGSSPIRDDDPF
                     KLRKNQLQSQTEKEEQLQKRHSKERATTSETHSLSGWLTIRRQFHSNSTGGDGGISSS
                     NKGGSSMATTGSIAPPLPEVLTEDENPAKRSAELKDIDQSINTALGDSNAPSMNPAAK
                     STYSSRIAQTYRSIVPRQNKLPAPKSYFFCVLKSSVLFLYEDESQSNCAAAIGIEDYN
                     VEVEDGGGQFNGRDGEMFSKRNAIVLKLREGGRGIPLLSKSMSAEDADGEASGPIYLF
                     SKSNTKMEDWYMALLQVSSCQPTFDDVFSSKDMQNMVDTIDTEPDPIPMRWFNAFMGR
                     VFFGYYRTEAFEQFIISKIMKKLSKVPRPSFLSPIVVREVNVGSSPPFFSKPMLKDLT
                     ASGTAAFEVHVQHRSRASQPASDVRLTIATTATIPTGFKPYVVDLVLAVVLKSFEGNL
                     LVQIKEPPSNRIWYGFTKMPKIEMEIIPVVSERKIQISMVLKAIEKQLRDVIAESVVL
                     PNMDDLAFFNSCDYPVRGGIFDFAAKAKRNAKGEREDTFHASERSTQDALSPSSEASS
                     TTLRQRHQKQTVYTSTTTVPPLTPSIPSSESGADTGTEIVRTETAPITLPSGSASSKK
                     AAALSATKKWFAASGAKPSSSVAQTLTGGVGQGADDDNSTNENLSKRSMESQEADRKI
                     GQKGQTNWENRPEIASVEVSLSTSSHSDIPEPVRASGIDDVTSGSRSTLGLVAPSPSK
                     FSETSSIATSSTEAFPNVIPTDETFALPHQLGMGSTSSLISSLRSRDKKALQAQMDSA
                     KDQMKKWSVNFGAKRRSKAGIIEEGGRSEKDEGRQALYRPKEEEEDVRDDDHIPLPSQ
                     SQTHRRTTSSLSHGLSLQERLNAAAHETHATVVPHTHSSPMLIPERQRSSSTVSRPSL
                     LPSPSKTSSLASVGVSPSKWTPVGGRPTTGVIKDDAASTSSNILAAQAQPMSQGHTRR
                     QSSSAPVSTQPTAERIMVVPSVPKRPGQVTGIGSSDLVPSKLNEGSAIRHDQEEDSKL
                     ESTEDAKDELKPEPSTLPPRKNTEPMQTEEKIEQEPPRGILPAHNVGVPPPLPPRKSA
                     FDSPSKPKSLGQQNDQKVQLRAPEQVPDLSGSARFSEVYRSQPEKKSNDLREEVHSVS
                     SNDKRPTHDPSLALASFSDRQRNRGDDNDYNFTPCEFQAPTAPVAQSTKDRTGDSDAE
                     SALRMVTIKYEEARKAKEAESNPEGEKVHVVNEEDDVLKNTRGYDAKTPAENRDSTLL
                     "
     gene            complement(731193..732741)
                     /locus_tag="CND02680"
                     /db_xref="GeneID:3257064"
     mRNA            complement(join(731193..731537,731594..731723,
                     731770..731968,732022..732100,732156..732272,
                     732322..732432,732483..732741))
                     /locus_tag="CND02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657008.1"
                     /db_xref="GeneID:3257064"
     CDS             complement(join(731427..731537,731594..731723,
                     731770..731968,732022..732100,732156..732272,
                     732322..732432,732483..732716))
                     /locus_tag="CND02680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512665.1"
                     /db_xref="GeneID:3257064"
                     /translation="MPSATYARQSANALNRATRGDDSLSPPAGPSNARDEDVKMNTRG
                     SPSEDEDEEEDIEGWTEDTFVDKPVNGSQPTMTMFRTLKSKLEEVTNRLEEAIEEIKD
                     AAFAIEEANPNDESLENIEGSLFKAFDQRQVLQIKIRCLEQLEARLKGGEEYTNVNDA
                     FNHLSEPEIKEYLAKSQRAKLRKFKEYIDFRSNLWSINHDDACPPVSSFLEKGINDEE
                     SDDEIDVGGQTQTYRCPITLTLYQDPMTCTKCSHTYSKIAIYDLIDSARKQRRSAKCP
                     VTGCSVTIEKSDLKPNPSMQKRANEFARRQQDKDDEREDDIASIEDSDED"
     gene            732917..735459
                     /locus_tag="CND02690"
                     /db_xref="GeneID:3257214"
     mRNA            join(732917..733116,733171..733311,733361..733633,
                     733681..733783,733841..734099,734149..734216,
                     734263..734804,734853..735063,735120..735459)
                     /locus_tag="CND02690"
                     /product="damaged DNA binding protein, putative"
                     /transcript_id="XM_024657009.1"
                     /db_xref="GeneID:3257214"
     CDS             join(732977..733116,733171..733311,733361..733633,
                     733681..733783,733841..734099,734149..734216,
                     734263..734804,734853..735063,735120..735221)
                     /locus_tag="CND02690"
                     /codon_start=1
                     /product="damaged DNA binding protein, putative"
                     /protein_id="XP_024512664.1"
                     /db_xref="GeneID:3257214"
                     /translation="MASPLTVGFCERATSAEDVSECFDSVVQVLNVKKIASTDTTAVD
                     RYRAILSDGQYFIQAMLATQLNHFVESKQVDKHSLVKVVNFSVNSVSGRKLLIILALE
                     VVPWTDEKIGNPVSVDQAKSGASASAQPAGAHSAPLQSATAPAPARAQVPGRNASSAR
                     PGNTKPKGDLGPLYPIEGLSPYQNRWTIKARVTQKSDIRHYSNQRGDGKLFNVTFMDE
                     TGEIRATGFNDAVDNFYNLLEVGKVFFVSRARINIAKKQFSNVNNEYEIMFERDTEIE
                     PCADESVPQVKYNFKGIGDLGELQKDDVCDVIGVVREVGELGSVTSRATNKPFAKREL
                     QLVDQSGQSVRLTLWGKQAETFQADDQPVIAFKGVKVGDFGGRSLSMFSNATMTINPD
                     IPEAHSLRGWFDAEGHNKHFTAYTTASVGDSAINTAAGAATRPAELKTIAQVKDEQLG
                     MSEKTDFFSTEATVAFIKKDPFSYPACANPDNCAKKVVEDGSGWWCEKCQRRWDEPIH
                     RYILSMNVMDYTGQFWMTAFNETAEQIMGISANDLMKLKNEGNDLDYDVHFAKATART
                     YVFQMMAKQDSFNDQVRVRYQCRKVAPPDYVADSAHLSQMISQMSV"
     gene            complement(735415..736938)
                     /locus_tag="CND02700"
                     /db_xref="GeneID:3256843"
     mRNA            complement(join(735415..736074,736125..736267,
                     736318..736376,736430..736682,736734..736938))
                     /locus_tag="CND02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_570471.2"
                     /db_xref="GeneID:3256843"
     CDS             complement(join(735505..736074,736125..736267,
                     736318..736376,736430..736682,736734..736866))
                     /locus_tag="CND02700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570471.1"
                     /db_xref="GeneID:3256843"
                     /translation="MSAKTVRSVHAAVTLSTPPPLSKHSRSAFSEAERQGLLQNFDLE
                     VQDKLQYFRSMLKQTLDSFSLRGETEILSIPRELRTMTLGELEEKWGGGWAGTFHRIK
                     TERFEVEEKEREEREEKGREEAVKGKRKRNIATTSRANSPARSTKNPRREAPTGPNRN
                     APSRATSSTAAARAKPAAMSKRTSKAIVASSSNSTSGLPQVHIFNPALPTAPFRSAGA
                     GSAARPSPISKVTHSYSCSRELSDNSGSIISVNEDSLEGDEEEDDLPDPQAMEAKLLS
                     QPEAKSPTSKSRSRKKRGPSLIFHQSFGAGKIISTPEPPSSLDSDEPLATIQLSDGRE
                     ISFNPFSLTPGRVERELEEGGVSKEEKIRVQNEVHAEVVKSLQARMEKWKV"
     gene            737062..741230
                     /locus_tag="CND02710"
                     /db_xref="GeneID:3256988"
     mRNA            join(737062..737145,737201..737854,737902..738091,
                     738143..738610,738663..738939,738990..740616,
                     740665..741012,741070..741230)
                     /locus_tag="CND02710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657010.1"
                     /db_xref="GeneID:3256988"
     CDS             join(737077..737145,737201..737854,737902..738091,
                     738143..738610,738663..738939,738990..740616,
                     740665..741012,741070..741162)
                     /locus_tag="CND02710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512663.1"
                     /db_xref="GeneID:3256988"
                     /translation="MRNMVAQHSLKRKATLENGSGNKRGPAVPQSSRAENDNDLQELG
                     NESSISYDEEAMEPLEDPMIDQQVFSDDAGSVSDADAHEEASESEEHDRPTAGPSRSS
                     KNLYKAPTLSEMEALRRAEETGGTTFSLQLSELLEASLLPTAPHAALKDLLTAIHSRI
                     LGMPAIESLHPAKAIKRIGIKVPFPGPAEFSPLKNGKEIKWTLGWAKPEEVVIGGSWS
                     VVGGYKKEKGEMGGIDLVVAMPHGIFSPKDRLDYRYFHKRIFYLAVIFSELQRLATKE
                     GELKGVKIEWATNMADERRPIVVVRAGKDQGLKSKVDIRIHASIPSSLFPLSSLSPAK
                     SLVRTALFATTDQTSGTPSPLYNTSILHDTLHKPHLLHLHRLSQLLPSNARTVDSFLA
                     LWRIWAKRRGIRRERGGSAWLAGMVLGWVINGGWVGGVGGKREQVKKVAGVGRSLGAW
                     GALRAAWEFLAHTDFKQTPIFLHPPSSPSSFEHSVFLTFSHVFTDPSGLVNIFAGWDE
                     GEIDFLRYHARETLAMLEDESGERFADVFLKEFDLGPAVFDEFFHIDISSARLPDDLY
                     KRSEHPSVSSLAVTVFSSTLRQGLSNRVNFVHICPISDHSISVGLLLDPSHANRVLDI
                     GPSSDKPLEGEAFRGLWGEKAELRRFKDGSIAESVVWDLSRPEDAALIPSKIVRYLLE
                     NHYSIPGDAVTSFSSSQSWLSLIQIPSSARDAITIKGSEKLGFRPMLSGYDSLYKVLK
                     DIDHKLPLAVLNVQPSSPLLRYSSTFVPHPVDIHRFSAAPDCIKYIPSADVIVQFESS
                     PKWPDDLAAVQKVKLALFEKLARILPSRLPEIKADIVFDAGASEIEDQASLAVMLPEG
                     ISFRLRIYYEREKTMLERVLQEEKPLFATSLPYPPRRLVVPALAIHLERFHYLPAHHS
                     SLAPMHHRYPTYSSACRLLKRWFAAHMLLGESGVREEIVELIMAGVYLEPGRGKTPSS
                     AVGGFMRAMELLECWDWRTEPLLIPIVSASSPTSASASGRVRFPAELKEEALKLFEHL
                     RAKEKGTEGNEGNVHAWVVCTEQDVEGMRWTKGIGKAVAVRVGALARATVRAVKDSIE
                     KGSLDVTALFITPLEHYDIIIHLSPKFLSTSAQSILPDPSLWEPHLKYRNLTSSSEES
                     DGMRIDFDPAALFVRDLKKIYGDSLMFFVDRHGGDAVGGVWNLARDGARGLKSFLGWN
                     GMPVKSEAELVEINKEAIIGEIARLGQDLVVRIERRR"
     gene            complement(740667..742040)
                     /locus_tag="CND02720"
                     /db_xref="GeneID:3257364"
     mRNA            complement(join(740667..741282,741330..741500,
                     741556..741882,741937..742040))
                     /locus_tag="CND02720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657011.1"
                     /db_xref="GeneID:3257364"
     CDS             complement(join(741274..741282,741330..741500,
                     741556..741882,741937..741939))
                     /locus_tag="CND02720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512734.1"
                     /db_xref="GeneID:3257364"
                     /translation="MSNTLRPYLNAVRATLTAALTLSNFSSQVVERHNKPEVECGTSP
                     EVVLHPLIISRNESERVLIEPSVNSIRLSIAIKQADEIEKILCHKFTRFMMMRAEGFV
                     ILRRKPLPGYDISFLITNFHSESMLKHKLVDFIIQFMEDVDKEISEMKLSLNARARIV
                     AESYLSTFA"
     gene            742143..744059
                     /locus_tag="CND02730"
                     /db_xref="GeneID:3257223"
     mRNA            join(742143..742287,742335..742700,742752..742822,
                     742873..743022,743071..743347,743499..743584,
                     743646..743793,743854..743906,743962..744059)
                     /locus_tag="CND02730"
                     /product="fk506-binding protein 39 kda, putative"
                     /transcript_id="XM_570231.2"
                     /db_xref="GeneID:3257223"
     CDS             join(742264..742287,742335..742700,742752..742822,
                     742873..743022,743071..743347,743499..743584,
                     743646..743793,743854..743906,743962..744004)
                     /locus_tag="CND02730"
                     /codon_start=1
                     /product="fk506-binding protein 39 kda, putative"
                     /protein_id="XP_570231.1"
                     /db_xref="GeneID:3257223"
                     /translation="MPLAMNLWSLTLLPGQQYPTYVRRDFQITNAALGEELRSKDGRS
                     VVKVTHNPISQSMLESDDEWSDEDEDEEILSEEDDGEMEVEEVKQKKGKKAEKVEEED
                     SEEEDEDESDFEDELEETNVLCSLTAGKTEQASLNLTFVRGEVVVFEVTGDNVVHLMG
                     NYIQQDEDSDDESDSDFDGEDDYSELYGSDDDLELDSEEEAAVAKITEIPDEPTPKTK
                     KALPAADKKPVPEAKPAQKRKAEELESPAKEDAALSKAQKKKLAKKAKVEGEKAEEKP
                     AAAAVAEKPATKKEAKAPQKKTLPSGLIIEDIKIGDGPVAKTGKRLGMRYIGKLTNGK
                     QFDANTSGKPFSFVLGKGEVIRGWDEGLAGMAVGGERRLTIPAALAYGNQKIPGIPKN
                     STLKFDVKLVSIN"
     gene            744200..749776
                     /locus_tag="CND02740"
                     /db_xref="GeneID:3256955"
     mRNA            join(744432..744541,744597..744690,744821..745559,
                     745610..745762,745812..745923,745969..746180,
                     746236..747356,747406..748932,748986..749369,
                     749426..749776)
                     /locus_tag="CND02740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657012.1"
                     /db_xref="GeneID:3256955"
     CDS             join(744459..744541,744597..744690,744821..745559,
                     745610..745762,745812..745923,745969..746180,
                     746236..747356,747406..748932,748986..749369,
                     749426..749614)
                     /locus_tag="CND02740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512661.1"
                     /db_xref="GeneID:3256955"
                     /translation="MSLFKRKHSKADLHPPPATTPAPAATQPVAPSAAPHRGQAYGNV
                     GIGGNNNPRRMTSNPQLKSSAQASYPAHSGQSPQLNQHLPGQVDTHAGHMSMMSTPHP
                     QLGYRINPQSPTPSANGPAASGGYGGSPHLGMSPPPIHSSAPASVQASAQPQQGQLQH
                     QALHSNHPQGQSQEIGQGQLQSRPHPSPNPLSYPWQIRPLRLYSSGQNVPASPFPRYG
                     LSVPCFPSHSGHMLVFGGLVNEKVRNDLWSIDIRDLSVMYVKTKGDAPPPRVGHASVI
                     MDRIMVVWGGDTKIDVADEQDEGLYILDLRSQEWTKVPISKGPVGRYGHAACMVENRF
                     YVFGGQADGMFMNDMWMYDIKQLSGTAMVHTWEQVSYTTPPPPRRTGHVLVAASSGKL
                     YLFGGTDGNYHYNDTWCFDPSTGAWAELSCIGFIPLPREGHAAAIVDDTIYIFGGRDV
                     KGKDLGDLAAFRLSNQRWFMFQNMGPSPAARSGHAMVSAHGKIFVVGGEANQVPLEPG
                     ERDDPQKIHVLDTSKIKYPHDAKSKTTMADQADSRGMQGTPQPGQQQGQTPGRLPQSA
                     STEGLNTRTGTSSPSSERGPSTQHVLTQSQSQVLDTQVSPQSQAQIPQPPLQSPRNVG
                     PVLTTKPNGPPPQRPRREGDEEFREAMSPTKLHYSSQASDQAQSPVQSSLPSRVTSPT
                     HISPTSPKNHPKMFHSSVNGTRSPSPRLRNADGPSSERERAPPPPDAFYYGRRSPTAN
                     GFRQSASSRPSSFGASNDLVKEVRAKENEVEEGKRRETALKIILNRAVKQGFLLGDEE
                     QKPSGGDKEEQADDNKQNDGLVGRLTDALVRLKKEKAKMQNDLVAQIRAASAKSVEAD
                     HLRRGALQETAFYRAKIAALETNSLLDLKRVEKERINELEKQINILANENAQMSKELE
                     WEKEGREQANCLHSSATQREAETLRRAEEAEEAQKEALEELERLRGHFLTYEQGAREH
                     SEQLITLSSRVQQREAERDQLRSQLDEAIATRDQNIQLVSEVQAAITSAGLMASEMEA
                     MYTKESVKVQQLEEELAECRAELESRTRNAELATEKLKEIENAYAKSREEADALRAVT
                     TSRLGEILDSHKEMRADETRAARGHQEQLQALEEEGKSLRKMLKEAGQRVDAAESGVN
                     QHRTKMRDVESKVQTLRGELRTSQTKLLSAQAEVARYKQLHSTRDEELKEKEIAMTEV
                     ETRCAMLRNLLADHGIAVNDSDLEDIKAPSTRELEGKLREQTRVSEAAQREIQDLRTR
                     CEEAEVKVESLGKLVERIKGARSPTSASMRSPTPTSGEMTRVSELEKKLIDMEKEHRD
                     KVAGLETDYQTAVRYVKGTEKMLKRMKDELNRQKATNTTIQTELDHLRGRSSISGRST
                     PSSSSVIESDVQRRFNVLQNQHQKLQEDFSASQDVLSARNREVDLLRMRLDEAERDME
                     SLRDDLAQAQHRIQTLLDVKGGSDDEDDGSLEATMAFDKFSQELKQWERSRSPGEGNF
                     EDKSSEEGTTMPGQSASYQARVVAQSSKAHSPSSSEYSGDWVQ"
     gene            complement(750068..752442)
                     /locus_tag="CND02750"
                     /db_xref="GeneID:3257413"
     mRNA            complement(join(750068..750542,750638..750802,
                     750856..751480,751531..751758,751817..751915,
                     751987..752103,752209..752442))
                     /locus_tag="CND02750"
                     /product="Delta-12 fatty acid desaturase, putative"
                     /transcript_id="XM_024657013.1"
                     /db_xref="GeneID:3257413"
     mRNA            complement(join(750392..750802,750856..751480,
                     751531..751758,751817..751915,751987..752103,
                     752209..752442))
                     /locus_tag="CND02750"
                     /product="Delta-12 fatty acid desaturase, putative"
                     /transcript_id="XM_570226.1"
                     /db_xref="GeneID:3257413"
     CDS             complement(join(750680..750802,750856..751480,
                     751531..751758,751817..751915,751987..752103,
                     752209..752363))
                     /locus_tag="CND02750"
                     /codon_start=1
                     /product="Delta-12 fatty acid desaturase, putative"
                     /protein_id="XP_024512659.1"
                     /db_xref="GeneID:3257413"
                     /translation="MTSTLRQRAVTPPAGQVEKDQLLREAEEKEISQGQQFIVPNFTI
                     KQLLDAIPAHCYKRSALRSSLYVVQDVVVIAALVYGAFHIDSLLGRFSLSPVAYYAAK
                     FALWSAYWFITGLFGTGIWVIAHEAGHQAYSSSKAINNAVGWVLHSALLVPYHSWRIS
                     HGRHHAATGHLTRDEVFVPRTRKQLGYPEVEEEGEILGINVSKERQNQLREALEDSPI
                     VVCYNLFLQQLFGWPMYLIRNASGQLHYPEKTNHFSPHSFIFKANQYWQIIWSDIGIV
                     LVFAALAFWASQRGIKEVATIYGIPYLWVNHWLVFITFLQHTDPVLPHYSANKWTFPR
                     GALATIDRDFLGPVGAYAFHGITETHVAHHISSKIPHYNAWEATEALKKFLGPAYHKS
                     NENMFVSCYKCYRDCLFVEDGQDIVFYKNASGLAQRVPVEENGNISDSGIDMAESK"
     CDS             complement(join(750680..750802,750856..751480,
                     751531..751758,751817..751915,751987..752103,
                     752209..752363))
                     /locus_tag="CND02750"
                     /codon_start=1
                     /product="Delta-12 fatty acid desaturase, putative"
                     /protein_id="XP_570226.1"
                     /db_xref="GeneID:3257413"
                     /translation="MTSTLRQRAVTPPAGQVEKDQLLREAEEKEISQGQQFIVPNFTI
                     KQLLDAIPAHCYKRSALRSSLYVVQDVVVIAALVYGAFHIDSLLGRFSLSPVAYYAAK
                     FALWSAYWFITGLFGTGIWVIAHEAGHQAYSSSKAINNAVGWVLHSALLVPYHSWRIS
                     HGRHHAATGHLTRDEVFVPRTRKQLGYPEVEEEGEILGINVSKERQNQLREALEDSPI
                     VVCYNLFLQQLFGWPMYLIRNASGQLHYPEKTNHFSPHSFIFKANQYWQIIWSDIGIV
                     LVFAALAFWASQRGIKEVATIYGIPYLWVNHWLVFITFLQHTDPVLPHYSANKWTFPR
                     GALATIDRDFLGPVGAYAFHGITETHVAHHISSKIPHYNAWEATEALKKFLGPAYHKS
                     NENMFVSCYKCYRDCLFVEDGQDIVFYKNASGLAQRVPVEENGNISDSGIDMAESK"
     gene            complement(752829..752920)
                     /locus_tag="CND02760"
                     /db_xref="GeneID:3257159"
     tRNA            complement(752829..752920)
                     /locus_tag="CND02760"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:3257159"
     gene            753048..754206
                     /locus_tag="CND02770"
                     /db_xref="GeneID:3257227"
     mRNA            join(753048..753464,753536..753613,753693..753742,
                     753804..753862,753912..753976,754030..754206)
                     /locus_tag="CND02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_570224.2"
                     /db_xref="GeneID:3257227"
     CDS             join(753384..753464,753536..753613,753693..753742,
                     753804..753862,753912..753976,754030..754104)
                     /locus_tag="CND02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570224.1"
                     /db_xref="GeneID:3257227"
                     /translation="MSTPPANITVVPDEANLQVWRVRITGPPGTPYAKGTFTVSVEFT
                     KEYPFKPPVIKFETRTYHPNIDNDGNICIGLLKTEQWKPATKMDNVLREIYNLLAEPN
                     PDDPLVTSIAEQYRTDRKTFDKRAAEFVVKYAS"
     gene            complement(754357..755453)
                     /locus_tag="CND02780"
                     /db_xref="GeneID:3256894"
     mRNA            complement(join(754357..754456,754504..754676,
                     754736..755070,755123..755247,755362..755453))
                     /locus_tag="CND02780"
                     /product="40s ribosomal protein s6-b, putative"
                     /transcript_id="XM_570222.1"
                     /db_xref="GeneID:3256894"
     CDS             complement(join(754447..754456,754504..754676,
                     754736..755070,755123..755247,755362..755432))
                     /locus_tag="CND02780"
                     /codon_start=1
                     /product="40s ribosomal protein s6-b, putative"
                     /protein_id="XP_570222.1"
                     /db_xref="GeneID:3256894"
                     /translation="MKVNFSNPATGAQKLIDFEDERKTRIFMEKRMGQEVAIDSLGEE
                     FAGYVVRITGGNDKQGFPMKQGVLLQHRTRLLLSDGHSCYRARRDGERKRKSVRGCIV
                     GSDIGVLAVAIVKQGANELPGLTDVVLPKRLGPKRATKIRKFFNLSKEDDVTKFVVRR
                     EVTKKNGKTTTKAPKIQRLVTPLRLQRKRHLRSLKKRRTEAQKETVAEYNAAVAKHAE
                     EKKVHNAAVKAAKKARRSA"
     gene            755682..756450
                     /locus_tag="CND02790"
                     /db_xref="GeneID:3257008"
     mRNA            join(755682..755746,755797..756023,756117..756219,
                     756275..756450)
                     /locus_tag="CND02790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570220.1"
                     /db_xref="GeneID:3257008"
     CDS             join(755739..755746,755797..756023,756117..756219,
                     756275..756392)
                     /locus_tag="CND02790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570220.1"
                     /db_xref="GeneID:3257008"
                     /translation="MGRMHSKGKGMSASALPYRRSQPSWSKATPEEVCDQIFKLARRG
                     LSPSQIGVILRDSQGIPQVKSVTGNKILRILKTNGLAPSIPEDLYHLIKKAVSVRKHL
                     ERNRGDKDAKFRMILIESRIHRLARYYIKTQQVPATFKYEAATASTLVA"
     gene            758600..759825
                     /locus_tag="CND02795"
                     /db_xref="GeneID:36392825"
     mRNA            join(758600..758951,759013..759089,759158..759171,
                     759249..759825)
                     /locus_tag="CND02795"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658480.1"
                     /db_xref="GeneID:36392825"
     CDS             join(758931..758951,759013..759089,759158..759171,
                     759249..759574)
                     /locus_tag="CND02795"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514334.1"
                     /db_xref="GeneID:36392825"
                     /translation="MMRVEGESRTALTSPLDRLGKRDFLRKFSVVLVSNSMRTAILSH
                     DIDHDSMPSTPDHLLSLYPHTLGRTLIRPPAPVLQQIALLRPLIAVLHSQHKINLNCS
                     SFPSSLDQRTKLKRHIPFPMVVLQVARLAVPGQGAADEHGRLS"
     gene            complement(760093..762927)
                     /locus_tag="CND02800"
                     /db_xref="GeneID:3256846"
     mRNA            complement(join(760093..760853,760906..761354,
                     761416..761548,761603..761981,762036..762235,
                     762308..762927))
                     /locus_tag="CND02800"
                     /product="glycerol kinase, putative"
                     /transcript_id="XM_570467.2"
                     /db_xref="GeneID:3256846"
     CDS             complement(join(760214..760853,760906..761354,
                     761416..761548,761603..761981,762036..762235,
                     762308..762786))
                     /locus_tag="CND02800"
                     /codon_start=1
                     /product="glycerol kinase, putative"
                     /protein_id="XP_570467.1"
                     /db_xref="GeneID:3256846"
                     /translation="MSRPIDLSMSSVKNPSPLAAGGTGGFTPVFEASPANSPAGSRRP
                     SISQPTARRPSEVSISRRPSVNHQYSSYVSQYPQQGSLSRRSSMASGPRPIRRGEYSG
                     PVTPSVLSRAGSPTLPLGNEFTQAPRSYYEGASGYTPLGGTRELRNGQFIGSLDCGTT
                     STRFIIFDKRAKIIAEHQTEFEQILPHAGWHEHDPDALVEAMNECIIKAVEKLEWMGW
                     SRNSIKGIGITNQRETTVCWSRSTGKPLCNAIVWDDARTINVVREMEKKLDEEGLEID
                     DEEEDEINQKSKIVPDEVEMGTGTHEAAFGEKGDVVDGDTSMTGKIGKAMEGLGLSGR
                     GKDGKAKKYRKGKEGLVDVTGIPLSTYFSAIKLRWMLDHQKAVRIAHEADDLMFGTVD
                     TWLVYNLTGANNGGLHIIDVTNASRTLLISLKTLRWHAPLLRFFGLRASILPKIVSSA
                     EVYGNISDSLGLPLSGVPIAGIVGDQQAALVGNKCLMKGQAKCTYGTGAFVLFNTGED
                     IVRSNYGLISTVAFQAGADSKPVYALEGSIAVAGSAIKWLRDQMTLIEESAEMDILAG
                     SVSDTGGVYFVTAFSGLLAPYWDREASGTIIGLTGYTTSAHIARATLEAVCFQTRAVL
                     DVIEKESGSRLDTLKVDGGVTNSDLAMQLQANIGGFNVARPSMRESTALGSALLAAHA
                     LGLFGWDLTRPETLSEVNTAGVHTFEPELEEKARLKKIKGWNKAVDRAKKWHDIDDED
                     DEEEEYENEAGYAKIIGSA"
     gene            763206..765779
                     /locus_tag="CND02810"
                     /db_xref="GeneID:3257134"
     mRNA            join(763206..764091,764141..764275,764317..764804,
                     764849..765040,765106..765115,765169..765287,
                     765343..765420,765491..765779)
                     /locus_tag="CND02810"
                     /product="CAP1-related"
                     /transcript_id="XM_570218.1"
                     /db_xref="GeneID:3257134"
     CDS             join(763278..764091,764141..764275,764317..764804,
                     764849..765040,765106..765115,765169..765287,
                     765343..765420,765491..765565)
                     /locus_tag="CND02810"
                     /codon_start=1
                     /product="CAP1-related"
                     /protein_id="XP_570218.1"
                     /db_xref="GeneID:3257134"
                     /translation="MTPSRAYTPPVSPKLKNTNLSYTILPHGAPPVSRPIRRPKKIIY
                     LAAIFFLLYWFGIRHGLGRERLPIPPLGYAVKGGRRGRKSSLAWHSKGMATLLQPQPG
                     TKQEHPIYELMERAETHWTSMLASQSTTLPQAVAQYRKRYGIAPPLGFDAWFDFCKRH
                     DIKIIDEYDQMMKDILPHHALPPVMFIARSKALEGAAYTYTLDISQEHVNITGERSSY
                     DRPQHLLKLIAGFKGDLPPEFRLRVTGSDHNTGSVVLGMDQRMRAMELVQQSKHFDED
                     ELKSLEDPYRTPAWGWFKACPLDSPANIRPWSENATDEFQPKSFIHDHLPIMDFCEYP
                     ELKRLHGAMSLDYANRSPSVLKPILVLSKFPFDSSFQTPPMEGYMNITEEDVLFLDRW
                     EDKTDNRLFWRGSTTGGYTAQRDWKDSHRLRLHLMINGPKGGNAWWDQQLRDVMVPDG
                     EGGFKIVRRWERVLSKAYADVKLSGQPVQCPSEEICREVADTIEFGKKVWPDEAAVYK
                     YNLDVDGDGWSSRFHRLLISGSPVIKFTMFPEWHQEWLTPWYHYIPLKPDYSDLYDIM
                     AFFVGPLDDAGHVDFSKGHDYLAKKIGNAGQKFALEHSSWVDMQAYMFRLLLELQRLH
                     SLNRSSMSYKAQ"
     gene            766692..768753
                     /locus_tag="CND02820"
                     /db_xref="GeneID:3257396"
     mRNA            join(766692..766792,766847..767239,767295..767316,
                     767399..767645,767694..768399,768452..768499,
                     768548..768753)
                     /locus_tag="CND02820"
                     /product="expressed protein"
                     /transcript_id="XM_024657014.1"
                     /db_xref="GeneID:3257396"
     mRNA            join(766704..767239,767295..767316,767399..767645,
                     767694..768399,768452..768499,768548..768753)
                     /locus_tag="CND02820"
                     /product="expressed protein"
                     /transcript_id="XM_570215.1"
                     /db_xref="GeneID:3257396"
     CDS             join(766892..767239,767295..767316,767399..767645,
                     767694..768399,768452..768499,768548..768622)
                     /locus_tag="CND02820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512657.1"
                     /db_xref="GeneID:3257396"
                     /translation="MDILDEPLPGHMESISAFRTLLKSPSDRVTCPDSVARPAEPDAL
                     QTSAIESWKATEPSRESRLRLLRLLNDLTYIINSKYKGYEEGGLKRYWVDVFGSVSWA
                     GDTGHSGDLDLIVLDRKLLHGYAPVFWRTPPGEPLSTPTSHKRNNIPTPLKHLPEVYD
                     TFSMAECLRQAGFEDVESIAAASTPINKFKYRDQECDLNVNDLGGWYNSSLLLHYCRL
                     APYVLRPMVHALKLWASSHKLNDPSGAKGPATMSSYCLTLMAIAYLQHIGHLPNLQAD
                     INVPEVCRPEDTSEHDVVWVSWGKEQGVKAHVGFSLSPSDDWKPSNPNLTAADAIRGF
                     FEFFSLNGSAPLRGEKFDRVTQIVSILQGGIVPRAKEYGQEIRESQQRRDTLLNLGIS
                     LERIRQSEDMIRQERFKEEERMGKGDRGIQPRNWGEKKLVVQDPFLWFKNCAGMMSRD
                     GLDRWWTTVDNTHRVIKLKGKNFTLADLLML"
     CDS             join(766892..767239,767295..767316,767399..767645,
                     767694..768399,768452..768499,768548..768622)
                     /locus_tag="CND02820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570215.1"
                     /db_xref="GeneID:3257396"
                     /translation="MDILDEPLPGHMESISAFRTLLKSPSDRVTCPDSVARPAEPDAL
                     QTSAIESWKATEPSRESRLRLLRLLNDLTYIINSKYKGYEEGGLKRYWVDVFGSVSWA
                     GDTGHSGDLDLIVLDRKLLHGYAPVFWRTPPGEPLSTPTSHKRNNIPTPLKHLPEVYD
                     TFSMAECLRQAGFEDVESIAAASTPINKFKYRDQECDLNVNDLGGWYNSSLLLHYCRL
                     APYVLRPMVHALKLWASSHKLNDPSGAKGPATMSSYCLTLMAIAYLQHIGHLPNLQAD
                     INVPEVCRPEDTSEHDVVWVSWGKEQGVKAHVGFSLSPSDDWKPSNPNLTAADAIRGF
                     FEFFSLNGSAPLRGEKFDRVTQIVSILQGGIVPRAKEYGQEIRESQQRRDTLLNLGIS
                     LERIRQSEDMIRQERFKEEERMGKGDRGIQPRNWGEKKLVVQDPFLWFKNCAGMMSRD
                     GLDRWWTTVDNTHRVIKLKGKNFTLADLLML"
     gene            complement(769029..770419)
                     /locus_tag="CND02830"
                     /db_xref="GeneID:3257005"
     mRNA            complement(join(769029..769420,769474..769658,
                     769709..770419))
                     /locus_tag="CND02830"
                     /product="nitrogen metabolism-related protein, putative"
                     /transcript_id="XM_570466.2"
                     /db_xref="GeneID:3257005"
     CDS             complement(join(769247..769420,769474..769658,
                     769709..770180))
                     /locus_tag="CND02830"
                     /codon_start=1
                     /product="nitrogen metabolism-related protein, putative"
                     /protein_id="XP_570466.1"
                     /db_xref="GeneID:3257005"
                     /translation="MAGLYHDQFGRKVAKIQLLLINPNSTSTFTQDVARHLHPRLPTD
                     VGITFYTPPPEAPASIDGPLDGIVSTAVILKDLELQPKGQAVNAPEDSSGASRLATSY
                     SGIVVACFSAHPLVPVLKELLAGYDKPPPVLGILESSVLAALQLGPTFGIATTGPQWE
                     PLFDEAVRAMGISPTRYTGTKGTGFNAVSLHGDKPAEALLEASCFLVQKGARVIILGC
                     AGMAPMRASLQEQLADRVGQSVAVIDGVSAAVDMAIGYARMGIGRTFGPDLSENSPTT
                     "
     gene            770537..772158
                     /locus_tag="CND02840"
                     /db_xref="GeneID:3256934"
     mRNA            join(770537..770647,770699..770772,770819..770840,
                     770916..771108,771173..771415,771465..771796,
                     771851..772158)
                     /locus_tag="CND02840"
                     /product="host-pathogen interaction-related protein,
                     putative"
                     /transcript_id="XM_024657015.1"
                     /db_xref="GeneID:3256934"
     CDS             join(770611..770647,770699..770772,770819..770840,
                     770916..771108,771173..771415,771465..771796,
                     771851..771987)
                     /locus_tag="CND02840"
                     /codon_start=1
                     /product="host-pathogen interaction-related protein,
                     putative"
                     /protein_id="XP_024512656.1"
                     /db_xref="GeneID:3256934"
                     /translation="MTLSKQRKVLTLEHFIIDTFTRLGNDGIERPIEQPDQIGGGGTY
                     AVIGARAFLPPTQLGMIVDYTPSTFPRALKDVLESYGNEMWAFRERTDGLPTARAVNR
                     YDGETRGFEYLCQPVLLTPNSLKGTQFEDIVPSVIHFISYPAPRAGIVLDEINNFRTS
                     KGWSPLIVWEPEDESLEAVTSIASHVDILGPNQNEALRLYSLLTDPTFTDDDFKAVLT
                     KICRSLAYLRPRIGAVIRAGHLGCCYASADPRGYRPEVKWIPAYWNKERDGYEGKVID
                     PTGAGNAFMGGIAAALSEGKSLDEAVRWGSVAASFAIEQIGLPQLTKTVDGRELWNGQ
                     NPQERLTAMSM"
     gene            772440..772532
                     /locus_tag="CND02850"
                     /db_xref="GeneID:3257155"
     tRNA            772440..772532
                     /locus_tag="CND02850"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:3257155"
     gene            772920..776429
                     /locus_tag="CND02860"
                     /db_xref="GeneID:3257313"
     mRNA            join(772920..773243,773294..773394,773453..773573,
                     773623..773752,773803..774002,774054..774232,
                     774291..774477,774529..775031,775086..775572,
                     775618..775760,775816..776032,776079..776429)
                     /locus_tag="CND02860"
                     /product="WD-repeat protein, putative"
                     /transcript_id="XM_570211.2"
                     /db_xref="GeneID:3257313"
     CDS             join(772970..773243,773294..773394,773453..773573,
                     773623..773752,773803..774002,774054..774232,
                     774291..774477,774529..775031,775086..775572,
                     775618..775760,775816..776032,776079..776395)
                     /locus_tag="CND02860"
                     /codon_start=1
                     /product="WD-repeat protein, putative"
                     /protein_id="XP_570211.2"
                     /db_xref="GeneID:3257313"
                     /translation="MISSAGHPTKKRQKKQLRSSQPAAGPSQQPSSPPRIFAPFRALG
                     YVTDHVPFAMFVHTPSGALATPTVNITTSVGRSWLMWDAARMTLVFAGADTGNQINGL
                     AMTGTDIYVSSGSKVIKYHRGKEVASFLSPDGSTLGQILIFGDDFLVLKKDGSGMFVF
                     DLATRHLRNQIAFHSSFTASSLMHPATYLNKVLVGSKQGELQLWNVRTCALVHSFPHP
                     TPFNPSSITTIVQTPAVDVVGIGYLDGSIRIQDIKHGDLVMQMKIEDGAVSSMSFRMD
                     GPSILATASSTGSISIWDLSKGGRILHTLRGAHDQSISGLQWVSGQPLLVSSSLDNSV
                     KQWLCDSPTGMPRLLKLRGGHHAPPTCVRYYGEDGKQILTAGKDRALRYTSVVRDSRS
                     FELSQGSLVKKAIGLGVTVDHLKFPQITAISSSSMRSKDWEDVLTAHSEDAVARTWRV
                     QEKRMGPWTFELEDGYAQSVCVTACGNFGIAGSSTGEIRMWNMQSGKERKSFALTGAA
                     PGNSKPKIISQSTGMVKAKVRKPERAKGNKSVQAITGLATDALNTILVASTLEGKLYF
                     FDFHSTQKLDEVQIESSITAISLHRDSGLLAATCDDLVIRLVDIESRRVVRELRGFKG
                     RILDVVFTPDSRWVIATSLDSIIRTYDIPTGKLIDAFKTSSIATSVTFSPTGDFLATA
                     HVDSVGVHLWANRAQFTDVALRNLEEDDDVVEVGLPTVQGLDADDAIEGIEDVGAPEF
                     TDIYTTPDQIDESLVTLSLIPRSRWQMLLNLETIKQRNKPKEAPKAPEKAPFFLPTIS
                     GLETQFDLSAVDKNRTEEELHKGKRLELDGSWLESEFTRRLSVEDETGSYNTFFEYMK
                     ALPPSTLDLEIRSLISLTHLSSFINALTQRLKSHRDYEAIQAIMSVFLRVHGDMLIAN
                     AELKEGLGALRLEQERESKRLRELVGYALGTLGFLRGA"
     gene            complement(776420..778469)
                     /locus_tag="CND02870"
                     /db_xref="GeneID:3257383"
     mRNA            complement(join(776420..776558,776616..777065,
                     777115..777192,777245..777515,777562..778400,
                     778440..778469))
                     /locus_tag="CND02870"
                     /product="mRNA processing-related protein, putative"
                     /transcript_id="XM_570464.2"
                     /db_xref="GeneID:3257383"
     CDS             complement(join(776488..776558,776616..777065,
                     777115..777192,777245..777515,777562..778400,
                     778440..778455))
                     /locus_tag="CND02870"
                     /codon_start=1
                     /product="mRNA processing-related protein, putative"
                     /protein_id="XP_570464.1"
                     /db_xref="GeneID:3257383"
                     /translation="MLSTSTSLQGGKVSREEYRRQKDLEAARKAGTAPAALDEQGNAI
                     NPHIPEYITKAPWYADTGRPSLAHQRINEQGPHLKLDEWYDRGAKAGPAAKKYRKGAC
                     ENCGAMTHKMKDCVERPRKRGAKFTNKDIAPDELVQQFEGDYDAKRDRWNGYDPASYK
                     HVVEEYEATEQMRKKYREEEIDQQTSTDMAVVKKLAKKDKEGKVEDDDDDFGSSDEDE
                     DDEDKYADAADQVGQKLDTKTRITVRNLRIREDTAKYLINLDESSAYYDPKTRSMRDA
                     PVRNMNPEDMKFAGDNFQRYSGDATNMQKLQLFAWQSAQKGSNINVSANPTAGELLHR
                     EFQQKKEVLKDTNKTSILAKYGGEEHLQRMPNELLSGQTENYVEYSRSGQIIKGRERA
                     KARSKYDEDVYINNHTAIWGSYYDLSTSQWGFACCHSVLPGSYCTGDAGKLANAASSA
                     SALLASSNERSKIEEAAEKERESLAEQHLKDLASGKAKKGKEREWDLPQYAKRREDGE
                     ELDLDKGRLKNALKEEKKRKKMGEDEAWQQTKKGKTDVTQEELEAYRLSRQAYDDPMS
                     NYQDPEDQ"
     gene            778610..780857
                     /locus_tag="CND02880"
                     /db_xref="GeneID:3257032"
     mRNA            join(778610..778686,778732..779068,779124..779755,
                     779808..780000,780053..780274,780324..780495,
                     780545..780857)
                     /locus_tag="CND02880"
                     /product="splicing factor SF1, putative"
                     /transcript_id="XM_570209.2"
                     /db_xref="GeneID:3257032"
     CDS             join(778648..778686,778732..779068,779124..779755,
                     779808..780000,780053..780274,780324..780495,
                     780545..780590)
                     /locus_tag="CND02880"
                     /codon_start=1
                     /product="splicing factor SF1, putative"
                     /protein_id="XP_570209.1"
                     /db_xref="GeneID:3257032"
                     /translation="MWRPAAKTTGTNDVPLANKRRFGLPEEGPPSNSPSYAPRPAADI
                     QYFNGRQERERDARDDRERPRDDYDRRRDDYVRDDRDRRYDDYPRDGHSDRRDERSKW
                     DEGDRREAPRGRERSRDRGDSNEDGPRKRRSRWGDASAKVNVPGMPVAVMGNVSQTEL
                     DNYAIHVRLEEINRKLRTGDVVPPEGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDER
                     TRLIDRAVKSDPNFRPPVDFQHKRGSRPQDKVYIPVKEFPEINFFGLLVGPRGNSLKK
                     MERESGAKISIRGKGSVKEGKGRAGNFPQDEEDELHCLITADDESKVKTCVALINKVI
                     ETAASTPEGENDHKRNQLRELASLNGTLRDDENQLCQNCGEKGHRRWECPQQRVYSAN
                     VICRICGGAGHMARDCRGRGDPSLTQNKQTAFDSEYTALMAELGEGGGSTPGSAPAAA
                     IGAPGAIPPQSRVPPWRLPENWQTNSGGFRGPPNFQAQGYQQAAPGAAAYGQQAYPGY
                     AGYQTGAVSGYGSPATGGADAYAAYYASMGQQAPAAAV"
     gene            complement(781724..784805)
                     /locus_tag="CND02890"
                     /db_xref="GeneID:3256842"
     mRNA            complement(join(781724..782026,782081..782284,
                     782343..782467,782519..782789,782840..783128,
                     783178..783474,783530..784338,784400..784805))
                     /locus_tag="CND02890"
                     /product="DNA supercoiling, putative"
                     /transcript_id="XM_570462.2"
                     /db_xref="GeneID:3256842"
     CDS             complement(join(781918..782026,782081..782284,
                     782343..782467,782519..782789,782840..783128,
                     783178..783474,783530..784338,784400..784752))
                     /locus_tag="CND02890"
                     /codon_start=1
                     /product="DNA supercoiling, putative"
                     /protein_id="XP_570462.1"
                     /db_xref="GeneID:3256842"
                     /translation="MLRRTIQRPSEPPLTSATSGGYGIVSTPFKVPKSSAPKRESALP
                     ARKRKAVSYKEEGSFDGSGDYEDNNEGRASKKGKFAMGNKEYGSDGVLGDMAKWCNRK
                     FPVFQPKDKSGVFTKSFSIPVMYCPKTSEPIIHSLSHASLGARRHPTLIPRPLHNPMD
                     DHAIVLFDPTIDDKPNPEDMKAAEFHEEMKKKEELNKGPHRSLKAILGIVDEKKNKQV
                     VKVPVVIDPRLSKVLRPHQIEGVKFLYRCTTGLIADGAWGCIMADEMGLGKTLQCIAL
                     LWTLLKQSPVAGKPTCEKVIIACPTSLVGNWANELVKWLGTGAVSPMVVDGKGGKAEL
                     IPAVRRWVQAHGRNVTLPVMIVSYETLRTLQEELASCEIGLLLADEGHRLKNAETLTF
                     QALTSLKVQRRVILTGTPIQNDLSEYFALLNFANPEYLGSKLDFKKNFESKILRGRDA
                     DATEKEKLESDAKLKELGGLVSKFIIRRTNDLLSKYLPVKYEHVVFCRPSPLQASLYN
                     LFVTSKDVQRLLRGKDSQPLKAIGLLRKLVNHPDLLNLPEDLPGSEALLPDGYNGKGR
                     DRTVNCQYSGKFVVLERMLDHINHHTNDKIVLISNATQTLDLMEKLCRSKRYGYLRLD
                     GSMSVPKRSKIVAQFNQPESKEFVFLLSSKAGGCGINLIGANRLVLFDPDWNPASDQQ
                     ALARVWRDGQKKECFVYRFQTTGTIEEKIFQRQCQKQNLSACVVDEAEDTARHFTQGD
                     LRQLFNFNPETLCDTHDTYKCKRCREGKQFVKAQALLYGDASTWNHYPNEELGKMHDD
                     LLRAELGLPEVSYVFQYISH"
     gene            785182..788988
                     /locus_tag="CND02900"
                     /db_xref="GeneID:3256900"
     mRNA            join(785182..785430,786063..786095,786146..786253,
                     786318..786763,786815..786968,787021..788028,
                     788074..788135,788191..788332,788386..788508,
                     788556..788988)
                     /locus_tag="CND02900"
                     /product="glutamine-fructose-6-phosphate transaminase
                     (isomerizing), putative"
                     /transcript_id="XM_570206.2"
                     /db_xref="GeneID:3256900"
     mRNA            join(785182..785218,785270..785430,786063..786095,
                     786146..786253,786318..786763,786815..786968,
                     787021..788028,788074..788135,788191..788332,
                     788386..788508,788556..788988)
                     /locus_tag="CND02900"
                     /product="glutamine-fructose-6-phosphate transaminase
                     (isomerizing), putative"
                     /transcript_id="XM_024658481.1"
                     /db_xref="GeneID:3256900"
     CDS             join(786089..786095,786146..786253,786318..786763,
                     786815..786968,787021..788028,788074..788135,
                     788191..788332,788386..788508,788556..788626)
                     /locus_tag="CND02900"
                     /codon_start=1
                     /product="glutamine-fructose-6-phosphate transaminase
                     (isomerizing), putative"
                     /protein_id="XP_024514335.1"
                     /db_xref="GeneID:3256900"
                     /translation="MCGIFSYCSFLCERNRKYVCDVLCNGLARLEYRGYDSAGIGIDG
                     DSKGSSMILFKEVGKVAALRKHIDEGIPCPLPGQAPSKEKVDMSKVFLSQTSMAHTRW
                     ATHGVPSPGNCHPHVSDVQTEFSLVHNGIITNYKELKLVLLKRGYTFHSDTDTEVVAV
                     LCKYVWDSQPNKRLNFTELIKTVVKELEGSFAFVFKSTHFPDEIVAARRGSPLLIGVK
                     TDRKLKVDFVDVELPTAEERVNDVDASGLLAVPAAVAEGPGPKLRRSQSRAFLSEDGM
                     PQPIEFFVASDASAVIEHTKRVLYLEDDDIAHIAEGELHIHRLRRDDTVSSVRAIEHL
                     EIELAAIMKGQYDHFMQKEIYEQPESVVNTMRGRVNFDTRSIMLGGLKAYLPVIRRGR
                     RLIFVACGTSYHSCIAVRPVFEELTDIPVAVELASDFLDRRTPVFRDDVAIFVSQSGE
                     TADTILAMRYCLERGALCLGVVNAVGSTLSRETHSGVHINAGPEIGVASTKAYTSQYV
                     ALVMIAVQLSDDSITKTARRQQIIDGLHDIPAQIRKVLAMDKVLQQMAKDMLSKEKSL
                     LIMGRGYQYATCLEGALKIKEVSYMHSEGILAGELKHGPLALVDEHLPVIFIMTRDSL
                     YPKVQSALAQVTARKGRPIIICNEDDDTVNDNAKVIRVPQTVDCLQGLINVIPLQLLS
                     YHLAVMNGVDVDFPRNLAKSVTTE"
     CDS             join(786089..786095,786146..786253,786318..786763,
                     786815..786968,787021..788028,788074..788135,
                     788191..788332,788386..788508,788556..788626)
                     /locus_tag="CND02900"
                     /codon_start=1
                     /product="glutamine-fructose-6-phosphate transaminase
                     (isomerizing), putative"
                     /protein_id="XP_570206.1"
                     /db_xref="GeneID:3256900"
                     /translation="MCGIFSYCSFLCERNRKYVCDVLCNGLARLEYRGYDSAGIGIDG
                     DSKGSSMILFKEVGKVAALRKHIDEGIPCPLPGQAPSKEKVDMSKVFLSQTSMAHTRW
                     ATHGVPSPGNCHPHVSDVQTEFSLVHNGIITNYKELKLVLLKRGYTFHSDTDTEVVAV
                     LCKYVWDSQPNKRLNFTELIKTVVKELEGSFAFVFKSTHFPDEIVAARRGSPLLIGVK
                     TDRKLKVDFVDVELPTAEERVNDVDASGLLAVPAAVAEGPGPKLRRSQSRAFLSEDGM
                     PQPIEFFVASDASAVIEHTKRVLYLEDDDIAHIAEGELHIHRLRRDDTVSSVRAIEHL
                     EIELAAIMKGQYDHFMQKEIYEQPESVVNTMRGRVNFDTRSIMLGGLKAYLPVIRRGR
                     RLIFVACGTSYHSCIAVRPVFEELTDIPVAVELASDFLDRRTPVFRDDVAIFVSQSGE
                     TADTILAMRYCLERGALCLGVVNAVGSTLSRETHSGVHINAGPEIGVASTKAYTSQYV
                     ALVMIAVQLSDDSITKTARRQQIIDGLHDIPAQIRKVLAMDKVLQQMAKDMLSKEKSL
                     LIMGRGYQYATCLEGALKIKEVSYMHSEGILAGELKHGPLALVDEHLPVIFIMTRDSL
                     YPKVQSALAQVTARKGRPIIICNEDDDTVNDNAKVIRVPQTVDCLQGLINVIPLQLLS
                     YHLAVMNGVDVDFPRNLAKSVTTE"
     gene            complement(788856..791315)
                     /locus_tag="CND02910"
                     /db_xref="GeneID:3257197"
     mRNA            complement(join(788856..789160,789218..789274,
                     789331..789509,789570..790200,790250..790333,
                     790389..790501,790565..790622,790687..790815,
                     790871..791086,791150..791315))
                     /locus_tag="CND02910"
                     /product="D-erythro-sphingosine kinase, putative"
                     /transcript_id="XM_570205.2"
                     /db_xref="GeneID:3257197"
     CDS             complement(join(789036..789160,789218..789274,
                     789331..789509,789570..790200,790250..790333,
                     790389..790501,790565..790622,790687..790815,
                     790871..791086,791150..791258))
                     /locus_tag="CND02910"
                     /codon_start=1
                     /product="D-erythro-sphingosine kinase, putative"
                     /protein_id="XP_570205.1"
                     /db_xref="GeneID:3257197"
                     /translation="MRPPHHLPVILHNNNRGLLIIQPSTLDVLQLSGDGPPPKRLLTC
                     PLTNFLKAYLAPAPENSARRLDLHCLGGGMGTQLKLVKLHVLVEPINIPETNEWIRML
                     MEAAYGSIKPFRNVLILVNPVGGKGKAKDIVQDTVIPILEAAGTTVTVKETTHRLHAE
                     EIASSMDLIYDVIVTASGDGLVYEVVNGLASRSDARKALLTPIAPIPTGSANAVCTNL
                     FGVKDTFNIPLAVLNIIKGCNLPIDLCSVLILPSMTRRFAFLSQAIGLMVDLDIGTEN
                     LRWMGDTRFLVGFLKGIANNKGARCRLRLKVVEDDKQNMAKKAKERTQQGTTEGAVTP
                     LINGTRNMSVDGETPVSTNDNIIGEHEPSAVIGEPISSASHTPPKPANANYVPDHGPI
                     PDALPLKHDETWLTIESLPKKSSIKPKKSIQSLKALRKASAQNKWVDGQEILYFYAGM
                     MRWVARDLMQWPVSIPGDGLIDVVVQSVVPRLTMANAIAGAEKGETYWMDCQYYYKVS
                     QFIAENLDTENQPLFTIDGEAFPFESFHVEVHTRVANLLSLNGDFFTSDFLKKPTGKS
                     "
     gene            791457..792575
                     /locus_tag="CND02920"
                     /db_xref="GeneID:3256960"
     mRNA            791457..792575
                     /locus_tag="CND02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_570203.2"
                     /db_xref="GeneID:3256960"
     CDS             791460..792431
                     /locus_tag="CND02920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570203.2"
                     /db_xref="GeneID:3256960"
                     /translation="MKAPLRNPPRLLAGEGRVHLSASNAHPSFSTRLAAYPLKLLSPI
                     PLPSQPSNFAVLYTLAYGGGLVAGDLVSLSVVLDPGCGLVMLTQGTTKVYKRRPGLRP
                     LSHLHTSPPSSDPNLTRQRMHIRLSSSSFLLLLPESVSPFRASIYSQTQRFVLPADRT
                     ASVLILDWVNSGRGQRPQEVDEEIWSMDSYGSTNEIWVGDERIMRERMVLDNSHFALN
                     AGGSLSPIANQLSPYNVYATILILGPHFTTLFSYLAYLSDHSRQFQLKEPPGLAWSFS
                     EIDGKLQAGVVRIAACEVEDARKWLREVMTAGGVAALVGEGMWPRCI"
     gene            complement(792548..797263)
                     /locus_tag="CND02930"
                     /db_xref="GeneID:3257281"
     mRNA            complement(join(792548..792854,792913..793168,
                     793220..793522,793572..793819,793866..794646,
                     794698..794899,794971..795107,795160..795259,
                     795315..795632,795687..795973,796027..796283,
                     796334..796451,796505..796683,796736..796858,
                     796907..796965,797021..797063,797119..797143,
                     797194..797263))
                     /locus_tag="CND02930"
                     /product="chromosome associated protein, putative"
                     /transcript_id="XM_570201.1"
                     /db_xref="GeneID:3257281"
     CDS             complement(join(792667..792854,792913..793168,
                     793220..793522,793572..793819,793866..794646,
                     794698..794899,794971..795107,795160..795259,
                     795315..795632,795687..795973,796027..796283,
                     796334..796451,796505..796683,796736..796858,
                     796907..796965,797021..797063,797119..797143,
                     797194..797196))
                     /locus_tag="CND02930"
                     /codon_start=1
                     /product="chromosome associated protein, putative"
                     /protein_id="XP_570201.1"
                     /db_xref="GeneID:3257281"
                     /translation="MYIKTITIQGFKSYRDQVAVDPFSPGHNVVVGRNGSGKSNFFSA
                     IRFVLSDQYTKLSREERQRLLHEGTSTSTTLSAYVEIVFDNSDGRFPTGRQELVLRRT
                     IGLKKDEYSLDRKSASKSEVDQLLESAGFSKANPYYIVPQGRITHLTNMNDRERLRLL
                     KDVAGTEVYEQKRAESTRIMEETDGKRDKILELLTTIEDRLRELEEEKEELKEYQEKD
                     RERRCLEYALHQRELEDVTNALDEIEAERRQDIHNSNEKRKEFNDREDEIQRYEEALT
                     AAKHSLSTTQASLRQYETERADLVRNKTELECVIADFETAGQVGEHRRAELAEELEVM
                     QQKVDEATARLEDLVQEAEQRIGEEKAAREALEPTQSKLSVLFAKQGRAQQFATQAAR
                     DKYLKDEIKALKEHEKNQGKRVEILQKEVAGAKEQLAQLSAKSEQQVQGENDRRENLK
                     KMNEEIAQLQRNIAGMHEQKKELWREEGKLAQTEVNAKSEMEAAERSLMGMMNKDTSN
                     GLRAVRQIAKRLNLDGVFGPLYDLFEVSDKYKTAVEVTSGNSLFHVVVDNDETASKLL
                     DVMNREKSGRVTFMPLNRLKSHSVNYPKANDAIPMIQKLQFDREYVMAFEQVFGRTII
                     CEDLQTAAHYTRSHGLNAVTIEGDRVDRKGALTGGYHDVRRSRLDAVKAAKKWRTAYE
                     TDHARHAEVKAALQNIEQEVTRTMGQVQALEAKKRHMSDGGEGSFKLLTLPARDLDQA
                     RDRVARLEFSLEEAEGASRDAKAKRASYEEELRTPMRQNLTDEELRELETLTQNAEAQ
                     KKLLFEATQNRAKAVGERNRLEIELSENLRRKRQELRGKLDRLEGEAGNGELQSGEVE
                     LRRSELRNLVRDIEQLEEKVSESEGRVGELNSEISKISENLERVQTQQMENTRAIMRV
                     QKNAERYLTKRQTLINRKEECNNAIRDLGVLPEEAFSKYIDQRSDKIIKRLHKVNDGL
                     KKFAHVNKKAFEQYSNFTKQRDELMDRRDELDQSAIKIEELIETLDQRKDEAIERTFK
                     QVSKYFEEVFETLVPLGKGELIMQKKTDGFIEEESEESLEQGREKSDIDSYTGVSIRV
                     SFNSKHDEGQRIQQLSGGQKSLVALALVFAIQKCDPAPFYLFDEIDANLDAQYRTAVA
                     TMIHTLSTSAQFITTTFKSEMLAQADKFYGVFFDKQKVSTIKVIEKEEASDFVETAAQ
                     VGQL"
     gene            797479..799761
                     /locus_tag="CND02940"
                     /db_xref="GeneID:3256924"
     mRNA            join(797479..797626,797674..797753,797807..798419,
                     798470..799225,799312..799761)
                     /locus_tag="CND02940"
                     /product="centromere/microtubule binding protein cbf5,
                     putative"
                     /transcript_id="XM_024657016.1"
                     /db_xref="GeneID:3256924"
     CDS             join(797524..797626,797674..797753,797807..798419,
                     798470..799185)
                     /locus_tag="CND02940"
                     /codon_start=1
                     /product="centromere/microtubule binding protein cbf5,
                     putative"
                     /protein_id="XP_024512653.1"
                     /db_xref="GeneID:3256924"
                     /translation="MAVASSSTLTDSQVSKIQQDSDFSIKSESVTPKLDTSQWPLLLK
                     NYDKLLVRSSHFTPIPSGISPLKRDLQTYVKSGVINLDKPSNPSSHEVVAWLKRILRV
                     EKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVVRFHDKLQDEKALPRAL
                     ETLTGALFQRPPLISAVKRQLRVRTIYESKLIEYDNERNLGVFWVSCEAGTYIRTLCV
                     HLGLLLGVGAHMQELRRVRSGITGENDDIVSMHDVLDAQWLYDNTRDESYLRRVIRPL
                     ESLLVNYKRIVVKDSAVNAICYGAKLMIPGLLRYEADIEVNEEVVLMTTKGEAIAIGI
                     AQMSTVDLASCDHGVVAKVKRCIMNRDLYPRKWGLGPKAQEKKKMIKKGELDKYGKPI
                     EGVTPQQWSSGYIDYNDPDAVPASGSNDLLPTQPPTAEDVKMEPVEVKVEADEKKRKR
                     EEEEVGSPKAEEKKKKKKVKTEDGAEREETAEERAARKAAKKEKKEKKKAKEE"
     gene            complement(799236..801133)
                     /locus_tag="CND02950"
                     /db_xref="GeneID:3257071"
     mRNA            complement(join(799236..799502,799561..799743,
                     799796..800039,800090..800176,800231..800989,
                     801047..801133))
                     /locus_tag="CND02950"
                     /product="aminopeptidase, putative"
                     /transcript_id="XM_570460.2"
                     /db_xref="GeneID:3257071"
     CDS             complement(join(799308..799502,799561..799743,
                     799796..800039,800090..800176,800231..800989,
                     801047..801087))
                     /locus_tag="CND02950"
                     /codon_start=1
                     /product="aminopeptidase, putative"
                     /protein_id="XP_570460.1"
                     /db_xref="GeneID:3257071"
                     /translation="MKASIPPPPKDAVNFCDFVTHAPTPFHAVAHLTTRLFTSGFVPI
                     SERSPTSSLEPGGKYYYTRNQSSLVAFTLPAKPLPETAISFAVGHLDSPCLKVRPVSK
                     KTKSNYLQVGVELYGGGIWHSWFDRDLSLAGRVIVANREAHHSEDPKFVSKLVKIDRP
                     ILRIPTLAIHLDRTANDNFKFNKETEFQPILGLVEDALNATDAGLGMKRSHSGSLHQP
                     LAKKDSHETEKSDDLFNVANMEDKHHPKLLAVLADELGCDIADIQDFELSLFDTQPST
                     IGGLSNEFVYSPRIDNLMTSFCTIEALCEAVKTSNAEDESNIRCVILFDNEEVGSVSH
                     HGAESNLLPAFVERIVQLKDYKDVGYYAMLANSFLISADMGHAMHPNYESRYEPNLAP
                     KINGGIVIKTNANQRYTSNAQTTFLLRRVAKKAGVPVQEFEIRNDSTCGSTVGPHLST
                     HVRTVDIGLAQLSMHSIRETAGSHDVRHYINFFKIFFQGFGEIDRELRIDWH"
     gene            801431..802557
                     /locus_tag="CND02960"
                     /db_xref="GeneID:3257168"
     mRNA            join(801431..801448,801565..801647,801926..801996,
                     802049..802139,802190..802557)
                     /locus_tag="CND02960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570503.1"
                     /db_xref="GeneID:3257168"
     CDS             join(801446..801448,801565..801647,801926..801996,
                     802049..802139,802190..802373)
                     /locus_tag="CND02960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570503.1"
                     /db_xref="GeneID:3257168"
                     /translation="MGRVRTKTVKRSSRILIERFYPRLTLDFHSNKRILDEVATVPSK
                     RLRNKIAGFTTHLMKRIQKGPVRGISFRLQEEERERKDQYVPEVSALASSEESPLEVD
                     AETKDLLKSLGMDDLSVNVINVSANAPRERKTRFIPGAGRA"
     gene            complement(802527..803236)
                     /locus_tag="CND02970"
                     /db_xref="GeneID:3257409"
     mRNA            complement(join(802527..802768,802819..803081,
                     803135..803236))
                     /locus_tag="CND02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_570666.2"
                     /db_xref="GeneID:3257409"
     CDS             complement(join(802733..802768,802819..803081,
                     803135..803141))
                     /locus_tag="CND02970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570666.1"
                     /db_xref="GeneID:3257409"
                     /translation="MPAQQATSTSALPSTSHTAQPVQPSKLAKNPRLPATMVTPSGSI
                     QASQKNKSHKGQISKKKRAKLEKGKEKAAELSGKLEVKVREREDRKAKRQRAKKAWE"
     gene            803396..805737
                     /locus_tag="CND02980"
                     /db_xref="GeneID:3257162"
     mRNA            join(803396..803546,803630..803795,803844..803999,
                     804054..804129,804179..804301,804362..804875,
                     804928..805040,805093..805416,805469..805737)
                     /locus_tag="CND02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_570504.2"
                     /db_xref="GeneID:3257162"
     CDS             join(803432..803546,803630..803795,803844..803999,
                     804054..804129,804179..804301,804362..804875,
                     804928..805040,805093..805416,805469..805702)
                     /locus_tag="CND02980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570504.1"
                     /db_xref="GeneID:3257162"
                     /translation="MLIPLIPLLLYVASAVAATTPKCLVSGNQDSINDALALGGEGTT
                     VTLCPGSVHRLNSSIIFTAPSQTLTTLGNPKDRNRAMLVVDGEDLACAIKADCKQCSH
                     AMIRSLVIDGNRPQLLRIPKGDALIEIGNSESQTVRDCKLYEPRGWSALHFREGDTRQ
                     CRFGHIMDNEIGPCGEEWDDEYDGMDEIRPPWGNPRADGISLACKDSIVERNVVYDAT
                     DGAIVLFGSAGSTVRNNHIYARTRVILGGINLVDYEPWDGDYTNVKVHNNHLYALGRY
                     FKVGIVIGPASWSDDTESVVHSASVTDNEFSGGYWGYGIVVASAKNFEVLRNKVIWDG
                     EQGVAKFSGVPGSRCPKAPENGKPTAFLINRGSAKGTFQDDFINGEVQHIICLNPDQE
                     PPYKPWRFRDSPEAIAAREAENPTANTAFDSRIAEALVSYQMSLLNSMDAITQKVEHL
                     TNPIVDDALPFVHEHERAEADQRARQEARRKEKESGNKDVDMLNVKVEELEKGGRRLK
                     KALDGLKSDFEGLSGRLKKSADENKPIIETIFVSSQNLLLGATSQQNLINRSLDGAYS
                     TLSFVNALGGMAGIVVSIMIARRLRRWWMMRQKTQSNKWS"
     gene            complement(805927..810360)
                     /locus_tag="CND02990"
                     /db_xref="GeneID:3257200"
     mRNA            complement(join(805927..806222,806286..806378,
                     806443..806631,806697..807795,807855..809373,
                     809423..809606,810240..810360))
                     /locus_tag="CND02990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570520.1"
                     /db_xref="GeneID:3257200"
     CDS             complement(join(806099..806222,806286..806378,
                     806443..806631,806697..807795,807855..809373,
                     809423..809446))
                     /locus_tag="CND02990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570520.1"
                     /db_xref="GeneID:3257200"
                     /translation="MSYQWNHNYDTSTSHRDQEPVYQDNDKQNVGYAPMQGQGMLDLM
                     GIPQPMFFPGIQTEFNNGRAPVSATGGYQNNMPPPQYQFRPALALDTTGGYLAPQPQP
                     SSAYSEMPSGLRPDLGSNTDSDLVMPNSYPSAGVQYPPYNSDFMTSLSVNTGMVNPGQ
                     TGRGIEQPQSMLGTYQSTVMSQYGYYPIPHPEMQQTQQPIEPSVQLGTISPSELGQRQ
                     PLKPTKSFSDLMMGSRASSSSSLASQDVPPDGWNGNALEDWTRPLSRALPSSGTPVST
                     SAGSRQLPSAADISSLPDLTKRPSFASSPLRNPSFSPLSPNASDTDSIIKQYIRAPNR
                     LAFGERRIIVMSPKVGQKSYGTEKRFLVPHPQAILIGSGWWAKSPDGCPVSPLQPPRI
                     NISLTGEQAVKDSIISWTDLNGKNMDEKASTQGVKIDDQPFTGSVAGKNLHISDNDPK
                     RKEVKALVTVKAPLNKHAGPNGWGSAKGTLSDVTNDNVFGIFESKDIKIISKPSKKRS
                     TAKSGELTISHGTTVALFNRIKSQTTSTRYLSVVPDFTRTLGSDGRPVTGAKAPQYEN
                     DKGALRGFTADASFWESFIIWLVDPSLPSGPSNHQAPNPDWPRPPANIIPLNTISHSI
                     RYNSTVVLQSLRTGVISPTLVVRRIETDSDAVGMDGHVHEVPAMPPGELASDLVSQLQ
                     KVAFEIYSPDTMNRLQRESKYGGSWLSCYQDEVREHAIKAERKWAVLQAPAGSKPTSR
                     PNSLPNTPQQRFGVLPMTPHTNNMNLPSTPSSPVSSSSSLDYFNYQSQRSSGHNHSLM
                     SPGSVETALPSTDGGPIRRQRTSSMGKGPLSRPLHRKRLSTDSTGSNSYEYMPSLSSA
                     MSSAEQPIQPQRMFWTMDVGDSCVWSIISVEQASYTFFTPPITSFEEFEPVAPFPVAN
                     RLLPANLSAEVPSKYAHHYTTTTNMPLVTLYGKHFVKNVDGRAKHVMYYGDEPARHNE
                     VRCGEVMVASEPEPSIKSDRKRPIFLVREDGKVIIPTSLHYPV"
     gene            complement(810559..815132)
                     /locus_tag="CND03000"
                     /db_xref="GeneID:3257051"
     mRNA            complement(join(810559..810749,810804..810973,
                     811034..811177,811233..811306,811360..811444,
                     811508..811584,811639..811919,811979..812329,
                     812393..812463,812514..814657,814753..815132))
                     /locus_tag="CND03000"
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /transcript_id="XM_024657017.1"
                     /db_xref="GeneID:3257051"
     CDS             complement(join(810668..810749,810804..810973,
                     811034..811177,811233..811306,811360..811444,
                     811508..811584,811639..811919,811979..812329,
                     812393..812463,812514..814487))
                     /locus_tag="CND03000"
                     /codon_start=1
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /protein_id="XP_024512652.1"
                     /db_xref="GeneID:3257051"
                     /translation="MSIPDNPFQPPTDTSPPTLQLEATSHDDGQSIKSGINGSPMPAG
                     SPHSHLSPPSEIASPRPVLSNLQHLGPGVKTPRRVQWTSDPHIVQLQPVEPAPGSPQT
                     LDPSNIDEFRDALERHRSGGAGRRPPSQLSRQSSASGSVTRHGTDDEEDYDYRTDVDP
                     PQRPDIERHDTDETMYESNLIDNGMRGHVSQYIAPGETDGLPNIPQMSRENQNDTAKD
                     LVRAHTGKWGVLRRRVRGAGAVKGALNAAAPNRKRGDDGEEEEKRRSGEHDRASQDAF
                     AARYPEPRKGPSAGGFGGGAVPGGASVLSSLLALYGQQNDQHSANTSAASSRRGSEDE
                     YSSGDERSAAKGGRHAWRHLGRRSADEGLPAFAVHDQPRPSNVQPPRVSQGSLDPNDP
                     TSPTSPGFGPDSGQDHEYSRTQSRYDDTPGSPGFKGFFQRAKEQLQYNRPDAARNAGG
                     VFGALIQNTQNLSGAATPAASTLAPAARRPGYQLNRYSLGDVNDETRKGPWRPPSRPS
                     SGAGSRSGSRPASIHSSTAVSGNGESPKDDSGNSFGGKKAISSDDLMSMRKANESTLS
                     LGGKKRPKTGLHLESLAHLPVAAVKGGGKQIKNAEKWLLGGKTPLGSTPPEKGGADYF
                     HRPLTEDERRRKEWEAEKKKRKKAREARKKQEIFIIQHVAAILSRQQFLLKLARALMM
                     FGSPSHRLETQIQATAKVLEINCQVVYLPGTMLVSFGDDATHTSETKFLKQSTGLDLG
                     KLQATHHLYWNVVHDKMSVDQASKDLDVLMTTPVYYTWWQTLAIGALCSAFISVMAFY
                     GSFIDALMSMVLGATLVGVQMLAARNDMFSNVFEIAIATLISFVAAALASTKVFCYTA
                     LVSGGVVLILPGYIVLSGALELASRNITAGAVRIGYSVIYSLFLGFGISMGAVIYSKI
                     TKHDVLNSNDYTCGNTHYSGSPWYMETPSAWWYFLCAPGFSLGLSLKNQQPLWAKELP
                     VMVIISCAGWTSNHFSALAFPGRSDLTSAIGSFVVGTLGNIYGRFSNGSSFPVTVPGI
                     LIQLPSGLSNGGIFNFATESSSGSSTAYSDGFSVAEQLVAVAIGLTVGLFVSAAVCHP
                     FGGGRRRGAGIFAF"
     gene            816708..817990
                     /locus_tag="CND03010"
                     /db_xref="GeneID:3257429"
     mRNA            join(816708..816889,816951..816998,817052..817095,
                     817165..817271,817376..817447,817505..817586,
                     817648..817990)
                     /locus_tag="CND03010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570194.2"
                     /db_xref="GeneID:3257429"
     CDS             join(816868..816889,816951..816998,817052..817095,
                     817165..817271,817376..817447,817505..817586,
                     817648..817689)
                     /locus_tag="CND03010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570194.1"
                     /db_xref="GeneID:3257429"
                     /translation="MWLSDGQKIGIALVAFGIFFQFLGIILFFDGPFLALGNILFLSG
                     LPLIIGLTKTFYFFSRREKWRGTLCFFGGIILVFAKRPIIGIIIEFVGFIGLFGSFFP
                     VILQALRQTPFIGPILSLPYIRGAADRLAGVRQSAV"
     gene            complement(817838..818910)
                     /locus_tag="CND03015"
                     /db_xref="GeneID:36392826"
     mRNA            complement(join(817838..818679,818813..818910))
                     /locus_tag="CND03015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658482.1"
                     /db_xref="GeneID:36392826"
     CDS             complement(join(818128..818679,818813..818896))
                     /locus_tag="CND03015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514336.1"
                     /db_xref="GeneID:36392826"
                     /translation="MASIEDLIATISGGLHAGQQGNDIRDLHAKLAQTINNPLPPPVH
                     RPIPPCTTTSVSAAGMPPPAPASSWNTPPPNAGFLFSTSPISKINGAGPSAGGVSGGG
                     GGSAGGDFEVAHHVHEGWSVPMPNMGTSFTGRPIQPIVPNSNQQREEGQWRQRNQGFT
                     GDEPEERPYHASVLPIKASPKDTGGFAEDAFKPLWEDQGKDQWQGFNRQNR"
     gene            complement(819090..820665)
                     /locus_tag="CND03020"
                     /db_xref="GeneID:3256919"
     mRNA            complement(join(819090..819413,819487..819849,
                     819906..820116,820173..820665))
                     /locus_tag="CND03020"
                     /product="3-keto sterol reductase, putative"
                     /transcript_id="XM_570518.2"
                     /db_xref="GeneID:3256919"
     CDS             complement(join(819135..819413,819487..819849,
                     819906..820116,820173..820636))
                     /locus_tag="CND03020"
                     /codon_start=1
                     /product="3-keto sterol reductase, putative"
                     /protein_id="XP_570518.2"
                     /db_xref="GeneID:3256919"
                     /translation="MRRTPSSQPDHDPHRVIALVTGANSGYGLGICHQLLSNLSLPST
                     VPIPASTPQPTALAPSMRDSIPSNSLRPTKTSVPDTTLTLILACRSGAKAQEAIDMLW
                     KKHKSDLEKRKKKGLAVKKGWLEGLRIVWEGVNLDSPGGTNGILAFTERVKNRYPHIT
                     CLFLNAGMGAFSGIDYCKFTKQIFTDGMSVALSQPQFNIEIKGAKSADGERGLVWGTN
                     VLAPYIMARELLPMLRRSPPELPFAPRVVYTSSGTATLSKLNNHPLDDYMLLDYDESY
                     GASKYMGDMVMLQLDREFNDETTKRDDDRGVRVLTIEPGCVATNFFNAGLGAWAWWIK
                     FKWFWYWLSFYICRLLGSPYHPVYADQGALPMLYAALIPAAFLLSPSQVPAQKFEVRA
                     QRWGNTKVGYGEIDRWEEADALGLPKGFADRCEVVRREWRRREGLE"
     gene            820791..822521
                     /locus_tag="CND03025"
                     /db_xref="GeneID:36392827"
     mRNA            join(820791..821948,822001..822232,822284..822521)
                     /locus_tag="CND03025"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658483.1"
                     /db_xref="GeneID:36392827"
     CDS             join(820827..821948,822001..822232,822284..822417)
                     /locus_tag="CND03025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514337.1"
                     /db_xref="GeneID:36392827"
                     /translation="MNTLSRIDSYFSAIASPPTSHPPRTPPRRPRQTISSISVPPPTA
                     PLILRIALVLWSILLTVWRSFVGETRATRRRGRRSRRKRLTGLRELGERVMITAGIAS
                     LDTPHEHTEGDEGSEDDKEDGWVDPVTRGPEGSASLEEAPPGEDEFVSATTAATGTGA
                     AEVEEEPEPDETTVAAKDDRLGGPDPNFTFRLRSAPKKELDGTETAVPSPGHKPIPSF
                     QRPPSPTSILNNPITPPPPPPKTAEPSPKRPSGTRLLANPISTSLLDPSVPAPASNAD
                     SSLFRKPSPRPLRQPTTPFHLQKTLILDLDETLIHSTSRPIHYPGGSSGGGGLLGLSV
                     GGVFGSGRANEGHTVEVVVNGRSTMYHVYKRPYVDHFLKKVASWYTLVIFTASMPEYA
                     DPVIDWLDGGRNLFARKLYRENCHVQPNGSYIKDLTLVEKDLSRVCFMDNSPVSYSWN
                     KANALPIEGWTSDPNDEALLHSIPVLDSLRFVNDVRRVLGIRGFS"
     gene            822612..825109
                     /locus_tag="CND03030"
                     /db_xref="GeneID:3257039"
     mRNA            join(822612..823316,823375..825109)
                     /locus_tag="CND03030"
                     /product="nuclear envelope-endoplasmic reticulum network
                     protein, putative"
                     /transcript_id="XM_570505.2"
                     /db_xref="GeneID:3257039"
     CDS             join(822849..823316,823375..825012)
                     /locus_tag="CND03030"
                     /codon_start=1
                     /product="nuclear envelope-endoplasmic reticulum network
                     protein, putative"
                     /protein_id="XP_570505.2"
                     /db_xref="GeneID:3257039"
                     /translation="MSPQEAADYVDRRRERLLLQQARAIDGLPGVVAEERLETVDEKK
                     VLRPFHPVLHNIPAAGPSQPEKRSTVTGPEHVAAPVAEAAAEPSVKHQREQVAGKSEP
                     GLAVSGKAKALSPAVTPSSSQAASSSKMDDLIEIMTEGAAAAAQKKGGAEKDETVFNE
                     EGLPFHEIRETLNGETIGSLPPPAAADLNADMEVLPKDEKDDYWSEDAVARRAALRKK
                     IFHEGEESDDEESIEQIQQQPQVPDSSLPSSPPSPKAELHLHSILRHHAPSSQQPKSI
                     LKPPIRKKSVTFDPSIPPASPDSSDIAPSSIKPHKFGFPLPLATDDDQAWAPKPVPTI
                     SEPKPKAKKDDGFAGFKKGFLGPPPKVLTAENAQPSFSSPPHPTAISEQGPPSESAQE
                     AFKPKKKSLFAQRLAHSEIDASAPATSSGTPATASPRGVNLPKMAESKGTSAIKGAVV
                     EKSATMTPATNPSSSHAEVPDTERTDDDNGDDSFAEYSSGSEDEYDLDDALLAREVAL
                     EYHRRHAYTSLNRDPRDAPYEEDDNGNGAGVMLGLPRISDLQGQDGRPVITNPTPDDL
                     RRFIRVGRLENGNLVLAPGQEGLSDSEGDGEEGKEGEDDDEEVKEKKERRLEVKKRRE
                     QVRNRLLGLPVEEGDLEPERKRDSVDDESLKATIPPAIQTEVAERHAQIDTSAESEET
                     PVPKKKVSRFKAARLAGAQ"
     gene            complement(825074..826489)
                     /locus_tag="CND03040"
                     /db_xref="GeneID:3256969"
     mRNA            complement(join(825074..825264,825324..825872,
                     825922..826048,826116..826223,826282..826353,
                     826413..826489))
                     /locus_tag="CND03040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570517.2"
                     /db_xref="GeneID:3256969"
     CDS             complement(join(825131..825264,825324..825872,
                     825922..826048,826116..826223,826282..826353,
                     826413..826475))
                     /locus_tag="CND03040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570517.1"
                     /db_xref="GeneID:3256969"
                     /translation="MPSSLDNTRRHVQVFAERVGAVAGSEFPGHYPGEDHSWNLQKFK
                     QDLVASVQRLTPSTIEFDLVGVDASIANALRRTLIAEVPTVAIEEVYVWNNTSIMQDE
                     VLCHRVGLVPLKIDPRSLRYRPSANSQPHEHDTVVFDLRVRCDRRPNVDRSETDPKKM
                     YFDSNVYSGMLKWVPSGDQKKKFKGKAPRPVNDDILLVKLRPGQQVDLHCFARKGVGA
                     DHAKFSPVATASYRLLPHIILRGPIPKEHQQKFKGCFPPGVIEIEKDENGEDQCVVKN
                     PRKDTVSREVLRHPEFQDLVQLARIRDHFIFNVESAGQYSPEELVPEAIKILLGKIKD
                     VEEGLDKLFATEGQAA"
     gene            826770..829201
                     /locus_tag="CND03050"
                     /db_xref="GeneID:3256989"
     mRNA            join(826770..827096,827161..827363,827417..827801,
                     827860..828021,828080..828188,828245..828327,
                     828378..828604,828671..828804,828854..829006,
                     829049..829201)
                     /locus_tag="CND03050"
                     /product="expressed protein"
                     /transcript_id="XM_570506.1"
                     /db_xref="GeneID:3256989"
     CDS             join(826792..827096,827161..827363,827417..827801,
                     827860..828021,828080..828188,828245..828327,
                     828378..828604,828671..828804,828854..829006,
                     829049..829114)
                     /locus_tag="CND03050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570506.1"
                     /db_xref="GeneID:3256989"
                     /translation="MSPTSPQPPHSPTTPPSPSASPTHSILRRTASLSAPSHPHKKML
                     RFTQLHRDSDTLLSSVGQNEDVYYHGRTMEEGLYTDRVTTDQRRYLQSDPGTPNFQET
                     ADQIRRTLSLASVDSLLLLSANQSERTKFLAEVSRAGRGLVWRDEGEQCLLPQDNERA
                     VVLALKRGLRSFILAFSVRSGINVLLLLFRLLRKHAPKLSLPLLHRTIFGPEPFRFGG
                     MIGTFTFLYTFTLHLLRLAPPLSYFRRRIRAGLWNKTTFGPPEREGNEGERRWQAAAA
                     GAVGSLGLLWESKSRRTGVAQQMFVRGLQASYNQYTPRFGIHIPHGDLLLFGACCGQI
                     MFAFLMSPETIPKEYNNWINSASRVPSFAILANRTQVRQGYIQDALVQEALNYKGITA
                     TNRIRLENVLRKIRDGQQPVAVPCGMVHPWCNTCTETNFRRFFAVCRFMLPVYSALHL
                     IPMLVLRRHHVKRDPIRMMARALWGIGRSCSFLGAFVVIYQVLFCARVQALEKSRGPD
                     FMRSLLKRKEVFWALGFTTCLSLLVEEKKRRAEIAMYVLPRALESAWSGARKRAWVPL
                     VPFGETILGAGAMAMVMDAYKHQPDAMSGIVRRLLFQMVGPA"
     gene            complement(829169..829932)
                     /locus_tag="CND03060"
                     /db_xref="GeneID:3257091"
     mRNA            complement(join(829169..829298,829357..829535,
                     829590..829824,829877..829932))
                     /locus_tag="CND03060"
                     /product="ribosomal chaperone, putative"
                     /transcript_id="XM_570192.1"
                     /db_xref="GeneID:3257091"
     CDS             complement(join(829253..829298,829357..829535,
                     829590..829824,829877..829896))
                     /locus_tag="CND03060"
                     /codon_start=1
                     /product="ribosomal chaperone, putative"
                     /protein_id="XP_570192.1"
                     /db_xref="GeneID:3257091"
                     /translation="MQIFVKTLPGKTLARDVLPTSTVSSVKEMIASAEGIPASEQRLI
                     FAGVQMDDERALAEYGIQKESTINMVMSLCGGGKKRKKKNYTTPKKIKHKRKKVKMAI
                     LKYYKVGSDGKIQRLRRECPAPTCGAGIFMAWHKDRQACGKCGLTYTFEPGTKPTTA"
     gene            830137..831868
                     /locus_tag="CND03070"
                     /db_xref="GeneID:3256996"
     mRNA            join(830137..831118,831176..831354,831409..831868)
                     /locus_tag="CND03070"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570190.2"
                     /db_xref="GeneID:3256996"
     CDS             join(830250..831118,831176..831354,831409..831458)
                     /locus_tag="CND03070"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570190.1"
                     /db_xref="GeneID:3256996"
                     /translation="MADSSPADNLSPKAVQEQLPSPDAHGAEHQLSLRSLVSTKEAGI
                     IIGKSGATIATIRDSTGVKAGVSKVVQGVQDRVLSVTGDLEGVASAYAEVARLLLETP
                     LSDSSLPPPPVGSFTSIRLLISHNLMGTVIGRSGLKIKQIQDMSGARMVASKEMLPQS
                     TERVVEVQGSVDAIKTAVLEIGKCLLEDWDRGAGTVLYHPGAAGDAGVLAGGLGAQAV
                     TGSTGGIRRTSVAAGFGGYSGDRRPSRGGSISGPSGVSGERRPSEGPQVNLNDPNLRT
                     QNISIPSDMVGCIIGRGGSKITEIRRLSGSRISIAKVPHDETGERMFTIQGTPEATER
                     ALMLLYSQLESEKERRVNGSNSEVPASADFA"
     gene            complement(833160..835667)
                     /locus_tag="CND03080"
                     /db_xref="GeneID:3257445"
     mRNA            complement(join(833160..834396,834462..834623,
                     834673..834765,834817..834877,834924..834975,
                     835026..835072,835132..835292,835348..835433,
                     835495..835527,835577..835667))
                     /locus_tag="CND03080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570188.2"
                     /db_xref="GeneID:3257445"
     CDS             complement(join(833280..834396,834462..834623,
                     834673..834765,834817..834877,834924..834975,
                     835026..835072,835132..835292,835348..835433,
                     835495..835527,835577..835600))
                     /locus_tag="CND03080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570188.1"
                     /db_xref="GeneID:3257445"
                     /translation="MQRRALKQLNKVTQWTSEKVFSGEKTQLSSDFLEFEKEIEIRRI
                     GIERLHATSLPFYEQLAKVKSTADPYPPPGSGKDKISYTEALGLVMIDYGDEIGDDYG
                     DALSKYGRARCRLASAQEEFASRLGDSYIAGMESGLAAVNEYKSLRKKLDSRRLALDA
                     AISKSQNSKKDTGVLEEEVSIARIRFEEIEEETHSRMVNIQEAEDEQYALLTDLLEAE
                     VDYHNKCKEILEDLRNSWGTHSSRKPLNTRARSSTVTSSRSLGRTVISRSHSSKHNAV
                     PSSEDDAPSSRSRSQSNASSSGKSKDKRSMIPSLGSFGRKSGLSTVTSSKKKEKREKY
                     SESRTALHSEEEDEDEGLRWPAPTDRSQSQLSSSVTSYKSSRYDPPPSLRRTVTSPPT
                     PAARYPDPNGRYVKALYDYQANASDELSLRVGMVVKVQTQVNDDWWIGEGEIEGEFGL
                     FPRGYTEEYIPSPRAAVPFVPSLPTRRNVPPPVGQPTTATRLPPSPNLSLNSDFSESD
                     NGFYDGDNNFTASLAASPQPTATRLAASGKKMPPAPPASRRAASSSNILDLSRDMSDS
                     HLSPPIIPYGRARSGTTGTVRGSSHEASPFGGSEDDETDDIRRGY"
     gene            835930..838224
                     /locus_tag="CND03090"
                     /db_xref="GeneID:3257390"
     mRNA            join(835930..836327,836374..836580,836630..836790,
                     836842..836878,836929..837299,837353..837521,
                     837573..837784,837851..838224)
                     /locus_tag="CND03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_570186.2"
                     /db_xref="GeneID:3257390"
     CDS             join(836051..836327,836374..836580,836630..836790,
                     836842..836878,836929..837299,837353..837521,
                     837573..837784,837851..837985)
                     /locus_tag="CND03090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570186.1"
                     /db_xref="GeneID:3257390"
                     /translation="MTSPRSLPFRLQPPQEPGHIHDCAIMDSPVPESPTARKNKDLSY
                     LIISGGTGANSIAGAFGRSPSFVLPVSDDGGSSSEILRCFGGPSIGDIRSRLIRLIPV
                     VRHPVTKEDKERAAIYQLMAYRFPSDAAEKVVRDMWMDIVEGKSHLWSGIGEDKKECI
                     RAFFVHFETQCLKRAHKRFSFRNFSLGNGFLTGARDLFGSLPSAIFLFKSIAGVEHGA
                     QVIPVINTNQTVTIAAQLANSTTLVGQCAISHPRPSASQDSSMSTPLHGLSSATLPSI
                     HPFLRIHFRRDSRTFDTPDESAPPTRSHSSDRLEATTSGAEGHDGEGNLAYRKGEDEA
                     PLEAKIERIFYINLYGQEIYPEPNTDYINAIQNRDILVYSCGSLWTSIVPCLALKGLA
                     EQIARSQTLKAKVLLLNSSNDRETTGYAASEYVATILAMLRHYDKPKRNRTREQLLPG
                     PEWKAANLISHVVWLEGAKIEIDEDQILESGVKMVCVPASVHGAQHGEIPLFSNEAVE
                     WAMERVLEDVNHNA"
     gene            complement(837943..839622)
                     /locus_tag="CND03100"
                     /db_xref="GeneID:3257451"
     mRNA            complement(join(837943..838896,838947..839102,
                     839159..839622))
                     /locus_tag="CND03100"
                     /product="adenyl-nucleotide exchange factor, putative"
                     /transcript_id="XM_570680.2"
                     /db_xref="GeneID:3257451"
     CDS             complement(join(838297..838896,838947..839102,
                     839159..839542))
                     /locus_tag="CND03100"
                     /codon_start=1
                     /product="adenyl-nucleotide exchange factor, putative"
                     /protein_id="XP_570680.1"
                     /db_xref="GeneID:3257451"
                     /translation="MPDINELLRWSIANSTAPDTDASEQLQIRFNPNSTQSGTSTLHA
                     SDSGPPDISPASTPGPVTPDDGSSLPLPPGTEVPVTKKEDLTTEMLDLILGKGDSITM
                     KEKMAFATDENNSVEDRVEALDDFEMLIELIDNANNMPILKLWDPLLTLLSSSHPEIV
                     AHTCWIIGTAIQNNIKAQAAFYIHETFSRILEIIYPPSSISSYPPSVRAKATYALSAA
                     LKHWPLASYALYTATSSAENGYSVLRRGVNDPQAIVRRKMAFLVGTLAMQSGERYEGE
                     IPSEVRNYIEENEKNAPSESLVEGLKREGVFTALVDGLKQGVDDVEYEENAMRALVRA
                     HQKGGLTVSEKSDLKTIWEKWGKQGRQERGLDGEDGKEVSETLSS"
     gene            complement(839737..842769)
                     /locus_tag="CND03110"
                     /db_xref="GeneID:3256849"
     mRNA            complement(join(839737..840755,840805..840857,
                     840908..840999,841061..841473,841529..841776,
                     841831..842022,842079..842195,842252..842769))
                     /locus_tag="CND03110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657018.1"
                     /db_xref="GeneID:3256849"
     CDS             complement(join(839932..840755,840805..840857,
                     840908..840999,841061..841473,841529..841776,
                     841831..842022,842079..842195,842252..842589))
                     /locus_tag="CND03110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512650.1"
                     /db_xref="GeneID:3256849"
                     /translation="MLAESEVPQLSKWALPSAFLGLLDLPPGQAIDQLIPTRSQPPFT
                     QSAEVPGTSSHPFIEALKNIPDTLTEKGALAHKTTDSPLVDLFFDLAPGIASDRLYKL
                     LEAAWTEDSLATLKIIFHSRSIHEGKGYKDGFYRALAWLWDEHPRTFIENLHLIVDHT
                     CPPPISEKKVSRKRQKREKQQLKEGDILELDDEGNIDLGEEIPNQYSSRPHGTFNDLL
                     DLLILHINNQLSTSFSGKLTAVDETLAPNISADLFKQSRIQGRTTSKRDRQGFFKIIV
                     EAKKREKKDADDFQAKLWKAPTLSDKHHLLSSRLQDALTNDKKFQALYITVLRIFHRY
                     LEEDLKLLVKYNEQDCLGGDHVIVAPHISNMSFAAKWAPTPGKSADKQLHIATALAIL
                     FYPGDDVSWARQKLQKEVLTPLRKALAIPEVAMSNRSWKFDYNRVPSRSMARNAEAFM
                     AHDQQGFTAYLDRVSQGLATVSGASLMPHELLYNAIRGKSPVAKRLADLQWSTLVDSI
                     RSSSSDDISNCIAIADVSGSMGSLDQGSPQNPPPLLPCIALTLLLSELASPPWQGRFF
                     TFSTDPACEYIDPDLPLAERASQLSKAHWGMSTEFYKTYELILTTAKKNELAPEYMVK
                     KLFVFSDMQFDQAVKGKYGETEHETMKRRFEEAGYPLPEMVYWNLASRAEGTPKPTKS
                     DVEGVTLFSGFSGALMKFFLGDGLADDALERQFEDIEISKEGESCVSEKERKKPNPLE
                     QVHRAIGGQHFAGLKVVD"
     gene            843084..844348
                     /locus_tag="CND03120"
                     /db_xref="GeneID:3257407"
     mRNA            join(843084..843181,843243..843375,843436..843672,
                     843725..844348)
                     /locus_tag="CND03120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570184.2"
                     /db_xref="GeneID:3257407"
     CDS             join(843162..843181,843243..843375,843436..843672,
                     843725..844288)
                     /locus_tag="CND03120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570184.1"
                     /db_xref="GeneID:3257407"
                     /translation="MSMLRTIKPKNARVKRALEKREPQIVENDKTAIFVRGQNSSDKV
                     RNVMKDLYSLKRPHAINFSRKNDIHPFDDASSLEFFAGKNDASLFVTGLHSKKRPHNL
                     VFSRMFDGRVLDQIELGVEGFKAMSEFPTLKSSLGVKPMMVFHSDLFDTHPTYQQLKS
                     QLLDLYNGHPITEAPLLTTLEHVISITAGPVSDTTPLPQVHFRVYTVKLIPSGTRVPR
                     IQLTEMGPSIDFVVRRLQEPDEEMMKAALKRPKIAKSDVEKGLGKKRKNIETDEMGDK
                     VGRIHIGKQDLAKMQGRKMKGLKVRDGKKRKTSGADGMDED"
     gene            844532..845888
                     /locus_tag="CND03130"
                     /db_xref="GeneID:3257318"
     mRNA            join(844532..844676,844734..845434,845489..845707,
                     845761..845888)
                     /locus_tag="CND03130"
                     /product="peroxin19 Pex19p, putative"
                     /transcript_id="XM_024657019.1"
                     /db_xref="GeneID:3257318"
     CDS             join(844595..844676,844734..845434,845489..845707,
                     845761..845805)
                     /locus_tag="CND03130"
                     /codon_start=1
                     /product="peroxin19 Pex19p, putative"
                     /protein_id="XP_024512649.1"
                     /db_xref="GeneID:3257318"
                     /translation="MDESSKHQYRDPQVDEEEEEEDLSDLDNVLESFQNSRPSASTLQ
                     RDASLPSATQPRPSTPPPGEDDEDFEASLMQGMESLLRQLAGDHPPGVMPDIGGDGSS
                     KPTDPRMGSSGSVEPSPLSKEAEEAAWQNAVDTLLSGEGLAALGLDEGKSSRSKEKAS
                     SEHSLNGTAPKPSYEDTLRKTLESLKSAGRNSGARSSAAKDGQNDIASLFASLGGDPD
                     LLKGMNLGEEGGEEDFEGILEGMMTQLMTKEVLEEPMSELAVKYPPYLKSPPPDTSPE
                     DIAKYHQQYTLVTQIVETFKKPGYTDEKDGKDIARLVSEMQDLGGPPKEVMGDLPEGF
                     DLGILGNEDGCTIM"
     gene            complement(845813..851707)
                     /locus_tag="CND03140"
                     /db_xref="GeneID:3257411"
     mRNA            complement(join(845813..846153,846206..846427,
                     846485..846613,846663..847462,847517..849250,
                     849302..849354,849402..849871,849921..850758,
                     850809..851179,851236..851395,851450..851707))
                     /locus_tag="CND03140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570516.2"
                     /db_xref="GeneID:3257411"
     CDS             complement(join(845932..846153,846206..846427,
                     846485..846613,846663..847462,847517..849250,
                     849302..849354,849402..849871,849921..850758,
                     850809..851179,851236..851395,851450..851634))
                     /locus_tag="CND03140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570516.1"
                     /db_xref="GeneID:3257411"
                     /translation="MDISHSIHSEVSSLSFSFLSADDIKAISVKKVDNPILLDNLNLP
                     TRGGLYDPKLGPMGSRDLCETCHLSYFACPGHFGHIELPTPVYHPLFMNQCYHLLRGV
                     CLYCHHFKMPEIVATSYVARLRLLDAGLLTESHEVAALFDNAIGKSSRHRDTDEDEDA
                     EGDVDMDAPAPQTIESAAEFMVRIEAYVYHHLKLAKQNAGGSDSKVEDGYKDGLVFEE
                     RKKLLHEFGKKIWNRCTRCTAYGNTFRKEKAIKIIEYDLTPKQKLANKLSNLRRPDVL
                     AASGKYSSKQRRSEGDIDEGIEMDSDKSSVSEGEGESLDEEEEEEQDVGQTVAKTASG
                     QVKGTRGRHERVMSPAEVRAHLRLLFDKEPRICRLIYGRHGNPAALSSVAPPPLADMF
                     FMEVVPVTPTRFRPAARMGDELFENSQNSLLTAVLSTCQRIQKLNQDLINQAKAERGE
                     HVLDAVAKAQGGRTFELLLEALIKLQHDVNSFVDSTKNPAVMRQGKLPPPGVKQLLEK
                     KEGLFRKHMMGKRVNYAARSVISPDINIETNEIGIPPVFAKKLTYPEPVTQQNVAELR
                     QLVINGPKIHPGAALVQNEDGTQISLDKLTLDQRISLANQLLTPQGSEDNIGAASIGP
                     AAKNKKVYRHIRDGDIVILNRQPTLHKPSMMCHRVKVLLGEKTIRMHYANCNSYNADF
                     DGDEMNIHFPQNEVARAEAQMIANTDNQYLVPTSGGPLRGLIQDHVVAGVWMCNKSSF
                     FTREQYFQLIYGALRTENNYTGRSRIITLPPAIFKPKPLWTGKQIMSTILTNLTPSNA
                     KGLNLTSRNKVQNKLWRRDDSSDPAMSEENVIFLDGHLVCGVLDKSQYGASGYGLVHS
                     VHELYGPYIANRLLGVLSRLLTKYLQHDAFSCRMDDLILTAEGEKIRKDILDKASGDG
                     AIAAMKYVGLPEGSKIEDPDTAKNLAIRLEEILRDDHLMAGLDAVMQSAFNKTTSKIN
                     NDVLPDHLVRPFPDNNMQMMTISGAKGSKVNASQISTLLGQQALEGRRVPTMVSGKTL
                     PSFKAFDTSARAGGYVANRFLTGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLI
                     KHLEGVKVHYDHTVRDSDSSVLQFLYGEDSLDVTKQTHLNKFDFAAANHLSLLNKVRP
                     GDIAGKVSDEALSHMKKALKKPHKHVPALSEYSPSRYIGSMSEAYAKKLNNYIEDNKL
                     GYITKKGESKASPYTSERVPEKEFLGLARARYMRSLVEPGEAVGLLASQGVGEPSTQM
                     TLNTFHLAGHGAANVTLGIPRLREIVMTASSKPTTPTMKLPLREHISDKDIETFVKQV
                     SRLTLSEVVERVTVTERLSSKSSESDSRQRKYTVLLEFYPPEEYGTEYEITSEQLHES
                     LAWHFAPRLKKEIQNEIRRVAKTKEQEAQVGKGRKVRVGGDEGDEEEVDREPDVRRRG
                     RDDELDNDDEDSYQLKRAAQAKQHEYEADSDADSGVADLEDFVEKELEEDDEEDVEDD
                     AAEKAKKDQKADDWAELFKLASKYATTFSFDGHSGKSAQFDLEFPASAPKLLLVDIIE
                     RTCRASVVHEIENIGRCMKIFSDKGEFTRSLITEGSNLRGMWALADELVDLDRLSSND
                     IYAILQTFGVEAARRAIIDEVSSVFGAYGIAVDYRHLTIIADYMTHAGGFRPFNRTGI
                     SAKSSPLLKASFETTVAFLSEATLHGDFDDLTSPAAKIVMGKPSASGTGAFDIRAPTR
                     L"
     gene            851849..852921
                     /locus_tag="CND03150"
                     /db_xref="GeneID:3257244"
     mRNA            join(851849..851982,852042..852151,852218..852378,
                     852433..852609,852663..852921)
                     /locus_tag="CND03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_570182.2"
                     /db_xref="GeneID:3257244"
     CDS             join(851911..851982,852042..852151,852218..852378,
                     852433..852609,852663..852817)
                     /locus_tag="CND03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570182.1"
                     /db_xref="GeneID:3257244"
                     /translation="MVRSTTIFRVHDALPLAASVDDESTEKALTEYKQQSKLIFRRLN
                     ANSEPACSIESGAYTLHYLIVDKVIYMCICDNSYPRKLAFSYLDELSKEFQRSYGDKI
                     DGATRPYAFMGFDTFIGKTTRLYRDSRSLTQGGGPAAPNSRLDQLNENLKDVTQIMTK
                     NMEDLLWRGDSLDRMSQLSTSLRSESAKYRKAARNINLEALIRKWAPIGGIAFFIILF
                     IWWRFF"
     gene            complement(852467..854722)
                     /locus_tag="CND03160"
                     /db_xref="GeneID:3257207"
     mRNA            complement(join(852467..852823,852877..853986,
                     854048..854126,854174..854310,854375..854445,
                     854504..854536,854609..854722))
                     /locus_tag="CND03160"
                     /product="long-chain fatty acid transporter, putative"
                     /transcript_id="XM_024657020.1"
                     /db_xref="GeneID:3257207"
     CDS             complement(join(852959..853986,854048..854126,
                     854174..854310,854375..854445,854504..854536,
                     854609..854637))
                     /locus_tag="CND03160"
                     /codon_start=1
                     /product="long-chain fatty acid transporter, putative"
                     /protein_id="XP_024512746.1"
                     /db_xref="GeneID:3257207"
                     /translation="MDSATAGLDAQFNRAVDIVQSLPKGGTIQTTYEDKLWLYSLYKQ
                     AIEGDVAVPRPGMLDLLGKAKWDAWNRQKGIDKPQAKRLYVSALVKILRKCADAKDVQ
                     RYLQILEHESGYEYPLHIPSCPASPASSASSYHSSQASPALLPQSSNSPIVPPHDISP
                     LTPSLPPPDDAPNFIPPSSHHSRNPPSLSSMQEQRNEVLDAVGRTGRDGNMRDQRPSS
                     AQNLTSESQIHAAMPLDRITGIEREAVSGKSGSVHSPRRQRRDSQASARLASPLPHPT
                     VGSRDFLGTPETISSPFLGLNQPTPMYSRRPGSTSTFSNSQATNIPYTLQQIQTSLTA
                     LHERLSTLERTQALILRRDERRKSWFSWEGHESEELDNCENDQAKEMWGRTGVTTVTK
                     VNAKKKSISMRVLWFLVKTLRRALMDVGIGMMVTLIVIMVLNGGWGRARWMILKYKER
                     LRRFLTEQ"
     gene            854869..856070
                     /locus_tag="CND03165"
                     /db_xref="GeneID:36392828"
     mRNA            join(854869..855387,855454..856070)
                     /locus_tag="CND03165"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658484.1"
                     /db_xref="GeneID:36392828"
     CDS             join(855101..855387,855454..855988)
                     /locus_tag="CND03165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514338.1"
                     /db_xref="GeneID:36392828"
                     /translation="MITPEDNISTELELISASLLPAESLHCLSATGLYPQEFDITNSD
                     SGRSMHVEIHEDYPKKGSVKVEMKGNSMGRDEALGLKKWVDEKMLDWDDAQEYPLYQI
                     LTTQFLSLLTPSAMSPSLSPSTPSETITSSIPYHALLVSHHLLSTTKRKNIVSLSSTL
                     SLIGFSKIGHPGVMYAIGDEADLMEWIREIKSWNWLALRVKMGPEPIPEEKEQEAERR
                     GREEGARGGRGRGEWVEVEKVGDALSWLRERGGEKRARILTDVGVGGGTRPKEGT"
     gene            856073..860089
                     /locus_tag="CND03170"
                     /db_xref="GeneID:3257113"
     mRNA            join(856073..856300,856345..856609,856657..856858,
                     856901..857063,857107..857344,857397..857552,
                     857593..857925,857967..858121,858182..859546,
                     859598..859756,859819..860089)
                     /locus_tag="CND03170"
                     /product="expressed protein"
                     /transcript_id="XM_024657021.1"
                     /db_xref="GeneID:3257113"
     CDS             join(856172..856300,856345..856609,856657..856858,
                     856901..857063,857107..857344,857397..857552,
                     857593..857925,857967..858121,858182..859546,
                     859598..859756,859819..859878)
                     /locus_tag="CND03170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512648.1"
                     /db_xref="GeneID:3257113"
                     /translation="MPSTDIQLTPPEIRQSIYHRAIIDLRHTVGVEYVAWMEDTAARV
                     FDQFALLDTTIFPETFGPRDEDPFIRFGEWLNASSQNKYHVHDHFETRKQSLEADKRM
                     KDRLRQEVVSRHKEARAKGPAERMTLRAVDQPFPSYLHSQDVLMTATAMRETPSFDQG
                     GNVGPKEYADLGEEGAFRFLVNLKNPMPKERKIEEADALHLHLNFAKKDLKKAADMVR
                     TLEYKLQNPLRGADGTSLQSAIWDKWEKDTKAKFQHLPEPLSPKLFPRCLTNPGPNQL
                     HTFKDIEQLVAPTDASGLKLPIPTGAITQGSNRGWAMEDSNDFVEEALSLKNLDDFDG
                     VPFPPLTPNSVNKYSRIRASVSQRYNQLPMSPPATVERKSKMPWDQDPRLELPFMPAR
                     VNSPYMNSGSINDLFTPVENPSPPTQVRSFEVRSEAAVQSCSFKDDDEDVDRPFEARI
                     FYDLLANEDTQVRMNGNGSHGKAEEEALAYAMEEQLDTSKTSHMRVLNIKYEAYGDPS
                     NDLPKSFCELLESSRNKGLEADKQMFIKYPGLNTALASELHWSPFSTTNDAALIENGA
                     KVPPMGNDLPQSLTFPPADLLPQTIPHPSETSLRKLVERSPKSMTPARPRWLTIQDVD
                     KLQEPAGDVKSGESLLAPSLALTSTPRKKRKEVPQRDPDEVDELFEDGSNLPQKPTAA
                     NDSPEKAMRVNLRKKTKMKDVLQSNNQEATLNDIIDIITSRGGTRGQAVIRNIQGTSS
                     TLLDAIPRDDKYDLSTIKGFLHLQKLDHLLTEEQEPTYKFPSNQSLSPIFEEKEPMDW
                     RLDPLLTNPEWFIQTSAAQTQSFETPMPIMAAVSLFQNRPLIRMLESRGFCLLDSFPS
                     LQGADLVISPTIALVFRPLSSLPDIHVGLLEELKLVATYYQRVILVFETISYAASERY
                     AVASNNFNPLGTAVIHALGSLSRGKKAAWSMNDIIGELDIVFAYKGAGEIADSVSKVL
                     REDEERLRENMGEEGYLQYKGREWIGHEPIVEHENTMVEMFGINTFGARYALAAYGGA
                     ERLAYEMTEDERMEQLGPIWGQITTARFNDILREMLDGSKDVDF"
     gene            complement(859598..861775)
                     /locus_tag="CND03180"
                     /db_xref="GeneID:3257035"
     mRNA            complement(join(859598..860675,860752..860998,
                     861052..861263,861319..861775))
                     /locus_tag="CND03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657022.1"
                     /db_xref="GeneID:3257035"
     CDS             complement(join(860886..860998,861052..861263,
                     861319..861320))
                     /locus_tag="CND03180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512647.1"
                     /db_xref="GeneID:3257035"
                     /translation="MSPRYYTVDDSQWSTPALSLSPGWNMLRVNGSDEYINQTEVDSM
                     RPLLEIFWNNSISWTTTLGSWTSIYFNGTSISAFGLAGPNQGKFTAVLDGEAMGSYTA
                     QQDNVD"
     gene            complement(861828..867448)
                     /locus_tag="CND03190"
                     /db_xref="GeneID:3257252"
     mRNA            complement(join(861828..862276,862331..862630,
                     862684..862730,862785..862819,862871..863191,
                     863250..863676,863737..863854,863908..864067,
                     864124..865395,865448..865924,865985..867021,
                     867095..867448))
                     /locus_tag="CND03190"
                     /product="membrane protein, putative"
                     /transcript_id="XM_570514.2"
                     /db_xref="GeneID:3257252"
     CDS             complement(join(861999..862276,862331..862630,
                     862684..862730,862785..862819,862871..863191,
                     863250..863676,863737..863854,863908..864067,
                     864124..865395,865448..865924,865985..867021,
                     867095..867401))
                     /locus_tag="CND03190"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_570514.1"
                     /db_xref="GeneID:3257252"
                     /translation="MTSPPTPPPIPDNIPSAISVSRPTAVGPQRPLRIPDQERNTIPP
                     PQNPQDGQQPPEPSNYDYTENAPQAVVDAVAIERAKREQEGPPEMMVGSWTSWAGSDN
                     ADTGIFPSSITRSHMRVGSRRTSIASRHSVASIARPPSVFRRQGSSQIDLVQSPGSAV
                     FAFDAAEDETTAEHGAYHRRISSRRDSRRWGRRDSSAQPGSYFSSREHDRGREDEGRF
                     SDEEEDFEPQPVSPQRPSTTALGRIASFIGLTRHDTEDEEAALVHSVDELRRRSSSRS
                     RSRSRRASSGSRSYARSPSPSPSEEDWEYGEDDYMDSYGEDGEGYSSSLADDTSLPPQ
                     SRPTSPSIPLVPSATDGIFGEPHVRLNDLVEPRDFVSVAVPSRQTIVLPDEDLSIRFT
                     CYRTDPFRNILWWLGCILTLGALGLLGRWMPKIWVKFLGKETSFEEAKEGSWLVVETP
                     YGDLHVIPLHIVPYPYPLSTVFPQSIPPPASATSANGYFGLSSSSTPAQPLHSLNGEP
                     AGGVGGAKDLMSDVEPGKTVWEETTGLLKIMEYRYTKFALDPSAGRWAMIRDWRDPKW
                     TSSRAVAQGLDSAVRKQRLVLMGENIIDIASKSVVGLLVDEVLHPFYVFQIASIILWS
                     LDDYYYYAFAIALISITSIMSTLIETKRTIERMREMSRFHCDIKVLIDGEWVMKDCSE
                     LVPGDIFDSSDPNLSVFPCDALLLSGDAIVNESMLTGESVPVSKIPAKDETLRALSRE
                     SKQGSSEIDSDLAKHYLFSGTKIIRVRAGAKPVWAPKSESSIALAMVTRTGFNTTKGA
                     LVRSMLFPKPMGFKFYRDSMNFIGVLAIIAGFGFAISAVQFVRIGIHWHTIMLRALDL
                     ITIVVPPALPATLTIGTTFAIDRLRKSGIFCISPNRVNIGGKINVVCFDKTGTLTEDG
                     LDVLGARTIDRQNSRFSELHSDIADVPIEGGVNGKTPLLYALATCHALKLIDGEIIGD
                     PLDIKMFEYTGWTLDEGQSRPVTKGNAEGARPQALVQTVVRPPGTDRWRMEDALKQGS
                     KHAHFLELGVIRTFDFVSALRRMSVIVKRLKSTCMEVYVKGAPEVMPEICDPSSFPHD
                     YDDMLSYYTRNGFRVIAIAGKSIEGLTWLRAQRMRRDVAESDLQFLGFIVFENKLKPG
                     TAPNIHTLRAAHLACRMVTGDNVRTAISVARECGLVSHSASVYIPTFIPGTGVHDEAR
                     LDWSSVDDDRLKLDEWTLKPLTNQVGVAMDTAEAEMHDYQLALTGDVFRWMLEYAEFE
                     TMERMLVKGVIFARMSPDEKAELVERLQSLGYTVAFCGDGANDCGALKAADVGVSLSE
                     AEASVAAPFTSQIPDISCMVEIIKEGRAALVTSFSCFKYMALYSMIQFMTVTLLYSFA
                     SSLGDFQFLYIDLFIIIPIAVTMGRTLPYPKIHPKRPTASLVSRKVLISIIGQILINA
                     AIQVFVFVWVRKQPWYTKPDTDVDKLETFNFENSALFLVSCFQYILVAGVFSVGPPYR
                     KPLYTNPSLVICLTVLTSFSAYILLSPAASIAAILDITDLKFTFRLQLLAVAAVNILA
                     SFAFERFAERPISRMIVFAKRWKGRRGKRRDYRLPPSTGI"
     gene            867606..870307
                     /locus_tag="CND03200"
                     /db_xref="GeneID:3256884"
     mRNA            join(867606..867672,867733..867876,867930..868401,
                     868462..868670,868718..868742,868786..868866,
                     868922..869290,869351..869623,869688..869849,
                     869909..869984,870043..870128,870193..870307)
                     /locus_tag="CND03200"
                     /product="expressed protein"
                     /transcript_id="XM_024657023.1"
                     /db_xref="GeneID:3256884"
     CDS             join(867632..867672,867733..867876,867930..868401,
                     868462..868670,868718..868742,868786..868866,
                     868922..869290,869351..869623,869688..869849,
                     869909..869984,870043..870128,870193..870222)
                     /locus_tag="CND03200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512744.1"
                     /db_xref="GeneID:3256884"
                     /translation="MGSDEQPPWAPLPRSNQQSVDHDDEDDEQLRIAIALSQAEARET
                     KRARREETPDDEKHMLAEAIAASLAEAGPSANPEATVSQQPVASLAIPVVAPVVEVPS
                     SLRVGSQTYDRAQMNKERLQRQAAREKSEAEQSRREGISTFEQTTPRLPQARKAASAQ
                     WPPPTGAHPFQGTAPFPRDAAGEYYLEGELRHTGNMWASEGPIGNIRQPTFSLTHVVG
                     DHSQISLIITSAYCIDDSWLNEAGILPDPVDVPVVMIRPYPKDLRHRLNGKVASQLNG
                     EVWCYPDMKDNWGTMHMKFFWIFYKTGRLRVCISTANLVPYDWSMIENSVFVQDFLPL
                     NTPIQGLSADAPTHDLALQFRTLFKHIGVDSALTLLSKNHPQGNRIPFSGQNDFSDLR
                     RWDWGKVRFRTVISVSEKLSGAGDVDLFGIGRLGHVLNTEGWVPDKEQKAVIEYQGSS
                     LGQYSLNWLHNFYSFCTGKKVSSLVTNSKPSSWPPIKIIFPSLSTVDSSVGGRDGGGT
                     IFAGKGWNANTKYLFYDSNSKRGGILMHAKMMIAIFHPKAETPSSQTPSSTSLGKRKA
                     LEPDEVENRIGGWVYVGSHNFSPAAWGTLDTKKSPVTLSIKNYELGIVFPLYGQQSNV
                     AADKVAPYKRPPKKYSVGDEPWDQKKHGFGL"
     gene            872426..874012
                     /locus_tag="CND03210"
                     /db_xref="GeneID:3256990"
     mRNA            join(872426..872746,872797..873628,873679..873832,
                     873884..874012)
                     /locus_tag="CND03210"
                     /product="Ran GTPase activator, putative"
                     /transcript_id="XM_570508.2"
                     /db_xref="GeneID:3256990"
     CDS             join(872561..872746,872797..873628,873679..873832,
                     873884..873926)
                     /locus_tag="CND03210"
                     /codon_start=1
                     /product="Ran GTPase activator, putative"
                     /protein_id="XP_570508.1"
                     /db_xref="GeneID:3256990"
                     /translation="MSKVFSILGKNLKANTKAELEPYISQLEEMEDVEEVHFGGNSLG
                     VEACEAIASVLKKKTNLKVVDLADIFTGRLISEIPQALSALCNALSDHTSLVELDLSD
                     NAFGGRCADALVPFLQSNTHFQIFKLNNNGLGPWGGSVVAKALLDNAAKCEKEGKESS
                     LKVVVCGRNRLENGSAPDWAEAFGKHRNLKEVKMPQNGIRMEGIQALAEGLSNCKELE
                     HLDLQDNTATKTGTRAIVKHLGSWPNLKHLNLSDCLLGSAGGIALATSLSLGSNPKLE
                     SLKLQYGEMDKRAIELLSVAISQHLKELTVLELNGNRFSEDDECVEELKKALELWGHE
                     EALDELDDMEEPESEEEESEKEEEREEEETGEPDDGVDKGASGEDKLPPASDKQTDEL
                     ADMLAGVHVGKQ"
     gene            complement(874001..874708)
                     /locus_tag="CND03220"
                     /db_xref="GeneID:3257126"
     mRNA            complement(join(874001..874170,874308..874396,
                     874500..874619,874685..874708))
                     /locus_tag="CND03220"
                     /product="mRNA processing-related protein, putative"
                     /transcript_id="XM_570179.1"
                     /db_xref="GeneID:3257126"
     CDS             complement(join(874131..874170,874308..874396,
                     874500..874619,874685..874699))
                     /locus_tag="CND03220"
                     /codon_start=1
                     /product="mRNA processing-related protein, putative"
                     /protein_id="XP_570179.1"
                     /db_xref="GeneID:3257126"
                     /translation="MSAIAPVNPKPFLQDLTGKVVYVRLKWGLEYRGYLVSTDGYMNL
                     QLANTEEIENGKSNGALGEVLIRCNNVLYIREFKDRAGGMDQD"
     gene            874885..877503
                     /locus_tag="CND03230"
                     /db_xref="GeneID:3256878"
     mRNA            join(874885..874908,874954..874989,875093..876759,
                     876816..877015,877074..877503)
                     /locus_tag="CND03230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570178.2"
                     /db_xref="GeneID:3256878"
     CDS             join(874905..874908,874954..874989,875093..876759,
                     876816..877015,877074..877419)
                     /locus_tag="CND03230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570178.1"
                     /db_xref="GeneID:3256878"
                     /translation="MAAPNPFAGFGSKPQPSASGTSLFGNTSSQPASGSGLFGSSSTT
                     NNSSATPAASGGGLFGGGAQTSGGLFGNNTTGANNNNNNSNAAAANSSTPAAPSGGSL
                     FGGFGTGGFGTNNTATGSTTPASKPAFGGFGQSTTPAAPPPASTGTSLFGGAATGTST
                     GGGLFGAKPAEGTGAPGAASTTGGFTGFGAKPAGTTSAPATGGLFGSKPAESTPAASS
                     SPAPSSGGGLFSFGAKPASTTTPAAPSLFGSAPAKDASSSTPTSGTPPTTSGGGPFGG
                     GGLFGAKPAAPATEAPKADTATTAPAAPTSGLFGGVGASKPAEAPKPAAGGFSFGNLG
                     AKPATPSTTEAPKTGGFSFGASAPSADKKDEMPAEAPKTGGFSFGAPAAAASNEEKKT
                     DKPAEAPKPGGFSFGNIGTSATTASGDDKGKAPEAPKAGGFSFGGLGAKTDGDKDKAP
                     AAPTPAAPAAGGLFGAKPADAGQSSTAAPSASGGLFGANPNTTAAASTTTPAVPTAPI
                     ASAPANVEKPSEPVPNLLRGKALDDIVEGWNKDLEEQVKEFERQAGEVREWDKILVRN
                     GNQITALRRQVLEAQQTQAAVDEPLNYFEAQQNQLESMLDVYEKEIAKMSNDSTRPLA
                     AKMPADREREKAYTLAEDLNKQLDDLSRNLSQMIEQVNKISTSQSSLDASTSSLTNRP
                     GTPSASAADAASQMPDDPVSQLSAILGAHLRALSSIDSSAGKLSTKVGELETKMGSSG
                     SARGWGLPRR"
     gene            complement(877484..878770)
                     /locus_tag="CND03240"
                     /db_xref="GeneID:3257211"
     mRNA            complement(join(877484..877800,877857..877999,
                     878051..878166,878226..878382,878475..878550,
                     878611..878770))
                     /locus_tag="CND03240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657024.1"
                     /db_xref="GeneID:3257211"
     CDS             complement(join(877507..877800,877857..877999,
                     878051..878166,878226..878382,878475..878550,
                     878611..878661))
                     /locus_tag="CND03240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512799.1"
                     /db_xref="GeneID:3257211"
                     /translation="MSATKRGATAVHGSNPQYLIEKVIRARIYDSLYWKEHCFALTAE
                     SIIDKAIDLRAIGGVTDRQTPTPFICLVLKLLQLQPEKEILIEYLLAEEFKYLRALAA
                     FYVRLTFRSLEVYEILEPLMKDYRKLRVVHAGGYSLTHFDEFIDELLTQERVCDIILP
                     RLTQRSVLEETEGLPPRKSLLEDQESEREGSRSPSPPRYTSRSPSRTPPSSPGSRGRS
                     RSRSSASSGNRYVSRSPSLSGSELGGEEGDTRDRYISRSPSVSPDRVLEVAEDDVLEG
                     DV"
     gene            878859..879658
                     /locus_tag="CND03250"
                     /db_xref="GeneID:3256851"
     mRNA            join(878859..878961,879022..879087,879166..879260,
                     879320..879388,879449..879658)
                     /locus_tag="CND03250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570509.2"
                     /db_xref="GeneID:3256851"
     CDS             join(878892..878961,879022..879087,879166..879260,
                     879320..879388,879449..879562)
                     /locus_tag="CND03250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570509.1"
                     /db_xref="GeneID:3256851"
                     /translation="MTGNGKGEDDVSLPKATVLKIIQEMLPEDISASKEAKDIIFDCC
                     TEWIKLISTQSNMVCEASSKKTISPEHVVEALKQLGFEDFVAEVEESNKDFKQAQKER
                     VRSQPDTKGMTEEELLELQERLFASSHARFAAGQQ"
     gene            complement(879626..881079)
                     /locus_tag="CND03260"
                     /db_xref="GeneID:3257057"
     mRNA            complement(join(879626..880725,880783..880851,
                     880909..881079))
                     /locus_tag="CND03260"
                     /product="expressed protein"
                     /transcript_id="XM_570513.2"
                     /db_xref="GeneID:3257057"
     CDS             complement(join(879663..880725,880783..880851,
                     880909..881057))
                     /locus_tag="CND03260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570513.2"
                     /db_xref="GeneID:3257057"
                     /translation="MPPPHPELRHLLATSRRIPSKTSRLLSTSASTLRPTDEEPHFTR
                     APKSTPVKSQTDSLQHTQFNDLWSQLHQEWPKQSNNKGAPQSISSFLDLSSSNVIPRP
                     MKGARNRLARASGVTPPEAEVFNEVISSILTSFPSTPSDPFLATKSGVTGYGSNEWGD
                     GAKQLRTMFDRNRSEDDNLEEYEMLAEEMDMVSSDLELVEWAKKRVFTPIDPLKPDEG
                     TEKVKASVEDETSATPESSQSTAATSPHQNTYKPPANLLPLLTFSPVYPKILTRVLKT
                     LRENFNSPHLVLALFHHAQSSSLESYLFGCLTGAYNEVLTCRWESFRDLDGVQRGIRE
                     MEMMGVKWDKDTNRLVSRVVDEAGREILQGGRWGEDALQTLQQLERKLESDVIEEERY
                     HEFERKKRKRERERREGGADGEQWQTERGALGML"
     gene            complement(881189..883747)
                     /locus_tag="CND03270"
                     /db_xref="GeneID:3257160"
     mRNA            complement(join(881189..881338,881402..881539,
                     881621..882591,882672..883179,883241..883747))
                     /locus_tag="CND03270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570177.2"
                     /db_xref="GeneID:3257160"
     CDS             complement(join(881297..881338,881402..881539,
                     881621..882591,882672..883179,883241..883660))
                     /locus_tag="CND03270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570177.1"
                     /db_xref="GeneID:3257160"
                     /translation="MPHHDTVPAMPPSDAAKPDDLAIQDLSREVTSTGNIRLAAKRLA
                     QSAQAEKLRNLKERASTRPQVAPPYARWADDPEEAEYLQSNVHAQAAHVEDQVLVSDE
                     EDEEEKEAMGHMQEVVDGLWVGDLVAANDDDELEKNGIKNILSALRPSLKFSDKYAVY
                     PLEIDDAADTDLLSHLPSCVAWIKEILDLRQKAAEPSSQQKNGTGNGESLKRSPDIDT
                     VAQRGKPGGVLVHCQAGMSRSASIVAAYLMTEYDIDPMEAVAMIREKRPVIEPSATFW
                     HQLGLFYNTDGKVSLKDRSTRQYYMERTTTQFINGDGTAPSVEKMAKYPASPSPSNPP
                     TPKDHARRKIRCKMCRRHLAVREHMMDHILDQAPAVPASRPRTPSGASISSQRASFSS
                     NAGMRFTDVMEEAGAGLLTDRERRGSQVSDVINPLTGLPGALSRRSSAGAGSNGALSP
                     RATQTLYERDTVTSPLSISHNNNNNNNTTHLASRRESLLRNHSEPAGTMPPPVPSPTS
                     HSTTSVPAPAPAQRALQSADQLNARLPPQLLALRMAGMGGAGASAPASPGTNTPEKER
                     RDQSPSSANTNGGTGAAARRLSSLAMTSKDEKEATKLYERRASAGEGMYGPPPILVNP
                     KCSGYFVEPLTWMEPVLSKGQVAGKLVCPNEKCGVKIGNFDWAGVQCGCKEWVTPGFC
                     IHRSKVDEVF"
     STS             883282..883843
                     /standard_name="ha2793"
                     /db_xref="UniSTS:515597"
     gene            complement(884169..885144)
                     /locus_tag="CND03280"
                     /db_xref="GeneID:3257229"
     mRNA            complement(join(884169..884234,884292..884342,
                     884391..884442,884494..884786,884834..884990,
                     885034..885144))
                     /locus_tag="CND03280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570512.2"
                     /db_xref="GeneID:3257229"
     CDS             complement(join(884224..884234,884292..884342,
                     884391..884442,884494..884786,884834..884990,
                     885034..885096))
                     /locus_tag="CND03280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570512.1"
                     /db_xref="GeneID:3257229"
                     /translation="MPAIARQLLARGYATAATAVKAPLQLNSLTGTYATSTYLAALKK
                     SPKELEALAKDVEAFDRKIRDDAKVAAFIQNPTLSASERAAALSSVVPSGASPILSNL
                     LSVLSENGRLSSAPKVFADFHSLMAAYRGELEVVVTSAEPLDSKSLSRLDKALKGTEI
                     AQGKTLKVVNRVNASVLGGLLVDFGDKTIDLSASSKVNRFNAALTQGV"
     gene            885244..886458
                     /locus_tag="CND03290"
                     /db_xref="GeneID:3257070"
     mRNA            join(885244..885423,885490..885947,886003..886458)
                     /locus_tag="CND03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_570176.2"
                     /db_xref="GeneID:3257070"
     CDS             join(885276..885423,885490..885947,886003..886155)
                     /locus_tag="CND03290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570176.1"
                     /db_xref="GeneID:3257070"
                     /translation="MAASLPIFHLLPNHHPAYPPSPTFSDPAFSAQYDSAFPANMDLS
                     KSSQHPLNGYPFPAPPGTSAPQYSSRHIPSYPNLVPPNFSRGSYPAVQGGEDPTTFLD
                     LDLSQPGPSTYHQQQPQPQSAAHHYHQPDHEYVQSDAEDDESLVQVKEEQDERQEGEE
                     QDADVDNEEPLYVNAKQYHRILKRRMARARLEELNRLVRSRKPYLHESRHRHACSRPR
                     GKGGRFLTAEEIETLKRQEAEKASKGEDEAQASA"
     gene            886865..889207
                     /locus_tag="CND03300"
                     /db_xref="GeneID:3256853"
     mRNA            join(886865..887522,887618..887942,887998..888052,
                     888119..888203,888262..888403,888467..888559,
                     888608..888667,888763..888834,888913..888963,
                     889027..889207)
                     /locus_tag="CND03300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570510.2"
                     /db_xref="GeneID:3256853"
     CDS             join(887014..887522,887618..887942,887998..888052,
                     888119..888203,888262..888403,888467..888559,
                     888608..888667,888763..888834,888913..888963,
                     889027..889068)
                     /locus_tag="CND03300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570510.1"
                     /db_xref="GeneID:3256853"
                     /translation="MSQDEPTRRSPHLHSDATGNSLSAQDTSSKDFEGMKTVNARSDA
                     ETAASGKRVKVFHASTPEEEQARRHRALGNEDAMVREEETSAEAEGNEQSNKDEDAST
                     ATTSSAIHQRERDQGADLADSNDVNMDDDESPKVSTVPLAEETDEEWWDLKMQWGGKV
                     YDIHVGGNDMVYDFREKIASLTSIPPDAQKLIGLSPTVKGKLNASHDAMRFAHLGVRK
                     GGKFVLVGTKVEERFVDPIKEQEGEGGEGEFDVDYKGIGPGNDPRNKRKIQEIIDKVP
                     ITVMNAPREGKKLLVLDLDYTIVDTKSLLNGTLPSSECARPGLHDFLELVYPHYDIVI
                     WSQTSWRWLETKLVELDLFNNSRGYKISFVIDRTCMFPVFSQRNGQPYKHEVKPLAYL
                     WASFPQWSAKNTIHIDDLSRNFALNPGEGLKIRAFNKAGSPDGRRDRELIKLGTYLIG
                     IAASESDFTTMNHKYWSGRVKGRRGRH"
     gene            889278..892089
                     /locus_tag="CND03310"
                     /db_xref="GeneID:3257452"
     mRNA            join(889278..889590,889653..889721,889782..890157,
                     890211..890324,890380..892089)
                     /locus_tag="CND03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657025.1"
                     /db_xref="GeneID:3257452"
     CDS             join(889319..889590,889653..889721,889782..890157,
                     890211..890324,890380..891951)
                     /locus_tag="CND03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512745.1"
                     /db_xref="GeneID:3257452"
                     /translation="MRILILLAAAALLGTTLASAHALAPIPSLNPPIVRREDTNETAP
                     GNNTQTWTEGDDWVPFNIVIDPAYGIAGAVLILSGIPVAVLGGKNRWSSLAIASGQAL
                     FLFALVMILRFGVQPNLVPPSPHPPSPTLRGLYLLACLISSFIGAGLGIFFFNFTKYA
                     ISAAGGFTFGWFLLALREGGLITSVVGRWALLGALTVVAFIASLPKWSNDLMTLVSTA
                     WIGATSFVLGVDCYTRAGLKEFYIYNLGFHDLFPTLGGAKYPLTQTMIIELGILGAVV
                     LVGAAIQFRVIGLLQKRMNRLRAEEEARMEEDEISKAAERFKNVGAELVEWEEKYGNK
                     PRSESEHNGTEKCGSVRDVSSPSGPYAISLTADRSSVLLPQLEFNDSQESEILKKRPS
                     NNLSLLGNDISPQIRPSSSFSLVRVASESGKGHENINPDKPTNTMFLGIEKLKPDEPS
                     SGLGRDSSDLESKLRLLEEVRKARESVQGSLELLRSRTPSETQSFAGPSGADTLSGSG
                     LEGRPRRYSSMSSRLLDEAKVRPVSSASNPSPLQSHMTEMPQQQSEWDTYVAERRIVS
                     PVASSPPSFASLSVDRQRQYTTVPVSVAKGIESRRERTISMLETRVSDFGPAQQERAH
                     GTFPERSPITYVSDIERKGSAAHHDYFERGIPSPPLAANRPQMSYTSPPRVITGGASD
                     RHPASAPKTMSMEELAERHRQRLSKMQQPVTFKLKESERVEEAKKKWEKQRAHEREEM
                     RRRQTERARENENSQGKIREVVRRTDQWRRSIAVDPEPQVGGEKTSNGEKAQKQGRTI
                     VN"
     gene            892268..899959
                     /locus_tag="CND03320"
                     /db_xref="GeneID:3256964"
     mRNA            join(892268..893227,893282..893434,893490..894288,
                     894352..894436,894488..894671,894727..894902,
                     894954..895285,895345..895431,895483..895524,
                     895581..895694,895748..896124,896178..896876,
                     896928..897287,897358..897588,897635..897958,
                     898024..898233,898278..898385,898440..898537,
                     898593..898675,898724..899049,899101..899258,
                     899323..899653,899708..899778,899831..899959)
                     /locus_tag="CND03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657026.1"
                     /db_xref="GeneID:3256964"
     CDS             join(892320..893227,893282..893434,893490..894288,
                     894352..894436,894488..894671,894727..894902,
                     894954..895285,895345..895431,895483..895524,
                     895581..895694,895748..896124,896178..896876,
                     896928..897287,897358..897588,897635..897958,
                     898024..898233,898278..898385,898440..898537,
                     898593..898675,898724..899049,899101..899258,
                     899323..899653,899708..899778,899831..899883)
                     /locus_tag="CND03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512646.1"
                     /db_xref="GeneID:3256964"
                     /translation="MSHSRNHSLAISTSASIHTSASPSPVSPASPASASAGLSRRHSW
                     NITDENQEIPTFNDPSSPSRHINDSLTPKRAIPLHSTPLGKSGTAHSHRLSERDITWA
                     DANDGRDIWGDPNQTTPTQSRTRPFIDTYQSTTSLQSTISPLDDNGRSSDDRERLTTG
                     HSHVMHYNGIGMGTPRRSPRKPYNESGSGLGRSSTLRNVSQSLRKASVRVVNIMGTER
                     GGGRERLGSDDEGEEVLQDVEIDGNQGFAMSSTNDNRETLPSPRQLPTSSRREEVGHR
                     RLRGRTMCLFGPMSRVRKSMDRLMRYPWTEPAILLLIITNVVVLAIQSAPTLNSPRTG
                     NGYFQGWEDAVLLVLFIVFTLEMFARIVVTGLLLDPETSLRESLFGQDGVVPVLQRYL
                     LITKSNIQSNLRRKATKRRAPWRSQEQNDATHNKGSKTMATSALRSLTGLSEAPFQKA
                     MAKQKGLSDQGRPYLRHSWHRIDMIAVFAFWITFFLALTGHEATANRHVYIFRALSVL
                     RAGRLLVITSGTTTILHSLKRAGPMLITVSYFLIFAACIFSIIGVQSFRGSFRRACVL
                     TDPHNSSNVIQLERQCGGWLDPTSLESVSYLNSDGTPSAVPPKGYICPLGQTCMTTDQ
                     NPNNNVNSFDNVFSSLVQVIIVISINTWAPVMYMAMDSDFFGSSLFFIAGVIVLNFWL
                     INLLIAVVVNTFSDIRAETKRSAFGAGETFLGTEPHWAAEDEKTKNNRLLAFYQKTEI
                     FWVILIVADLVTQGSKTSSSSESMLRLLDRLELAFTLAFDLEIIIRFLAYLPDWRSFF
                     YRKRNCFDLFLAIACSIIQIPAISNSTIYPWLTVFQLIRWYRVILAFPRMKPLLVTVF
                     GSFSGLLNMVIFLFLMNFLGALMALQLFRGDLEAGEPITFSQTYNSFLGMYQIFSSEN
                     WTDIVYDTMGAEAQYKQNIIAAIFLCGWFLFSNFIVLQMFIAVINENFAIAEEQKRKQ
                     QIQAFIHRAEAPSAHASWIDRLNPYRLMAARPRAVRVKTLPPNLILPLKQNTGIDLSD
                     VSSSLPMDDGKGTKGAVKRLLGRDREEGQIRLKRLKRPSPREVTDDVEDEDDDRGLTD
                     LLPPLNAAVSKDEHMDALRERRNQQADFIAAHPSFDKSLWLFKQSNPVRKFCQACVPP
                     AYGERIFGRPANPTLELIVKTVVFLAVVASIVVAAIASPSYRREYYADHGISRGTWFD
                     LTEVTLGLIFVLEAAMKIVADGFIFAPNAYLLSLWNVLDFIILITLLINITTSLIFIG
                     GLSRVTRALKAFRALRLITLFGRLRDTLHAVLFAGALKILDASIFMILYLIPFAVWGL
                     NIFSGLLYYCNDDDSTGLTSCIGEFSTSPVDDSLTYLVPRVWVNPTVDESIWSFDSFR
                     ESILILFEIVSLEGWIDVMASVMNIVGRDQQPEDQASQWNAIYLVIFNLFGGVIILTL
                     FVSIIIKNFSTRSGNALLTSEQRQWVDLSKFIKAQTPSQLPKGRPKLLFRAWCYDRTV
                     NKNGFWAVGFTMIYYLHILLLMMEDFSENLLNEVQLDWIFLFLTVLYAIDLLVRFYGL
                     GFKSFRSNGWNIFDLIVITGSFATTIPALQADSSGGTANQVNVQLQKLFLVSISLKLV
                     QRISSLNQLFKTSVASLPAIGNLFLLWATIFIFYAILYLEVFGLTKEGNNAGTRFQNY
                     YTFGNALLMLAFMSTGEGWNGYMHDYTIQVPRCTENGNFLESDCGSAPGAYVLFISWN
                     IISMYIFVNMFTGVVVESFAYVYQMPGKSSLNREEMRAFKQLWAEFDSQRVGYIKRRD
                     LIKFFSRLTGVFEVRPYPIEFSIHNIIHHSRPDQPDNASSRSYVITGVKHAVDIRRVA
                     EQIAQIDYRQVRERRQLFSRLYNEARISEEPGKGISFTAMLMMLAHYKLIDDESALEL
                     DDLLLRRARTERVTDLVNLDRVRGLLRTIYWRKRFLATRDARKLTLNAEAEGIPAIVL
                     DPTPITPPDYSDQSRYDPSYSPQVHEKEESTPKRILSTEIISPTSYFPSGKTHALPVS
                     DLSNSNSLPSPSFYNSPTRSTPRPESLGRQPSNSSYLSSDDAHYRRDSKPDENLHAKD
                     YDEGMSDSMWGDMMREAVDQEGIENEQG"
     gene            complement(899905..908162)
                     /locus_tag="CND03330"
                     /db_xref="GeneID:3256914"
     mRNA            complement(join(899905..900193,900248..900327,
                     900375..900581,900638..900705,900765..900997,
                     901058..901228,901280..901545,901593..902855,
                     902911..903376,903432..903490,903540..903706,
                     903758..906011,906068..906867,906920..908162))
                     /locus_tag="CND03330"
                     /product="1-phosphatidylinositol-3-phosphate 5-kinase,
                     putative"
                     /transcript_id="XM_024657027.1"
                     /db_xref="GeneID:3256914"
     CDS             complement(join(900066..900193,900248..900327,
                     900375..900581,900638..900705,900765..900997,
                     901058..901228,901280..901545,901593..902855,
                     902911..903376,903432..903490,903540..903706,
                     903758..906011,906068..906867,906920..908056))
                     /locus_tag="CND03330"
                     /codon_start=1
                     /product="1-phosphatidylinositol-3-phosphate 5-kinase,
                     putative"
                     /protein_id="XP_024512761.1"
                     /db_xref="GeneID:3256914"
                     /translation="MPSSSYSEHSIPPSSHLTTFPNPFQDEPEQGILPAFLSKVKQTF
                     ASGISQPPTQNSHASSDRLPLSIEGENKFAHDRDSNPIAPPREGGQTEAQAIAEAVMK
                     NRIQTAAQGALPNSAVEQQQRMHGQSAGSISAVVATAAEALPSTQSTAHPSNLSIHTS
                     HDQSLNPPIGPVNTFGSSNSHPPVPASVASSQVSISGPKRAVASGGPHWRPSGVAPAQ
                     VTISPVTTTVQTASKEPISSPARPIPFPSAKVPHRGNVNRQNSISSSSRAPTPLPHHI
                     HTNPLSTGQNKRLRRSSVATLPDSPSSLSISGMIAANAELTQSHSYVPGFPLAQDDTR
                     SVRSMGAVKRLNSVSRIIKRMKGDGLSKQYWMADEHCKECYDCKSVFTAWRRKHHCRI
                     CGQIFCSRCASNIIGARRFGQEGVVRVCNLCLKIMEEYKDDDDDDRRSINSFSTSVHR
                     YPSISDRAFLNTAMSPEMPYAKSPFAASQLFSSHPNDSLMAIDEASVPMQWDDGRLDA
                     ERAFILNEVGGPPTPTGDDRIWAGRPPTVAPFRRPVELDQKVAADQEEADGDGRVSTP
                     VLETSGSALHATHRDATSSPFPRTNTMSTDDDVERAPLSREDSGHPLIGLKTRMNQAV
                     LTALLDSEKSEGLWRARSHSFAHQPEMLTGASLQHFKLMLSQAIARAELPKADEWHRI
                     LTNLILKVPLNLQPNVRAGDDIDVRAYVKIKKVPGGKISDSEYVDGIVITKNVAHKAM
                     SRRLVNPRIMVVTFPLDYHRVDNQFMSLDPILAQEKDYLRLLTKRIVDARPHIVLAQS
                     SVSRIALDYLLEANVALARSVKASAIQQVARCTQADIVASMDRLVLEPRMGRCGEFRI
                     QSFDHELIPGRRKTLMRFEGASREQGCTIILRGADLPTLRKVKVITDFMALVAYHLRN
                     EVIMYNDEHNIPPPKPVLPTEYRELLDLLDSDRSPTEGSPSCDTPSQLSHSTATLKPI
                     TSPDNIEFVSESSSTPRPNLNPIQLDDKQLEKRDALEVTKQIAKSLEPYLTVALSSSA
                     AIMFPPPAILAKMAALDRRLSELRVNRDEAEAAQILEEETKVAEVSKDNAPTVGTTDS
                     ETASLAPTSISEAAGTSSEVPINDAMSAYPTTSTSKPPIRDPYHILRKPQEVSQESAL
                     AQVEHAHQEQIRLWQWYTRRFAEELRPENYQGIVYLSSLGCEGAEKPCVEPSLQHIDY
                     YQPGDQTVGQFLESLAIVAPDQCTSKNCERLLLFHYHLLVHGQRRLQIAVDQFPCPSP
                     GHEDQIITWSYCRQCATPSPTTIMREETWKMSWGAYLEQCFYPPEIRAGFSCPHDAFR
                     DQIRYYAHRNLAIRIHNEQIDLFEPVRPSIKLQIKAETKVILKNREYDSALAKIYAFF
                     DSVASRLRTIDVEGVQSDKVSRLNANVESMLVRAASDREEIINLLNRTYKLTPITDVL
                     SLNIVLRALQDKVVQWDVDFADIEKAFMPTEKDLKKMTASHLKRFFANQDAPGSLERS
                     ALAGTPSVVSEEHETKDDVAPTQAPSDKQTTIIGLSSDTTTDGAAAFADIATAKLDDA
                     SVTPTAGILQPMSNPYSRSVRSSSKETEDDSDSTVFATHDDLVDKGDGKATIEPSTEN
                     DTSQFVSRLPRRAAPAPSIADLVQRFNESTQLALPGLTCSPEHTRSAGGSRRQSPRQY
                     SSHDISDSDHSSRNRPRLRRGKTEQPSHRQRDASRPGLMSDGDRSYATNASRISSSSH
                     LHRSVGESKNNDYPTVRPSMGSRAPSYTSNIPPRSGRASPKLRYPVVTHVQSLFDLEE
                     GKPRVAGKGKSPRRPESTTPIVGKNVGRRSQSGTSRVNSIARHFDRLSREAEKERQKR
                     ISVVRGKRARPVSVTKAKVQVFDNLRDAFKDEFDTDSSEADNEEDELGSDDSLGSADE
                     PISRTKAESFSNNSSPTRPIGSSVPMATSPSLLPEASLSKDDLVTMSPPIASETTTSI
                     LSDSKSEKSFTDRLKIELPSFETSAPLPSHPATPQVHTDTTTADEALGAVSASQTSDV
                     ETSTANEKSSLLKSLSGLWAFRAADFAPLEYPLSASEHIFADSKVIIRETEPTSIIAF
                     TLSSKTYRDNSKAWSTSRQEEGRFDTFMPEEAMSANHPAAWDAVSLEDVDETARQERG
                     THMKYDFESGASTIFCRIFFAEQFAALRKACNCEDSFVESLARCIQFDASGGKSGSAF
                     LKSRDDRFIAKEITRYEMDALTKFAPAYFDYTRKAFQGQRPTVLAKIYGFFKIGFNNA
                     ITGKAMKMNVLVMENLFYERRFAKIYDLKGSTRNRLIQPTGRINEVLLDENLMEIVYK
                     HPLYLREQSKRVLRTALFNDTLFLSNLNVMDYSLVVGVDTDKHELVVGIVDYIRTFTW
                     DKKLESWVKDLGAGGKGEPTIVTPKQYKLRFRTAMERFYFPSVPDRWTVVVPDEAQVE
                     EDEPGVGATG"
     gene            908806..909732
                     /locus_tag="CND03335"
                     /db_xref="GeneID:36392829"
     mRNA            join(908806..909036,909116..909243,909300..909357,
                     909458..909732)
                     /locus_tag="CND03335"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658485.1"
                     /db_xref="GeneID:36392829"
     CDS             join(908986..909036,909116..909243,909300..909357,
                     909458..909574)
                     /locus_tag="CND03335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514339.1"
                     /db_xref="GeneID:36392829"
                     /translation="MTQCSKDETLIQEIHVRIVERQGHEESSWDGCISVYSQLKSIFE
                     VWNDDVHEDEDIDSYRFTVYLEGTGKPGTVVNGDESCMSLGIHDQGIIFASRIEVPEH
                     RPQQMATSTRVAMRI"
     gene            complement(909713..911028)
                     /locus_tag="CND03340"
                     /db_xref="GeneID:3257020"
     mRNA            complement(join(909713..909914,909968..910194,
                     910247..910382,910440..910836,910889..910900,
                     910953..911028))
                     /locus_tag="CND03340"
                     /product="expressed protein"
                     /transcript_id="XM_570565.1"
                     /db_xref="GeneID:3257020"
     CDS             complement(join(909812..909914,909968..910194,
                     910247..910382,910440..910836,910889..910900,
                     910953..910998))
                     /locus_tag="CND03340"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570565.1"
                     /db_xref="GeneID:3257020"
                     /translation="MEADPLYHVKQLFYQASYQACISEASEYPHTPSDDPSSLHRALY
                     IARSHLALPSPSPSSAHAILAPFLSLSPVPLSARAVDAFASIHEAEEDAREEKVEEVR
                     DLVLECEGGNDEEEEKTVRAIAASVFILVGENEEAVATLTEGAAKDDLECIAILVQLL
                     LSLNRRDLAQATYNSAKKFGSDSMLIQAMEAWIGLKTGSQPLHQSYYFYEELYQLPNG
                     RTAPVLASHAAAHLLLGHVDEAKADIVEASQSKAGQSSSDVLAVGASVGAEGFAEKLV
                     TTAKQHPYALDLIEKNKLFDEAAAKYAVSA"
     gene            910616..910997
                     /locus_tag="CND03350"
                     /pseudo
                     /db_xref="GeneID:3257293"
     gene            complement(911137..912653)
                     /locus_tag="CND03360"
                     /db_xref="GeneID:3257418"
     mRNA            complement(join(911137..911361,911418..911539,
                     911628..911728,911783..911886,911934..911980,
                     912040..912139,912211..912226,912280..912323,
                     912377..912653))
                     /locus_tag="CND03360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570670.2"
                     /db_xref="GeneID:3257418"
     CDS             complement(join(911281..911361,911418..911539,
                     911628..911728,911783..911886,911934..911980,
                     912040..912139,912211..912226,912280..912323,
                     912377..912625))
                     /locus_tag="CND03360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570670.1"
                     /db_xref="GeneID:3257418"
                     /translation="MPNSVSINSSPTTTNVLLNPPLRSPSYSEVELIRTPPARSFTPT
                     PPVSRSLSANGSPTASTPGRLHGESDLSLLLRTLDFAARKHSCQRRKDVDQSPYINHP
                     ISVANYLSSTGITDVHVLQAAILHDTVEDTCTTIEEIADQFGIDVARIVEECTDNTAL
                     DGLQRKVEQLRAAPSKSKQAQQVKLADKLHNLESIRRSPPVGWGMKRVQAYFIWAKRV
                     TDICAPAHPPLAERLQRLYETAHTRVNGTYFPCHPEVCGPLTEEEKELVDKRLRELKE
                     GDTMCPEPLFF"
     gene            912779..916098
                     /locus_tag="CND03370"
                     /db_xref="GeneID:3257220"
     mRNA            join(912779..912859,912900..913139,913192..913385,
                     913441..913772,913825..914327,914383..914586,
                     914636..914817,914879..915271,915333..915471,
                     915530..915603,915669..915887,915939..916098)
                     /locus_tag="CND03370"
                     /product="expressed protein"
                     /transcript_id="XM_024657028.1"
                     /db_xref="GeneID:3257220"
     CDS             join(912802..912859,912900..913139,913192..913385,
                     913441..913772,913825..914327,914383..914586,
                     914636..914817,914879..915271,915333..915471,
                     915530..915603,915669..915887,915939..916034)
                     /locus_tag="CND03370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512645.1"
                     /db_xref="GeneID:3257220"
                     /translation="MSRQLLAWETEERKLQSVYDDISLHRIVPAQQTIARYLKKHPKS
                     QPALIVNMYIMQKTGAEESDILQVYKQIQALAGPKKEMTGRGVWWCTLTLRNMGRLDL
                     AQKVYQDLYDLHPETYQLLEQVFLHSAAAWDVSTMVQSSRKMFNATRDPKWARLAAWA
                     EWVQKAPQPTPSNPYPCPAPANSLKIAQVLLSTTGNTCETSDIFWLRAQILLSSDQPG
                     DLLTLARQQAQEGSLARLWWRMETVKAAVARCGKEGQKEWEAEREWVAGMLQKDDGSQ
                     RNYAFYRYLLLATQNSTDPDSMRSTTALLKSLVEQIGQKERAPQLAQLEFDMVLHDTK
                     FASETDISSHLMDDEEWLDKVEQYWNRWGSKGSIVTELIAISRENEKRKTMVENFLKA
                     RAVQQHHDETSFKEISNAYIILLMEKDADWMPTNEDIEKYWRLYLEGLQYGRNLAKTD
                     VQSSDPIGLLTVNLLLIMWHSSPKNMVPLYKSILCLEKICQESPICMHAHYLLIRLYR
                     LIGAASLIGPHLTTLGLSEIQLDNLLHVIVERGAIEALMAKNVGIWSSHTDKALNMYQ
                     RTASDFPEYVKECLGNETYSKITSIRHLASSLHDSLSSHVLAIEQARLHAFNSPTVPF
                     PPQLTRRLQKSLKAEMIDLRNWDLIQEIGGKRKLTKDITELGGRPIADDWVKIMGRFW
                     LVVGEFINNGQVLDLEFEGLEALLDHEQALVESGSNVLKAASKALKPSTEAAESEEQE
                     KSLKGIFSENIRICCGDHTSRWSLIQSYISLAQLIKITDLVLSRATEAAKPVKGKKKP
                     TQLSAFIADLRNEIQDLKNTTMVELNKRLDAVRGEDEVKWDCLSSLFDEDVYLQDVFE
                     NLMNARKASLDNLKPLLTTKK"
     gene            complement(916239..918044)
                     /locus_tag="CND03380"
                     /db_xref="GeneID:3257424"
     mRNA            complement(join(916239..916448,916522..916596,
                     916660..916755,916827..917267,917351..918044))
                     /locus_tag="CND03380"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /transcript_id="XM_024657029.1"
                     /db_xref="GeneID:3257424"
     CDS             complement(join(916412..916448,916522..916596,
                     916660..916755,916827..917267,917351..918021))
                     /locus_tag="CND03380"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /protein_id="XP_024512644.1"
                     /db_xref="GeneID:3257424"
                     /translation="MPLATRPHPRLLSPILALLFIIFALSSLFSLFANSTSILNFVPT
                     ALVKGERTPGCRGNAAISIQNLLDAGARHVAESNRLFDATGAKRDLGIDLGENWTLQS
                     YASYLENIWQEFLQEPQGSNADHPTLQTVLSYTSLLPREQGSETAIPKFIYTTDLLEP
                     QQLPEQFQSWITQNPEWTTMFVNDAEIDTWLEDRLGAGEVKTKAQEELLALKESYGVV
                     RADLFRYLVLLLNGGVYTDTDTASVLPIAQWARSPTVAPVAPLLTAIPQLISIIQDPS
                     SQTLPSTPSTSKPSLVVAIESDALSTGANWREQSFARSIQIVQWTIMANRGHPVLLDV
                     IGMALKKSEEIRLMKSNNDQVRKEDVNILNWSGPGAFTDAVFRYLFVRYGFHPAQASG
                     LKEPLQIGDVIIMPVHSFRADASEGFQGEHRVVWHGFFGRWKGKTDK"
     gene            complement(918114..918927)
                     /locus_tag="CND03385"
                     /db_xref="GeneID:36392830"
     mRNA            complement(join(918114..918405,918462..918545,
                     918599..918630,918680..918709,918763..918785,
                     918831..918927))
                     /locus_tag="CND03385"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658486.1"
                     /db_xref="GeneID:36392830"
     CDS             complement(join(918325..918405,918462..918545,
                     918599..918630,918680..918709,918763..918785,
                     918831..918853))
                     /locus_tag="CND03385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514340.1"
                     /db_xref="GeneID:36392830"
                     /translation="MAAVRWAKFTVYSSLIIGAGVWLQSKTVPSEKELYSQLSPQLKN
                     KMDQIVRHREGSQTMKERLEEAGEKDQVVWGDQLNTKRKPLFPDRH"
     gene            919034..920391
                     /locus_tag="CND03390"
                     /db_xref="GeneID:3257268"
     mRNA            join(919034..919103,919156..919297,919348..919710,
                     919778..919903,919961..920391)
                     /locus_tag="CND03390"
                     /product="6-phosphogluconolactonase, putative"
                     /transcript_id="XM_570172.1"
                     /db_xref="GeneID:3257268"
     CDS             join(919040..919103,919156..919297,919348..919710,
                     919778..919903,919961..920150)
                     /locus_tag="CND03390"
                     /codon_start=1
                     /product="6-phosphogluconolactonase, putative"
                     /protein_id="XP_570172.1"
                     /db_xref="GeneID:3257268"
                     /translation="MPPQPPAPPVFYSFPDTEVLVDSLANFVVKAQRDAVDKRGKFTI
                     ALSRGSLAANLRGLVGQQNVQWDKWEVFFVDEAAVPLEDEDSNYRSNYLSFLSHVPIP
                     REQIHTIDINQLDDLEELADQYEKQLVNHFAASNAARYPTFDLMLLGIGPDGETASLF
                     PGHEILSEKDAWVSFIDDAPRGPARRITMTFPVLNHCYRAVFVATGKEKTEMLHTILD
                     QPEAGLPCSRVRPASPGLVFWFADAAAASATQYPPTTFRWIDNEKEAQEAVDAAKRRA
                     ARKLAEADSEAEVLKKSV"
     gene            920465..922873
                     /locus_tag="CND03400"
                     /db_xref="GeneID:3257151"
     mRNA            join(920465..920846,920925..921297,921382..922093,
                     922152..922271,922337..922873)
                     /locus_tag="CND03400"
                     /product="mRNA polyadenylation-related protein, putative"
                     /transcript_id="XM_570171.2"
                     /db_xref="GeneID:3257151"
     CDS             join(920678..920846,920925..921297,921382..922093,
                     922152..922271,922337..922759)
                     /locus_tag="CND03400"
                     /codon_start=1
                     /product="mRNA polyadenylation-related protein, putative"
                     /protein_id="XP_570171.1"
                     /db_xref="GeneID:3257151"
                     /translation="MSTVFYRWGAGRDESRVTFDGTHISVFDLKREIILNNKMGNGKD
                     FDLSIYDNVTGEELKDDNQQIPRSSSLVARRLPPSLGKGRGSAADYIAGTTAAEALTG
                     DHRVESHARQAMLDKNLTKGIRSAGGTYGSLSKRFDGKEEKPAEKVQVSTGDKDEDAK
                     IQAILAQGAETWEQMQEDMSAGYRAPAARAARANKPSGSAVAGASQKYDFSLGPEKEP
                     PVGYICYRCGQKGHWIQNCPENDDPAAAERKRFVRVTGIPRSFLKTVETPVGAEGSSG
                     GAMLTADGGFVKAVPDQRQWQKQAAVKPRALTGADVRDQEPLEADLTCPLCKKLVWEA
                     VRTPCCNTAFCEECVQTYLVDHDFECPHCESKVPSLDRLKPDEDLRKRSRNYVDHELQ
                     KNKDAKGDSADGDVKEEAENDKNADDSEEGSLTPKEQNKNQILGADGQPLNSDLLDPH
                     MIQNYLFGAKKMLLNPDLNPAARALLTTQMQTLQANLLQMQMMAMMNGMGMGVGLPLM
                     GGQNNVGGGQTGIGLNGAIDNSMAMRGRPGFRGGFRGRGMATGQGFQRGPLGPAAQGG
                     MGMGMMNRPNVPAKRGADVELGGEAKQPRTGV"
     gene            complement(922850..930018)
                     /locus_tag="CND03410"
                     /db_xref="GeneID:3257269"
     mRNA            complement(join(922850..923051,923116..923224,
                     923290..923348,923403..923426,923484..925118,
                     925173..925730,925787..925898,925951..927173,
                     927231..927657,927711..928117,928187..928619,
                     928680..930018))
                     /locus_tag="CND03410"
                     /product="expressed protein"
                     /transcript_id="XM_024657030.1"
                     /db_xref="GeneID:3257269"
     CDS             complement(join(922944..923051,923116..923224,
                     923290..923348,923403..923426,923484..925118,
                     925173..925730,925787..925898,925951..927173,
                     927231..927657,927711..928117,928187..928619,
                     928680..929947))
                     /locus_tag="CND03410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512759.1"
                     /db_xref="GeneID:3257269"
                     /translation="MLPQPLEQRPSILPVSPCSPSLSMQLPVPSPAITYLPSRRHVMS
                     TCSSPPANQPSICSFKAARKRASNWHAGTDKSNIKSEEDELEPEGSSSLRLAGRTLPR
                     GIVTPGSRLSASQPQYSSSSSADDASSASPGTPGLSSELTSSLTEKAYHLDLQHRKRM
                     ADTALLPNPKRPRIDIRTSSIPSILPNVISNGSMSRNLGLAGPQKKAARKKAMDLVID
                     LTVLDSDDDSLIIDSSDASDEAADEKDREDGDSYDFSDRTGRHTGSLASGAGEDTDEE
                     EIEVMYLKAGSVKEKEGNMVNGSACQVSPSSTRHAESRPITPIEKGPSPLREVRDLPP
                     LNGTQINAGRFLQDSSRNEACSPVVFDNRPLTTHLLDATNARSRAQTAVDLGTSSQNL
                     NPTWLDSLASAKWSPVTLSIQGDLTEMTQNWTPEERSAHRRLVLLRRDLQGKLLQVEA
                     HAISEMEAVNHRSSCLPCFFWKERNIYVFPATSVSSVFQVLLGFDRLANVQANWLGNH
                     YKKRTGIIVLRDNEDGARFLGRIAEMSSPLNVGKKIETGSEFYLWEDLGSIIEDIIKN
                     LVVRLPRDGEGDHCPPVLAPHDAPLSQLFSTRVTLSNEATLFLPPQGINPTSSTQNLL
                     PSPMPSSCSYQQLPPSDQPGSYTSNLRALDDDAQRFPLTNEDRQTKEFGTEEQHAEGR
                     FTWSSIELRFEPDLKAVTKDWTLEERSAGRRLIQLSPHWDGAAITVKLRIITRTEWSP
                     FLTHIISCIYWEERDTCVIADDDILNALEALLDVGRLTVPLKTWINNNVDKHLSMIQR
                     RDGNNEKFFSEIQNMSNPHLGRSGSFIANVYPWDDLKSMIQRIFGRLLLRIPVDGDRS
                     RPVLTPFDGLRSQLFNPHPRESALVPLASSEHFTESHHFPDRPHPPHSALDTSEPGSR
                     PSASMVGSEQAGHLLVARQYTLGLRTNAEGALKSTPGDSILDGAQLQSILQTGATEDQ
                     NGSISPRDRINGLNTVGDPRLLIDAFEPEAIVENSQVHLSTIGSNIAEASKVGRNRSV
                     EVGETVSKQIEETSQPDNDRSSSVSGSQSSNLDMEAASQLPVISSALISVPQTVHEHS
                     HTNDIPSQLPISSDLLPSLDVSKLSLMNLSQDSAFSHRVPEVQNDIHLIPRGFAPQSK
                     LSIFSRRLLHNQPRHPFASEYISRHHPVTTRKPFLPRNVRAGLSGLASNEFPNKPSSV
                     KFQQRLKEGQVRELCMRIKKGEMTLDMRNVGFGTLKRDLVARESQLKTMRQGRLINIT
                     ISRIVPVDGGSGLVAGLDRARIRVSWESDPKPLHDVTLPLRDMALYQTPLPLILDGTF
                     LRANRSTHLQLRFHVDLYVGQDSQGSYISSPMSITSPDGFLLPIADIAHMRDRNGALC
                     FNLALESNISLDPAALPLEPLSNRVIPRRPRILNLLYIFKDVQGNATQEKIVDGWKCG
                     LCGLEEDVGDLNDMSELAVHIKHYHKYECAVLISGNGAEMVITLPDCVIFVKRHDASQ
                     VFSTIAGDLTHLTGQVSPHTGGTPSHLLNNLPETLSVQDSPVSFENRLPASYTDDIAS
                     TDEFTKFTRPPILTVPGQLSSPQVCVSSSEPLKKSSSVTRSPSLSANLAQPPPPTLAT
                     QDVQIEKITSFPIPFAETVLSNFDALGVGSPLPPAAGNCINTESSDSTACPLYSLPSI
                     SLSPRSTHQSNGVFKSISSSTSSQKSPQLYEPPGFASALKRDTTFSIVESSQGRSAAS
                     TSPQSPCTNTEGQCLGTIGGASMSQLDDQPMSPGPCQSQSVIARRFSALEGSGSGSPS
                     CQQLDDLSLRRLFTPELEDVRLLSDFETDVSRDARTESPSIGPITTSAWQMPAPSPSM
                     SPRHDDFQEPCVLSKLMIPEQSLEPILSSSTGNAKVPLEESSIRLADTSEPVSDSKFT
                     EAKANLAFMNAQPASHFDDSSNDESITILAGPETSISNHSHQSPTNISGQSRSQLRDS
                     PPAIEDLRPFTKTGHAGPYMGKRVNQWTEWSSSLEPGTLIDFMGELDKVWDGGRVRHL
                     IRHQESLIWIQHHLSHKRRFLACCWNRWVHQKGPIPAYNKAGYLKLWLDSYGVIMSRA
                     KLSYEVKDYLHLHFQNRHILLTDYIGACQYWNRLRRSYFDEPSRET"
     gene            930151..930913
                     /locus_tag="CND03420"
                     /db_xref="GeneID:3257054"
     mRNA            930151..930913
                     /locus_tag="CND03420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570522.2"
                     /db_xref="GeneID:3257054"
     CDS             930221..930865
                     /locus_tag="CND03420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570522.1"
                     /db_xref="GeneID:3257054"
                     /translation="MTTDIPAQPLKTTKETHPDLPPGLIIGPDGKPCKVCNSWQDWAK
                     IKVKKKAASGGEDAEKKNVSGSGAAVGMAGFGSMLSGAGASKAPTNAPLDRTPDRSNC
                     PPDTAALGRSTWTFLHTTAAYYPINAPPQTQSSMLNLLSSLSLLYPCSWCATDFQKDM
                     RRHPPDVSGRESLMKWLCERHNEVNEKLGKEKFGCDIKNLDVRWKDGPEDGSCD"
     gene            complement(930878..932053)
                     /locus_tag="CND03430"
                     /db_xref="GeneID:3257009"
     mRNA            complement(join(930878..931050,931102..931261,
                     931320..931421,931472..931588,931651..931793,
                     931843..932053))
                     /locus_tag="CND03430"
                     /product="prenyltransferase, putative"
                     /transcript_id="XM_024657031.1"
                     /db_xref="GeneID:3257009"
     CDS             complement(join(930925..931050,931102..931261,
                     931320..931421,931472..931588,931651..931793,
                     931843..932034))
                     /locus_tag="CND03430"
                     /codon_start=1
                     /product="prenyltransferase, putative"
                     /protein_id="XP_024512643.1"
                     /db_xref="GeneID:3257009"
                     /translation="MRSLPSTLVHRLFSVATSLLLFLLALGPIPHHVAFVMDGNRRYA
                     RELGQQVESGHAEGFNALRRTLEICLRLRIRAVSIYAFAIDNFSRSEKEVGALMNLAK
                     QRLAELCEHGDLLEEYGVKIRFIGQLDMLPPDVLQAVRDMEAMTQDNKNGVLNVCCPY
                     ASRDEITTAMKESVRRAYEGELAPSDITAKDVFDSLGVSKAINTVDKSLFVNPEEPEK
                     LDILVRTSDVKRLSDFMMWQASDDTQLHFVKTYWPEFGLSDMLPILLGWQQKAWMRKL
                     GWC"
     gene            932225..933582
                     /locus_tag="CND03440"
                     /db_xref="GeneID:3257471"
     mRNA            join(932225..932448,932539..932923,932984..933582)
                     /locus_tag="CND03440"
                     /product="expressed protein"
                     /transcript_id="XM_570524.2"
                     /db_xref="GeneID:3257471"
     CDS             join(932258..932448,932539..932923,932984..933502)
                     /locus_tag="CND03440"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570524.1"
                     /db_xref="GeneID:3257471"
                     /translation="MIRRRLSSGLLRAATPSRPSPATPPARTLASAVLLTSQTKWKTE
                     TVVTLKAELKKRGLSQQGNKATLVSRLESAETSSLLPPVPPIPSSVRSISSTTSLSRS
                     GKLSDAPKTGTSSKDAEVDPNVAPGVSVTGPGPQVISQRTSAVNPDTVPPEQVTVAPG
                     LPESKVGTEGAGETLDVRMPSVSADEEIDQVIPLIPDNFSAHSYPSSASTDPKVLTVA
                     SASTHPAGGPVHASHDQSDAHSLEFAVEKLSSSVPSLESIATSVFSAPAAAWTSLGLQ
                     LPKVGVPQGGSSEYKYNSRGLNQDEKRGAWILAGVIGAGLLLGGPKKDKTSAAHAESH
                     AETQGKRVVGDAKWAQASGAGVVGHGARKD"
     gene            complement(933898..935406)
                     /locus_tag="CND03450"
                     /db_xref="GeneID:3257143"
     mRNA            complement(join(933898..934101,934165..934183,
                     934242..934322,934379..934422,934478..934542,
                     934603..934626,934684..934762,934841..935406))
                     /locus_tag="CND03450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570563.1"
                     /db_xref="GeneID:3257143"
     CDS             complement(join(934043..934101,934165..934183,
                     934242..934322,934379..934422,934478..934542,
                     934603..934626,934684..934762,934841..935228))
                     /locus_tag="CND03450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570563.1"
                     /db_xref="GeneID:3257143"
                     /translation="MLFGVGTFSLLLAVLSTSSALPADKNCTRKLDADIGTTALVADV
                     TASPTSVQSTQGVVLANVQAVSSSSVISASGTSAGAETVQTASQTNTTPSSSSASSLA
                     STSSSSSSASSDSQTFLDLHNEFRALYDADAVTWNDTLASYASDAASACNFAHTGGPY
                     GENLAAGVGAGYNITSGFNSWTNEASDYDSSNPQASHFTQVVWQSTTQIGCAVTNCAD
                     GTVFTGYGTDSVNIVCEYYPPGNVIGAFASNVAA"
     gene            complement(936121..937326)
                     /locus_tag="CND03460"
                     /db_xref="GeneID:3257374"
     mRNA            complement(join(936121..936285,936342..936713,
                     936771..936935,937271..937326))
                     /locus_tag="CND03460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570671.2"
                     /db_xref="GeneID:3257374"
     CDS             complement(join(936250..936285,936342..936713,
                     936771..936935))
                     /locus_tag="CND03460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570671.1"
                     /db_xref="GeneID:3257374"
                     /translation="MGIDIRRHHVKKGNRSAPKSEDPYLLLLVKLYRFLARRTDSKFN
                     RVILKRLFMSKINRPPVSLSRIVKETKNSNPDNSKIVVVVGAILDDERLPEVPKLSIA
                     ALRFSTAARERITAAGGEALTLDQLALRAPTGSNTVLLRGKRNVREAVQHFGGPLKGG
                     KPYVASKGRKFEMARGRRKSRGFKIKSTHK"
     gene            937584..942114
                     /locus_tag="CND03470"
                     /db_xref="GeneID:3256897"
     mRNA            join(937584..937916,937970..938856,938907..938972,
                     939023..939280,939352..942114)
                     /locus_tag="CND03470"
                     /product="expressed protein"
                     /transcript_id="XM_024657032.1"
                     /db_xref="GeneID:3256897"
     CDS             join(937822..937916,937970..938856,938907..938972,
                     939023..939280,939352..941810)
                     /locus_tag="CND03470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512641.1"
                     /db_xref="GeneID:3256897"
                     /translation="MLIPLYLAGLLLLYIPFLARTQASPSTQIPSRWGHASSYLPSPP
                     TLVIHGGKTDPDSAYSYSSAPNVGSTLFLPLNATFIAQSAPVTEIKSPSGPALAWHTL
                     SQFAYSNGTWQILSFGGDSGTSQPSQTSNNSVWLDNFDLQNYSSLQYVNQPESWGSQP
                     SNRIYHSAVTGIDDKVYITGGLKDDGSNTAFADVYLFDSSHSYFTPLPSLPDCHYHHE
                     SILLGNGSILVLGGAFTSQITSNVDVHPYTNFRRLDLSSNSASGWVEVAVTGDAPQGR
                     RGATATATGDGDKVILLGGASSDLQTVYDEIWTLDLNTLTWEKEKVAEAGTGPGARFD
                     HSAIAVDENQIIVFGGYTQTGPADGGIYIYNTVSNSWVSNFTVSAGFNSTAKKSDSEV
                     ASSTVATGSAMAKIPCTLSSSGTMVDLVSSCVLSENSDSSSQSNALAVPSSTIAINSG
                     DSGAYSHSLTVPLVIGLTIGSVGLAGALLAVCMWRARRRLTRRKAYGDPSYASSPRSR
                     TFNPIRRHSPVEEEGPKLIDEMMDEKGTNVHKEMENPRTEAGTLSAVIAFRLEVGAVG
                     RGFSSISSRIRGSRWDSRPYSELTDYSPNDAQAMPHPPAPARQMGIGIHLLGPPLRRD
                     KSLYYSPSNSTAHVTSVAQDNRIGIFCDEDSTRSEHHRRDPVHFEELPGTKECGVLRS
                     HAGKWYSANSNNGAEEKEVGAPSQLPSQTEAVPMPQISITKANKYGSYCSPYESLQYR
                     LPNFRPSEPLEFPGVTNAFPIPGYGSLRSNPHSAHIHESLTSRHSDDMDESGQDVHVA
                     IENQPSPTIQNPLHRKGSIFKRMAEASASVLLGRRPSQASGRLSMNQLEIRDPAPQPT
                     LWPVLSQVQLCSVGIATPSLVAHENRQHPPVSWRDNVSQGLLPNDSYGPSISSLKSFR
                     SMRDMIIVQKEETQDNIETFRIIDEDDSGGSPEPKAAGLTTHLQRRESNENMCTPKED
                     HGEIDGFTCKQEPSREGWEATILMDSLAFEPRVLDLSLKAIVDPGAFTDSSAILKTAG
                     LLDTESVAETESGLSDSLSHGSDKNSSLEEAASGTPQTDPSIFSHSPGETKPPHEHVT
                     PLSAESSFDFCATSAGKARRRPVREVVNSINKRGDNTPMGLLAPRSFYSPAPGSSSGG
                     MKVHSGPISKSTMSSDDADPSGICNPFVTSESEYVSQSMRPTSTSPTFKGPIAPHDTA
                     IIPKQRETPVGQVKTKTMWEMVKREETLRIANPDAASVSESKKPLPDFHG"
     gene            942290..943435
                     /locus_tag="CND03475"
                     /db_xref="GeneID:36392831"
     mRNA            join(942290..942337,942411..942844,942912..943087,
                     943159..943435)
                     /locus_tag="CND03475"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658487.1"
                     /db_xref="GeneID:36392831"
     CDS             join(942521..942844,942912..943087,943159..943339)
                     /locus_tag="CND03475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514341.1"
                     /db_xref="GeneID:36392831"
                     /translation="MSFFSVLFFVLVAPLVFANTLQYKLHHRFVPVQASAGSPPSFSP
                     LGHLVLSSAEDGSPINPQIIPLSTTAQVEPQETADSAGWYQVGLQVKEGDSDDDKDWL
                     IASTRASYLAGPLLVKLHMEGTQLVSLSVHPLTSRSYDDSLSTVSLPQDISIFQLTIM
                     DSQKTRPPPMGTSMMIDNDTGAPVTPPPEKSFLQKYWMYIVGIALFFAAQMGPEEPRN
                     QNKGGSGK"
     gene            complement(943390..945643)
                     /locus_tag="CND03480"
                     /db_xref="GeneID:3257473"
     mRNA            complement(join(943390..943578,943634..943845,
                     943898..943926,943988..944080,944132..944464,
                     944524..944735,944790..945052,945106..945191,
                     945252..945416,945476..945643))
                     /locus_tag="CND03480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570562.2"
                     /db_xref="GeneID:3257473"
     CDS             complement(join(943445..943578,943634..943845,
                     943898..943926,943988..944080,944132..944464,
                     944524..944735,944790..945052,945106..945191,
                     945252..945416,945476..945607))
                     /locus_tag="CND03480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570562.1"
                     /db_xref="GeneID:3257473"
                     /translation="MLARVLTRARPQRNLLTQRFSTASAPRTKYTYRTTALLAGIASA
                     GIAVAYQSWNPVRADELSNAQAPGVSTVQPSGQKLVSFEEVQKHNKREDCWVIIDGKI
                     YDVTDFLENHPGGAEIIIANAGKDATKIFKPLHPPDALDMLDPSQHIGPVDPATMPEP
                     EEEEPTEEDLRMEEARKSMPGVDGMLLVQDFEDWAEKVMSGTAWNYYKSAADREKTAA
                     ENEKAFDRYFFRPRILRDATTGSTETEFMGMKTTMPVFISPAAMAKLGNPLGEVNLTR
                     GAGACGIVQGISINASCSLDEIMTARKEGQPVMFQIYLNKDRAASIALLKRVTALGAN
                     AIIFTVDTAWRSKRTMDVRAKAHVAPPPSSSGQQKSASPLGVSQAISGYQDTNLTWKD
                     IDFIREHTNLPIIVKGVQCVEDVDLCAKAGVQGVILSNHGGRQCDYAPAPIDLLYELR
                     CKRPDLFDKIEVMMDGGVRSGADVVKAIALGAKAVGIGRSFLYANGTHGEEGVVRLCQ
                     ILAEEITNTMRNIGAPRLEDLKPEMVGPAGPWVGNNAPPYVKTQ"
     gene            complement(946255..948058)
                     /locus_tag="CND03490"
                     /db_xref="GeneID:3257092"
     mRNA            complement(join(946255..946790,946843..947060,
                     947114..947305,947356..947755,947811..948058))
                     /locus_tag="CND03490"
                     /product="chitin deacetylase-like mannoprotein MP98"
                     /transcript_id="XM_570561.1"
                     /db_xref="GeneID:3257092"
     CDS             complement(join(946387..946790,946843..947060,
                     947114..947305,947356..947755,947811..947973))
                     /locus_tag="CND03490"
                     /codon_start=1
                     /product="chitin deacetylase-like mannoprotein MP98"
                     /protein_id="XP_570561.1"
                     /db_xref="GeneID:3257092"
                     /translation="MIPSTAAAALLTLTAGVALAHPGCGGQEIGRRNVGGPMVYRRDV
                     TDEASAAASTDVNTECTAYGYAPVTEIASSFPTIWETASILSNDTEGQQLFATINSTL
                     NTKLPNDVPHGTPTGDWTGVNYNSSDPDCWWTHNKCTTPASDTGLEADITIVPEPMTW
                     GLGFDDGPNCSHNALYNLLSENNQKATMFFIGSNVMDWPLQAMRAHDEGHQICVHTWS
                     HQYMTALSNEVVFAELYYTQKAIKAVLGVTPQCWRPPYGDVDNRVRMIAQALNLTTII
                     WSDDTDDWAAGTDGVTEQDVTDNYQAVIDKAGNGTYTTHGPVVLNHELTNYTMSVFMT
                     MFPKIKSAFSYIVPMCTAYNITQPYLESNVTCPNFETYISGVTNISSSTTQKDGSSST
                     NTSSSGSGSAAGSASATSSSDDSSSSGSTSASSSSSNASSGALGMFDGLSGVGLVLSG
                     VFAGVMLL"
     gene            complement(949232..951060)
                     /locus_tag="CND03500"
                     /db_xref="GeneID:3257023"
     mRNA            complement(join(949232..949476,949534..949656,
                     949705..949879,949928..950143,950194..950385,
                     950445..950521,950586..950618,950674..951060))
                     /locus_tag="CND03500"
                     /product="arginase, putative"
                     /transcript_id="XM_570161.2"
                     /db_xref="GeneID:3257023"
     CDS             complement(join(949355..949476,949534..949656,
                     949705..949879,949928..950143,950194..950385,
                     950445..950521,950586..950618,950674..950932))
                     /locus_tag="CND03500"
                     /codon_start=1
                     /product="arginase, putative"
                     /protein_id="XP_570161.1"
                     /db_xref="GeneID:3257023"
                     /translation="MYGRLGVSILLMAAASNVLAKIQEDDGYSEQLDPWNDEYANTPD
                     LSFSGVASFAHLPHKRCLDVKDAAFDIALLGVPFDSAVSFRPGARFGPYALRSGSRRQ
                     RPDRGYNSRLEVNPYSGDLSILDCGDVPVTPFDPATAVKQINSAYRSLLHHPVVSPEK
                     MQNLNMQRGLDGKIHPRIITLGGDHTIVLPILDAVHEVYGPVSVIHFDAHIDTWNPHR
                     YVGSVSVQASLNHGTFFWHAYEKGFIKPNSSIHAGIRTRFGGPQDLEDDVTAGFDLIH
                     TFDLDDFGIDWISEKIKNRIGDGPVVISLDVDVMDPAFVPATGTPESGGWTSRELRRI
                     LHSLIGLNIVALDIVELSPAYDTNAEISAIAAADMVYDFLSILALGVEHRNDGVSGTK
                     TLKDEL"
     STS             950222..950783
                     /standard_name="Stu4"
                     /db_xref="UniSTS:470943"
     gene            complement(954990..960025)
                     /locus_tag="CND03510"
                     /db_xref="GeneID:3257310"
     mRNA            complement(join(954990..955520,955569..955938,
                     955992..956084,956141..956634,956692..956879,
                     956930..957813,957862..958224,958275..958857,
                     958908..960025))
                     /locus_tag="CND03510"
                     /product="calcium-transporting ATPase, putative"
                     /transcript_id="XM_024657033.1"
                     /db_xref="GeneID:3257310"
     CDS             complement(join(955241..955520,955569..955938,
                     955992..956084,956141..956634,956692..956879,
                     956930..957813,957862..958224,958275..958857,
                     958908..959882))
                     /locus_tag="CND03510"
                     /codon_start=1
                     /product="calcium-transporting ATPase, putative"
                     /protein_id="XP_024512640.1"
                     /db_xref="GeneID:3257310"
                     /translation="MSRDNPPPVIITTDPDSPPPRSAPSTPPPNERPTPTLVIPGSPS
                     SESRQESPQGYDPFRLSPNARLYPPGSGHSPSSSYSSALTPPSPTLTSCSSVHFSDEL
                     PTPSSPNPKTSLALRENHPDAHSGMETLETVDENDPQRRHARGWSIGTWSSAAPTTDG
                     HSMKKPLIRTAIEANEIDEDRGEGGANKKGKKGKKGKKDKEEPPSAHLDPDKDKTDPT
                     PFREKPSRLAMLVDPKSLEDLEKIGGVSGLLEGLGVDGAKGLAVGTDEGNAENGAPRS
                     SADMPGGNGPQWRASMDHRREIYGRNDLPRRKSKSLLLLMWLAFKDKVLILLSIAAVV
                     SLALGIYQDLGTPPKIIYNDECPDGCEEAQVDWVEGVAIVVAIIIVVLVGSINDWQKE
                     RQFKKLNEKREDRSVKVIRGGSEMVINVKDVVVGDVCLLEPGEIIPVDGIFLRGHNVR
                     CDESGATGESDAIKKFSYDECIKERDHLQPGQKQKKDCFLISGAKVLEGVGEYVVIAV
                     GPTSFNGRIMMAMRGDADETPLQIKLNYLAELIAKLGGASGLLLFIVLMIRFFVQLKT
                     NPDRSANDKAQSFIQILIIAVTLVVVAVPEGLPLAVTLALAFATKRMTKQNLLVRVLG
                     SCETMANATVVCTDKTGTLTQNEMTVVAGSLGVHGKFVKDLSDNASRSNANEEGHSVR
                     GDFAFDMDQLNDYASSSLQTLFNEAICINSTAFEDKNEEGKLNFVGSKTETALLRFAK
                     DMEWPDYRQVRESAEIVQMIPFSSELKAMGVVVRKGDTYRLYLKGASEVLSNNCTKHV
                     VVHQDDNKGDDIETTEFDDDAMSNISKTIIFYANQSLRTIALCYRDFKSWPPAGTEKD
                     EADEVPYEAIAKDMTLIAITGIEDPLRPGVKEAVEKCQLAGVAVKMCTGDNVLTARSI
                     ASQCGIFTAGGVVMEGPVFRKLSDSDRLEIAPRLQILARSSPEDKRLLVKTLKSMGEV
                     VGVTGDGTNDGPALKLANVGFAMGIAGTEVAKEASDIILMDDSFKNIVLAIMWGRCVN
                     DSVKKFLQFQISVNITAVFITFISAVASSSEESVLTAVQLLWVNLIMDTFAALALATD
                     PATESSLDRKPDRKNAPLITVEMFKMIMVQAIYQIIVCLVLHFAGLKILGLENNDQNN
                     TELGALVFNCFVFCQIFNQLNCRRLDRKLNVLEGFWRNWYFIIIFLIMVGGQILIVEV
                     GGAAFQVTRLGGRDWGITLVIGALSLPIGALVRLTPTAQFARLLIKLRIYSDPNKLPE
                     QSPEAEEEQYSYNPALSKVKDNLSTYARIRGGRLRASSMVAKSRSSQLRDADIQLPSL
                     LTMVPTVIAGTVGAGAHWVTPHNSIGLSNPAGQDPSYSTAELYKGKVQLHPQTNPNDP
                     LYARFGLQPPDSRGSSVSGAKMFSSGDTNNV"
     gene            960763..966033
                     /locus_tag="CND03520"
                     /db_xref="GeneID:3257063"
     mRNA            join(960763..962016,962068..962297,962344..964218,
                     964267..964466,964516..965569,965630..966033)
                     /locus_tag="CND03520"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_024657034.1"
                     /db_xref="GeneID:3257063"
     CDS             join(960968..962016,962068..962297,962344..964218,
                     964267..964466,964516..965569,965630..965637)
                     /locus_tag="CND03520"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_024512800.1"
                     /db_xref="GeneID:3257063"
                     /translation="MLPTSSRPIPFSSLLISFIHVSSITAVASTIAPASLPQVDFSKM
                     GTVALGGSFSGLDWWSSESPFASSATGNPTFSSDGDTLFHRPTDGQFRALATTNSGGV
                     INALCWSKDGSANNGTLYVGGVFESLSGVSASNIASLTLADNSVTALSGGLSGEVNTL
                     YCDDDSSQIWVGGLFEAPIGSGGNVALWSTSSSTWVTPEFGGFNGRVQSIVPSIDNSS
                     IYFGGDFTTRFVQNSSILFNSTSNTNNTFGNVTSTPSVSENVTTVGDSGYLTPLTVSA
                     SASSSAAYSIQAGPSSTQSEYSDTNVLLCPGSGVWLAQEDTVSNVNLVGQGYLSATGI
                     RVVNGLVQGRGTTYFCLTILPTYTELNMTYTDPVTGELGTCTSHCPLYTNSSISAQDF
                     IFTAGTQNLTGFEMQLKEWIGDGAALSSVALLSDGAYLSAVSDGGSSCTNGAKNGSVQ
                     TVGSWDATTVATNSATESYLSSSVSLGDSQRPQVTFYPYVSSAGNYDIYVFIPGCLNA
                     GDCDSRTSVDVEVFPFSGGLGWTSTISEQVDYDTKTLIYSGPVGATTDSFTPTISLAL
                     SSDPYKPARGHMYTVVADRVQLTFIGTDGSVSSTPLLNNGTAPDDYTGSNATTVGNSS
                     WTTNSSYNVAFGLFEWPRSSKLNTNAASNALSNVTETALTRLGFALDAALNASGSSAS
                     SWAVNTIVSMDSTVFIGGDFSSTNNYTNVLSIDASSGETSALASQGLGGIVNTAAVVD
                     GYVFFGGDFTSTASSGGVALNYLARYDPATKAWAAVGGGVDGYVTDLMASPSSTELFV
                     MGNFSHVINSDGSLNETGGFGVWDISSERWTSSGVVFGNISAGEMISSSPSIAYLAGR
                     VSGYADNSADGLAMLSTDQNGLAKISSLTGASFSTTGSSSSLTTSRRRSLEIKSSYSS
                     SWLSRFAGGLVERALPGLAARATAPVIVTPSFPAPAVLAVDYWTNTSTSDSPSMMILG
                     GNFTSSSANVRGMAFYSTSQQTVDGPEPPVSGVVRALEVIDDRLYLGGEGVNVEGIGS
                     GLLVYNLVNGTWMEGGMASLNTASDSNVTINQIRTRPTTNTLIVAGSFTSAGSLSCAA
                     ICLWDSTNAQWSTLGAGLLSGEVRSIDFAGNNYDTLVAAGSFVLSDGTVASVASYDFD
                     SSSWTALGSLSGPTLAVAVDEKNVTNIFAAGYSASDGSPYLEQWNGNTWTAQNETLQS
                     GSLVYQLAFVPMSSEHTAVGSIEKDRMLMVSGNLYLDQMGNATSALYDGVNWYPYLVG
                     TSAAGGIGAGASLFWSDSDFSFKVKHYLARGLVVLVAIAIATGIVLLFILLALLVAYF
                     NRRRDTQAAQDRQEIYGKEGSDVSSTHQNVFANVQAALEASLAGGAGTMMGLGTSRNS
                     APSQARLSNPSSYASGAYPMASDDEYDEEEEEGDERETTMRYDFEGPELQEGEMSMKA
                     GQPLIILDDQQSHEWWYARDPATGREGMVPASYVW"
     gene            complement(966031..>970171)
                     /locus_tag="CND03530"
                     /db_xref="GeneID:3256961"
     mRNA            complement(join(966031..966524,966574..966840,
                     966914..967019,967086..967253,967306..967663,
                     967722..967890,967957..968715,968766..968833,
                     968890..969423,969490..>970171))
                     /locus_tag="CND03530"
                     /product="spore wall assembly -related protein, putative"
                     /transcript_id="XM_024657035.1"
                     /db_xref="GeneID:3256961"
     CDS             complement(join(966408..966524,966574..966840,
                     966914..967019,967086..967253,967306..967663,
                     967722..967890,967957..968715,968766..968833,
                     968890..969423,969490..970171))
                     /locus_tag="CND03530"
                     /codon_start=1
                     /product="spore wall assembly -related protein, putative"
                     /protein_id="XP_024512758.1"
                     /db_xref="GeneID:3256961"
                     /translation="MPPVPHPPARHPHSENSPTPLLKPSPAILTQVPPPRPPADPSLH
                     VLPRRFLGPIPGKVLNSSHLQEKRRHFYDLRRRAAYKVRHELIGRKDSLSGLEEDDPD
                     EGILRRAALKIGIPGLGQNGDREEDFSPESDHESESYGPQTTVGKETWFGESFDIGRE
                     FESEGHDNDEPSILATRDTSVRGSGSPDQNRRQKYTQQQRHLAPHRPSNATRSTEETF
                     FTARSQNSEAIESSIDDCPTPVLEHSPDTQLSQSSSRQPLIRSAQNRADQHPPQWIDP
                     NTKKGKGPANQSLSSSTFTVPQKLKSAFRHTSESPVGAAEPPGIDKSRMRDLPQKTKS
                     VQFPMDPIHSVASETGKTKAKDRNSPIDPNMVLSREGEEVQGTSSGAAADAMVEGDKS
                     QELLARQGNVLYKDRMLVRVGYHREENILSFDEASQRRNPCSKLDPFEEYIVVWRKGF
                     VELYQEWRMPLRERMTGSKRLCFAIPLMPHRSSLSIFNPDDLTLCLTTSVEKLQLEVE
                     ALLKSPKTSHISDLKNRMAQSSQVQWLRGHKKGTQIFILKLPERSRALDWYWELWRDL
                     GGQLPERFDISVPVVSTSIRMGIPRDVDNGQADSGQLLRHFCPDTVIRTCWEMLQKET
                     AFNDIVQQGRLQGIKDEVDLQLVWKAGDGMLDWVAYLETVEGKKRPWALLAGLARLQN
                     NPSPRELQLRPARHHPKSMKLEDGTILEEPPGIEGYLFRIHGPTTRSTIYLASHDGCL
                     FITNMKDSEPPLLPNQEGSTPSKLFSEVHKEFLENERRRMASVIRRSAGCIDMRDIAM
                     IQYPSPAGKDADGRRDTFELRFTAGGPMKLEAHTPEIAQEWVECLEALKSYWNHQHRV
                     EARQRMDAMSAASGRTHGDGIDEFLGEIWNWCTIRGCRPICLSGRLYMKQGAHEKFRL
                     KYMALSQGSFVSFEVTGKASFHVRKKNYPLFGAYTYSGLLAHDEIHEPHNRDAFLPQH
                     RVYQDGLQSFDGPEDTTFCVRLAISGSHSGANANDPWDSSDYRDHTSMKLSKSPTSLL
                     IFRARSKLERDRWVWAINAEVERQARAHLDQQNLFRAYGKVIDRW"
     STS             970076..970675
                     /standard_name="Eco33"
                     /db_xref="UniSTS:470942"
     gene            complement(970224..974520)
                     /locus_tag="CND03540"
                     /db_xref="GeneID:3256971"
     mRNA            complement(join(970224..970426,970487..970644,
                     970701..970755,970802..972895,972941..973999,
                     974051..974367,974427..974520))
                     /locus_tag="CND03540"
                     /product="DNA-dependent RNA polymerase II RPB140,
                     putative"
                     /transcript_id="XM_024657036.1"
                     /db_xref="GeneID:3256971"
     CDS             complement(join(970379..970426,970487..970644,
                     970701..970755,970802..972895,972941..973999,
                     974051..974367,974427..974436))
                     /locus_tag="CND03540"
                     /codon_start=1
                     /product="DNA-dependent RNA polymerase II RPB140,
                     putative"
                     /protein_id="XP_024512654.1"
                     /db_xref="GeneID:3256971"
                     /translation="MDAADDYPLASQPLDDGFTYDPDYDYSQQTAPKGDEDEEKYDVD
                     EDEPISQEDYWTVINSFFEEKGLVRQQLESFNEFIENTMQEIVDDHSRLTLDQFTQYT
                     GVAGDETRRYEISFGQIYLARVNHTEMDGRTNMLFPQEARLRNLTYSAPLYVDIKKRT
                     LTASGVDDPVEADWQPAVGDDGEVEGAEEEKTSIGKVPVMVRSNFCLLHGLPDDQCHE
                     IGECPYDQGGYFIISGSEKVLIAQERMATNHVFVFLKAAPARFTYFAEINSQKEKGGR
                     VANHTEVRMYARASGTTGGVIRVSLPYTKVDIPLVVVFRALGIVPDRDVLSHICFGAE
                     DEALLEMLQPSIEESFAVQDRDTALDFIGRRGQHEKAPRAQRQRAAFDILHKEFLPHV
                     STAEGFESKKAYFLGYMVHRLCMAALGRKELDDRDHFGNKRLDLAGPLMAEMFNVVFG
                     KLREDMYRYLKKCVEQNKEFALNMAIRPNTITDGLKYALATGNWGKRDNTRAGVSQVL
                     NRYTFASTLSHLRRTNTPIGRDSKAAKPRQLHNTHWGMVCPAETPEGSACGLVKNLAL
                     MSYISVGSYSAPVMEFLEEWGLEDLSEYQDAPTATKVFVNGVWMGIHRDAPTLHNNLL
                     QMRRGGQLKYEVSIVRDIRERELRLYTDAGRVCRPLFIVDQPTQTLRLKRDHIDRIDQ
                     MADEGLLSGAWDKLLSEGIVEYVDAAEEETILIAMTPEDLVNARTAHSKHELVRDRAA
                     HNLESFDPAARIKSTVWSQQYTHMEIHPSMILGVCASIVPFPDHNQSPRNTYQSAMGK
                     QAMGVCLTNYQLRMDTMVNVLYYPQKPLATTRSMEYLKFSELPAGQNAIVAIMCYSGY
                     NQEDSVIMNQSSIDRGLFRSLYFRSYTDTEKMKGMVKAETIEKPDRNETLRMKHGTGD
                     RYAKLDVDGLVAPGTNVNGDDILIGKTAPLPEDSEELGQRTQLHTKRDISTPLKSTEQ
                     GVVDQVMLSTNGEGNMFVKIRVRSTRVPQIGDKFASRHGQKGTIGITYRQEDMPFTAE
                     GLVPDIIINPHAIPSRMTIGHLVECLLSKVSTLTGAEGDATPFTELTVEAVSKVLRAK
                     GYQSRGFEVLYHGHTGRKLQAQVYFGPTYYQRLKHMVDDKIHARARGPLQILTRQPVE
                     GRSRDGGLRFGEMERDCMISHGIAGFLKERMYDSSDAFRIHVCDVCGLMAVANLKKQE
                     FYCSVCRNSTQISQVYIPYAAKLLFQELQAMNIACRMYGETD"
     gene            974675..976331
                     /locus_tag="CND03550"
                     /db_xref="GeneID:3257048"
     mRNA            join(974675..975032,975082..975207,975261..975366,
                     975420..975441,975491..975640,975705..975844,
                     975892..976007,976063..976331)
                     /locus_tag="CND03550"
                     /product="rRNA processing-related protein, putative"
                     /transcript_id="XM_570526.2"
                     /db_xref="GeneID:3257048"
     CDS             join(974700..975032,975082..975207,975261..975366,
                     975420..975441,975491..975640,975705..975844,
                     975892..976007,976063..976257)
                     /locus_tag="CND03550"
                     /codon_start=1
                     /product="rRNA processing-related protein, putative"
                     /protein_id="XP_570526.1"
                     /db_xref="GeneID:3257048"
                     /translation="MPISKKETRKLKSNKKLAPSKAEESKSLDKQSYVPDEQIESGDE
                     DDQDVSEEGMKRLMELVDVDDLNEYERALLGAEQGEEDEEGGSEGEEFEISAGESVDE
                     DEEEQGQNKKQDNTIINEKPDDDVVSLDGLGSDVSVDEDAVPMQKVTINNKPALRALT
                     DSIRVTNMSWPEHLVLDSKETADVDPSDDLQRETVFYKIALGCIPQARKLASKHDIPF
                     TRPGDYYAEMVKSDEHMERVRTKLVEEAQGIKKSEDAKKQRQLKKFGKQIQHEKLRQR
                     EQDKKSFEDRVQGLKRKRKEGMELGDEGEEFDIAVEDAMEEQPQKGGRAAPGKSKMPR
                     HARDAKFSLGGGGRRSKQNTRESTMDFGGGMSRGKGGKADKAGKVQSKGRPGKSRRQA
                     GRV"
     gene            977354..978543
                     /locus_tag="CND03560"
                     /db_xref="GeneID:3257329"
     mRNA            join(977354..977558,977631..978543)
                     /locus_tag="CND03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_570669.2"
                     /db_xref="GeneID:3257329"
     CDS             977692..978315
                     /locus_tag="CND03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570669.2"
                     /db_xref="GeneID:3257329"
                     /translation="MFCDTQQPHTSPSTYIHQHSTMSSHSHSQVSFPSSYLHHSQPHI
                     SSLTRPSFPPAHSSPNVLYSSQSNHASPSSYQAYTAPSSPGGSPSGATVSQSQQARRF
                     ARPKPLKKSSSTNGKHRNVQVSLEVKVEKAKGFHAFFVPHCKGGVPPAPPCSPVLGHG
                     SLKERRDMDGGNEATSLDYFGTWSKHGEKESEQWVENVEEDMEVDRI"
     gene            complement(978477..980382)
                     /locus_tag="CND03570"
                     /db_xref="GeneID:3257152"
     mRNA            complement(join(978477..978619,978683..978706,
                     978769..979003,979047..979077,979132..979216,
                     979273..980382))
                     /locus_tag="CND03570"
                     /product="arginine biosynthesis-related protein, putative"
                     /transcript_id="XM_570202.2"
                     /db_xref="GeneID:3257152"
     CDS             complement(join(978608..978619,978683..978706,
                     978769..979003,979047..979077,979132..979216,
                     979273..980316))
                     /locus_tag="CND03570"
                     /codon_start=1
                     /product="arginine biosynthesis-related protein, putative"
                     /protein_id="XP_570202.1"
                     /db_xref="GeneID:3257152"
                     /translation="MPPSIPVPSIVTRAIPSLARAASTTTKSTPSKEHHVHSYSPEVL
                     PLGYAVASTHASIKKKTGALDLGILVSTTDKPASAAACLTRNVFKAAPVTVTTQLLQS
                     GGGRARGFIVNSGCANAVTGKKGLEDAWEMSNTVTSQLPPGQRGIGTLVMSTGVIGQP
                     LPISSIISKIPELVRSLDDSPKSWLDLSKSFMTTDTFPKLRAKSFRLGERLVRIAGID
                     KGAGMIAPSMGPPQPPHATLLGVIATDAAISPPALQSALNYAVDRSFNNITVDGDMST
                     NDSIICLANGAAGKLETQGRETAESMEEITEDGHPEEYKVFREELRSFAEELAQLVVR
                     DGEGATKFVTIRVKNAPSYETAQAVAKSIANSSLFKTAMYGEDANWGRILCAVGYTPT
                     AQAIIPNHVSVSFIPSANVSDPTPLRLLTNGEPEANIDEDRASVILAEEDLEVEVDLG
                     DGHEEAKVWTCDFSHEYVTINGSYRS"
     gene            981983..984230
                     /locus_tag="CND03580"
                     /db_xref="GeneID:3257267"
     mRNA            join(981983..982100,982212..982289,982376..982531,
                     982596..982834,982898..983013,983078..983148,
                     983201..983380,983428..984230)
                     /locus_tag="CND03580"
                     /product="chitin deacetylase, putative"
                     /transcript_id="XM_570200.1"
                     /db_xref="GeneID:3257267"
     CDS             join(982390..982531,982596..982834,982898..983013,
                     983078..983148,983201..983380,983428..983912)
                     /locus_tag="CND03580"
                     /codon_start=1
                     /product="chitin deacetylase, putative"
                     /protein_id="XP_570200.1"
                     /db_xref="GeneID:3257267"
                     /translation="MYGHLSLSTLSLLAVVAAAPFPESWLQPRDSDVSQLFRRGAPDP
                     KASDYLSYYPSPGSTPNVSTIPQAWLDKLATVQLPNVSVATANDGRPTYPNNENDGDS
                     EICSFTDQCYVEDDLYSPPGEKVWALSFDDGPTDVSPALYDYLAQNNISSSATHFMIG
                     GNIITSPQSVLIAIEAGGHLAVHTWSHPYMTTLTNEQVVAELGWTMQALSDLNGGRIP
                     MYWRPPYGDVDNRVRAIAKGVFGLVTVLWDSDTNDWAISDQPDQYSVASVEAYFDTLV
                     TGNRTQGLLLLEHELDNNTVEVFETEYPKAVANGWSVKNVADAFSMKWYLNSGKGNDD
                     VVTTMSVAGTLTTAKPTHTSTSVASATATSSASVTDSAGVSIASAASSQESSSWPIAN
                     RPSLFVIACGLALAAIMV"
     gene            987149..988785
                     /locus_tag="CND03590"
                     /db_xref="GeneID:3257228"
     mRNA            join(987149..987454,987510..987739,987792..988038,
                     988091..988237,988303..988389,988444..988613,
                     988675..988785)
                     /locus_tag="CND03590"
                     /product="enzyme regulator, putative"
                     /transcript_id="XM_570198.1"
                     /db_xref="GeneID:3257228"
     CDS             join(987227..987454,987510..987739,987792..988038,
                     988091..988237,988303..988389,988444..988613,
                     988675..988690)
                     /locus_tag="CND03590"
                     /codon_start=1
                     /product="enzyme regulator, putative"
                     /protein_id="XP_570198.1"
                     /db_xref="GeneID:3257228"
                     /translation="MDQQQVSPSISSDVQQSANQHVPSQAKPRARLGPTEVVQLPASD
                     SEPDDEDGNNQETDAGGDGSPDFLKDYPEDTEDLQLLHLRLKTPLLVPLNFPRFGNHL
                     KRLCLRQNELTSPLPSGAFANLTELEELDFYDNRLGPHVRDEELAGCPNISTLDLSFN
                     NIRHAPSLPSLQHVNTLYLVQNKISRLEKGELDWCQDTMKSLELGGNRIRVIENLDKL
                     IHLQELWLGKNKIRVLENLSTFSSLRILSLQSNRITKLENLEGLVNLEELYLSHNGLQ
                     KIEGLHHNIKLTTLDVGNNFIKEIENLSHLSNLEEFWASNNQIGSLHALESELRPLTN
                     LCTIYLEGNPCQKEDMGNYRRKIMLALPQVKQIDATYVKA"
     gene            complement(988773..991587)
                     /locus_tag="CND03600"
                     /db_xref="GeneID:3257109"
     mRNA            complement(join(988773..989320,989373..989785,
                     989832..990810,990911..991587))
                     /locus_tag="CND03600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570559.1"
                     /db_xref="GeneID:3257109"
     CDS             complement(join(988970..989320,989373..989785,
                     989832..990810,990911..991327))
                     /locus_tag="CND03600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570559.1"
                     /db_xref="GeneID:3257109"
                     /translation="MSVAVPPPILLATRPTIMSKPSAPRIQSRPSPSSTSSLSTRPVA
                     AKSTQSPLNSAISSGSTPKVAVKSVATNIPTSARPSPAPRANSSSSTSTAVAATPIMG
                     KDTSSSAGKIFAKPSKEWVLPERAKPGRKVSNDEPDNKRQSQNRLSQRAHRARRTDYI
                     QTLEERLRQYEADEIHSNVRLQEVARALKADNERLKAEVNELKNKCMEYNGEKDVWEM
                     ERRTLKEAVRDMRIEIEALRAGSGMETIVRMDIDQSTIDSLVPGPSIPRRQSAHRLSP
                     RSASRPGNVTLQDCPICPNPDPDCPCQRPHARQEQYPPEHLTLAPSAAEDHAVACGLC
                     HSTDECLCRAVDEDVKPDISSPSHDLKTLDDDRCGLCTGGDFCACREAAAAASVRTSV
                     TSDTKTTVATTTAVSGIVTASSSSAALPLRLRTKGNGSAKASIWSLNAAPAVSREAIC
                     TGDPSNCDACRDDSFGREFCQHLFEAAESSSSVKPCSSCPGNCMNVKAGLSPSPGITQ
                     ASSSSSNQIRTPPTPPVNQPSAVEDDTPLAPLQMVCCGNAELCGGSRGGGCTDDIIGI
                     GGPSGALQASMSFPSVPEVDEDDNATLRPDQAWKQLKAHPNAKFASLALLADVVARRT
                     KCLGPRVEMSPTPASPAPTVSVPMSVPVIAHSASSRPRQPMLGSPDIPNTQQKRRNIE
                     VETSAVRDALKLLDKATPAPSPEPDRELKRRRIERIL"
     gene            complement(991999..997233)
                     /locus_tag="CND03610"
                     /db_xref="GeneID:3257389"
     mRNA            complement(join(991999..992456,992532..992573,
                     992635..992704,992797..994232,994303..995415,
                     995470..997233))
                     /locus_tag="CND03610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657037.1"
                     /db_xref="GeneID:3257389"
     CDS             complement(join(992361..992456,992532..992573,
                     992635..992704,992797..994232,994303..995415,
                     995470..997164))
                     /locus_tag="CND03610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512757.1"
                     /db_xref="GeneID:3257389"
                     /translation="MAPHEKGVNPSESPSGSLKKAPPSGPKALRGFASPSAFRNADIG
                     NGLLQHRGEDERISFAFPRKGKESLDRNGERPAPMSLESRLGPPVSRFNRPVGGDSLE
                     RGNGKGGWDNRDERTSASSSSIHRINKEKIRPRSDFIESSANLYSEDDRNRDRGRYHE
                     RDRSRGTNGDRGGGEGHSHREPGRGKEHQNGQGRDRSLYRDHSRERESSRDERDRYSE
                     EYKHQRSKARFSPSPSPERSRLKSSLGRHRSPVSVSSSSSSSARSPPPVQNREPLRYN
                     GSQSKNGEKELSNGLLENSISRSGVSIAVPRKLETKQLVRPSPPHVNLKSTIQDNPSP
                     PTGKYPPSPPSLDILSKPSCNREPLPDQRPPTPPLPENSSPTSPSLESSRFDQNQHLL
                     PDELPLPPLSISFPQKPVSSSSLSRLSSLSAALSRPNPLDKDGTSMPPSFHFREISTR
                     HQRLSPPNNAENQLPETSIIPPPPSETVPEPPWIRPPYIPPPCTKHRPGIGNFFITNL
                     REKVEDKSGKEEKRVDGMEGGKVVQVTDPRLSMTEEQRGRGRGSSKQRAAFYELTYEW
                     DLYSVTPKPPSPPTAVLITGLGPLTTVDQITKFLRPHGRIKEIDSKVDRKTGMQLGIC
                     WVKFEGPPLGRPGTAHDVASMAVKVCDGKKISMGGERIRVVLDGRGKRAEQAVKEEME
                     RRYPPKKPSALPSDMKVTPLSGTAMATTSRPPNAPNASTPLIDKQTFDTSAKAPIIRP
                     GVLKPLGQKMYHRPSAPPLVFNNHRFRDESFLNRPFNAGAGMISQQQMGYKILPGKPV
                     QQLASSFTSAPFVRHPRERREDSWTNERGRRLKGESSTRHWRARSLSRSSYSSYSSYS
                     SYSEESEEERPRHPTKVPYPQRKRLATGPSKEDEYKMEDVREAIRENGHPCVFIDAKS
                     LPAAREYESYLRDHFKAFRPTEIIHSHLGWYILFADDTTAYRVQRVLDTTAVQGHRLS
                     LVVHTSSGPRAQTDASEPVTGGVGESKKGNWRYLTITKKSRPMPAVKKSGKSATIRRK
                     VYSPSVSGSDDDDEQVPVMAQNRKRAPSYASSTSPLSEDDRPFARSVQREERDIDKEG
                     KFSLIGKKEDVVSVKAAKGPKSKTIRVDSDEVEENQGVPLASIGEVTKAEGKQDDSTV
                     VKLETLLSESISELTKGKKRPTKAKGGKATKKVRLDQEADDAATKIQIDEDIVPQPPK
                     KKKVVKTEVDKLLASGVLMDEEDAYWLGRVLAAQEDGLEPIWSDGEEDLVDEGHPLFH
                     KSGAWRAEGWKKVAQVQKSRYLPQRNRAVVNSEDVGGITTGRTARLAGRDQHRQTAAV
                     AANNTVESDLFAFNQLRIRKKQLRFARSAIEGYGLYAMETIHAGEMVCEYVGDLVRAT
                     VADVREQRYLKQGIGSSYLFRIDNDIVCDATFKGSVSRLINHSCDPSANAKIIKVNGQ
                     SKIVIYAERTLYPGEEILYDYKFPLESDPALRVPCLCGAATCRGWLN"
     gene            complement(997533..999616)
                     /locus_tag="CND03620"
                     /db_xref="GeneID:3257019"
     mRNA            complement(join(997533..997801,997853..997918,
                     997967..998117,998173..998739,998790..999616))
                     /locus_tag="CND03620"
                     /product="expressed protein"
                     /transcript_id="XM_570557.1"
                     /db_xref="GeneID:3257019"
     CDS             complement(join(997641..997801,997853..997918,
                     997967..998117,998173..998739,998790..999338))
                     /locus_tag="CND03620"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570557.1"
                     /db_xref="GeneID:3257019"
                     /translation="MSKLAVTPVNKSTGLMRRHPSIRASDRSPFGSISEGVKVQLHYL
                     PPTAFIVDHSPPTFHRADTVGEPDREGAKITPFPDEQSLQIFENARIKVQDDDPFGAG
                     HRQLSKNKGPKTFSSVAPERSSHFGSRGSIRPQLSNHHSQGYRHSSASGPRDLQLLQQ
                     VSRSASMEKMPPPSDIIQQKREHLSNNNHTNPHLAVQGHSGVSRLSQSGRDVSQSHPQ
                     IVCPTNTFVDDCPQIIAEPSQYMSRDSETLDQPPNVTASQQRGQELNLHYDKHFHTPT
                     TNRHQVEANINHPDHCGSSNVAGTHGHVHRPDASLDDEFVAKGSFQGLIFEDDSSMTD
                     FDGTEQTPKRTPDKRRAMDNESENIFNFTPRAEGHPNPRKNKRCRFVIPKGFSDHLTI
                     IKGVDPQDILFKRMKTTQVFDHGGKWTGPNEILEGQINQFESIRRRWEGFFGRLEDLV
                     QTKDAVLQHKQELTKQYADAGEQLAEQCDEIQLATRHTHKRRRICIA"
     gene            999890..1002852
                     /locus_tag="CND03630"
                     /db_xref="GeneID:3257213"
     mRNA            join(999890..1000016,1000062..1002852)
                     /locus_tag="CND03630"
                     /product="expressed protein"
                     /transcript_id="XM_570569.1"
                     /db_xref="GeneID:3257213"
     CDS             1000079..1002721
                     /locus_tag="CND03630"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570569.1"
                     /db_xref="GeneID:3257213"
                     /translation="MSNKVNGLTCLSSALRNKRPKISLRLCKSQPLASEIPLPDGPGC
                     SRWLSCSCCRPNISKRTFFTSNHLSEASVVGSPLTKGLERPSPEEEQRPILFVPDTSV
                     ATPHLPLPPTLPYSPNSHPFRRHLSILSLSLLSTDTDKSWFVYTALHPSLRRHLPDEM
                     FRALLTKQTGHGDGKEAWKRVRELLLLSKQCEMDLEEIGKEALEKCLTLGLDLALRVG
                     KTDPKTVKLLRKLWKSLASLSNNLETIPLHLRQDWLHLQAILLDLRQKHETRAWRLNR
                     PSPMEETILEMVERNGLSGLGPTVGRILLRMRGGSEEGLKQALRLVAWSVNKKAEVKM
                     ENVVEVMTRLGAAWGTEGRDGMRTLELEIDTILKEVEALPCSPAEELFGQALRSVEGK
                     INLLKNTLSSLEDRTLDYESLTRKCFELCAKAKRVKENEILPIMEATLRLLEIALQYP
                     EEDPIPLITSISKTLHQLLRSPLSPCVSPPIVRFTQLILQARILPALPPHVVVPLFRL
                     IIAALPSDDSYILSRKVYEFARTANPPFIWSESNSKQWRSLFQSALSRDRKHLHFASR
                     LYADYISDGLPVRRADALLMIRSIGSKPSPSRPILLERHIKDYLWFAYGRRPALVKAV
                     VQGLTGAGVRDSELALNLAQRLSLDKELQPLIILMIIGQLARSSQPAHRVKCFALLHQ
                     LSPITHPEETKWAYNTVLSYLVSSALPFPQLGNTAHEEIMPLVLSVYKNMIDRGIEPD
                     GRTAGTIIRMLTDYGLIDEALAVFGSCLDRGLAPKSHAIGRMMVRLALAKRFEEALQV
                     ESRWREVTTGIDSQKKIRAYDKGVVGARVLVDVMMGKSVDLSAAARKGWKGNKEFLEF
                     LESLKPKQDEAKEEVARIDAVEKR"
     gene            1003157..1004683
                     /locus_tag="CND03640"
                     /db_xref="GeneID:3257247"
     mRNA            join(1003157..1003463,1003534..1004296,1004345..1004683)
                     /locus_tag="CND03640"
                     /product="expressed protein"
                     /transcript_id="XM_570572.2"
                     /db_xref="GeneID:3257247"
     CDS             join(1003282..1003463,1003534..1004296,1004345..1004401)
                     /locus_tag="CND03640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570572.1"
                     /db_xref="GeneID:3257247"
                     /translation="MSATSDELVRFFPSATHEALPISIRILSTLRNLTGPGKGNELKS
                     EERAALVGVAAVLACEQIQSKDLPEQSAQKASSVSASHFRSALSLSRRLLSQQASMSP
                     QDSRNKRGDSEDAASLSSGGGLTTQEVLALVTPKTKRYSDFSLSESLANRPVRGSPLR
                     QSVARVASSAPKGQLGPEVTPGRSETASTNHNTELTPTKSAKFVNPRGINLEHPQSSS
                     IPHGKRKRNEDASPFFALRPAMSSAAYPSRSATETNRVKGMDTEDGQNSSWLRRLPEP
                     QISKVQQQRTNAKRRRNKRDWTFSEHCEEWKEGKVSVDEIMIELSDWMKKQETNSGG"
     gene            complement(1004415..1005535)
                     /locus_tag="CND03645"
                     /db_xref="GeneID:36392832"
     mRNA            complement(join(1004415..1004596,1004658..1004779,
                     1004828..1005058,1005115..1005204,1005275..1005336,
                     1005440..1005535))
                     /locus_tag="CND03645"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658488.1"
                     /db_xref="GeneID:36392832"
     CDS             complement(join(1004463..1004596,1004658..1004779,
                     1004828..1005058,1005115..1005204,1005275..1005336,
                     1005440..1005472))
                     /locus_tag="CND03645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514342.1"
                     /db_xref="GeneID:36392832"
                     /translation="MATSKIRSSNAKSPTVLAPHLPIIDKLPNGQRYTISLLSPSSLT
                     LQSQDVLYRLLDHNMRSLQSNSSFPYTEISKKEEMFDPTSRFLLVLGETPMDTRDEVP
                     PKKRQIDIQEHELFGFCEFRFDVEETLSEKLAEVVYCYELQLRPSVRKQGIAKQLIGI
                     LEDIGRLRKMEKIMLTCLKNNASALSFYRRQGFEADEIDPTRMSEEEPENGEEVDYVI
                     LSKPL"
     gene            1005632..1009946
                     /locus_tag="CND03650"
                     /db_xref="GeneID:3257436"
     mRNA            join(1005632..1005716,1005770..1005858,1005911..1005949,
                     1005992..1006092,1006150..1006294,1006346..1006798,
                     1006854..1007206,1007267..1007390,1007448..1008165,
                     1008228..1008506,1008556..1008660,1008717..1008835,
                     1008888..1008967,1009033..1009192,1009252..1009328,
                     1009393..1009946)
                     /locus_tag="CND03650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657038.1"
                     /db_xref="GeneID:3257436"
     CDS             join(1006050..1006092,1006150..1006294,1006346..1006798,
                     1006854..1007206,1007267..1007390,1007448..1008165,
                     1008228..1008506,1008556..1008660,1008717..1008835,
                     1008888..1008967,1009033..1009192,1009252..1009328,
                     1009393..1009802)
                     /locus_tag="CND03650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512764.1"
                     /db_xref="GeneID:3257436"
                     /translation="MLSSNNSALHTRNGGLIGLAATAIALGQDVAPYLGQIIPPVLAC
                     FQDPESRLRYHACESLYNIAKVSKGEILVHFNEIFDALSKLSSDSEMSVKNGAELLDR
                     LMKDIVAEAAPSYVSIYPDNRNPSLSLGSTAGNRSLTMDSKSHDGYQDMRDAEHFEDN
                     RAFSLERFIPLLSERVYVISPFTRMHLVSWLMVLDSIPDLELVAWLPEFLDGLLKYLS
                     DNNVDVRLAAENVLAEFLREIKYIAQVQDKQAENERTAKDARETIESKKREIGSKDGS
                     VFQNDSESEEGEVQGEADEEHNWEGEGSGAWVPGQGVLVDHAAIMEIIIHNLSYDDEL
                     VQSTAMEWILTFLEFAQDTVVAFTPQIVPAILPNLASSHPQIKMAAYDTNSSLYHVIQ
                     SIALQVQRPRSLTEAPYTAPLVGTNSSLAGSPPLSLTLTSASTKKDPIIEVNDSARSP
                     PAAPVSDPLEAATVPPVINTVSSPVTVSGGIAQRGPTSSMLTSGLGHKTRQSATISLH
                     QVSEPVTPSSNDAPAISIANPAKGAKVQSDNASATAPPVQPLTLTSSLLSPKAETQQT
                     MEEDQDPFDVKETVNVLTLQFLSDHAETRIAALEWLLMLHLKAPDKILSRDSGTFPAL
                     LKTLSDPSEDVVKHDLQLLAQISSSSEDSYFTSFMIKVLELFSTDRRLLEQRGSLIIR
                     QLCLHLNAERIFRTIAEILEKDDDLEFASMMVVKLNMILITSPELGDFRRRLKNLDSR
                     DGQMLFSSLYRSWCHNAVAAFSLCLLAQAYEHASNLLQIFADLELTVQLLVQIDKLVM
                     LIESPVFTYLRLQLLEPDKYPWLSKCLYGLLMILPQSTAFISLRARLQVVHSSGYVPT
                     TTKPPSTAAFGPTRSKIGKDEIRWQELLSHFRNVQNRHEKARRQLNSTDIGSTQGSMH
                     YPSPFQNYSSNTSVPGPSAVGSSSKGTTRKKATTTTSNSKQGSTDIRSGTSPLNPKRG
                     ASNSTNGTGLVSLGGAVASMNATQGLGIRPTSPGRKRILGGLRKGGSRD"
     gene            1010093..1013205
                     /locus_tag="CND03660"
                     /db_xref="GeneID:3256948"
     mRNA            join(1010093..1010297,1010355..1010630,1010696..1011055,
                     1011105..1011183,1011230..1011742,1011804..1011875,
                     1011927..1012222,1012274..1013205)
                     /locus_tag="CND03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_570195.2"
                     /db_xref="GeneID:3256948"
     CDS             join(1010163..1010297,1010355..1010630,1010696..1011055,
                     1011105..1011183,1011230..1011742,1011804..1011875,
                     1011927..1012222,1012274..1012972)
                     /locus_tag="CND03660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570195.1"
                     /db_xref="GeneID:3256948"
                     /translation="MSACTVTFVFDSALPLQQYTKLVQPDGIIYKLIQRLEEKHGGNH
                     YLHVSVLITPPTSSNRSIKKSMSKAFRSEYGSASTFLAALPKLSVLFPPRSLTPHHWP
                     QFDPRILPSETRAKDVKRKRSEDVRILDGVVGGLELLERPQPIHGPSPSQAYMSLTPN
                     TSAPLLEYICTPSNAMQDSPLQRYLVMVSMATSAPSPSYDGSVDVFAHYNWDSIWDGR
                     GWAALEQECKKGNVKCSCIIAGVTGNENRAKKIKELCEAVAEHVDEAWFKVPPTVELV
                     LSGFVIEADNTYTPPRDMASTTAEPTTAPVSLPPANKPDIRVLQQALSQSQSRSSLEA
                     GLGSSFNPATLSKMDPQLIASMLTAIKAQNEQQGVGDQRRSQVQQLLEMQQKVLAAKA
                     AQSRGKNGQGETVMAAIQQQRAQQAQASGQPTQVHSVQPRSQTIWSGAIVWGAPGGSG
                     SNASGSVGVEAQLFSGIPDSVMVSHWPKELLLRNLAIIHLPSLTEYAKENSCPIIAFM
                     PSDKTPSGTTPNPGMMHYNQLGTSLNAKSNMVVIPFPSIGPDRGLLIFSAPVGGTSAG
                     RGFRLMGIACVHVSFPPLQMVNPRAAPTTMDPRRAPVNTSTLQQPPTGTSQNQQFRPS
                     PVLQQDLVNQFNQGQSQGQATPAAQFAALMQQQAQAQSQTQSRVLQSQPPQLTPQGQN
                     PPINSSLPHPQNTTRGITFQQYQQILSHAQKLGIVLPAFDYTSIPQDKLQTLINGLKM
                     AEMKQRQHAQAQQAQAQQQQQQQQQQQQQQQEQIQAQMAQMQQMMAQQSQSGQGTSGA
                     GIGLRNFQPGP"
     gene            complement(1013391..1016584)
                     /locus_tag="CND03670"
                     /db_xref="GeneID:3257273"
     mRNA            complement(join(1013391..1014713,1014765..1015482,
                     1015532..1016119,1016169..1016584))
                     /locus_tag="CND03670"
                     /product="RNA ligase (ATP), putative"
                     /transcript_id="XM_024657039.1"
                     /db_xref="GeneID:3257273"
     CDS             complement(join(1013431..1014713,1014765..1015482,
                     1015532..1016119,1016169..1016582))
                     /locus_tag="CND03670"
                     /codon_start=1
                     /product="RNA ligase (ATP), putative"
                     /protein_id="XP_024512786.1"
                     /db_xref="GeneID:3257273"
                     /translation="MSPAPPPPQPSTYASKHPESTPRLLSALRDLHATDPKAIRTTVH
                     RYPAALYAHGQNEHARDRLITSWKMTEHMYFKKSLVFPTLARGLFTEEVLEGDPVPPL
                     EACSGQIGSDPDAPRERIVLRGYDKFFNTGEVSWTEWDAMKQHTQGPYYLTLKSNGCL
                     ILISALSPTHLIVASKHSLGTTTAAEGVDLSGSEKLIDKEKPAQKCGDSALGPEISQI
                     RTIPSFPPTVGSLDKHFKDLTLEQSQANQSLSKNALKKAEKAALKYAQKVINEGKSED
                     SAQITAAEEKKEIKENEEAQQHAEVGRRWLKRTLESSGKTEEELAQKLWEKNLTAVLE
                     LCDDSFEEHVIATPEHWTGLHLHGLNSNTPHFSTSSPSDVATFAKEFGFIQTKYIQLE
                     TLEQVKSFTADLAQSGTWEGEMIEGFVVRCTVKNGQDGMSQGAPPYRANSPFFFKIKF
                     EEPYLLYRQFREITRVMLPLLENTNPQKREEIWKKVRSRAKRPEVKLYSTWVGEMMKK
                     EPELFEDYNRGVIRVRERFLKWAEEDGKKKWDDARAGKIDKEQRAGDRDGLPKKWIVV
                     PAAIPGCGKTLLGVALSRIFGLAHTQSDDITAKRTAPTFIKNVTDLLATYDVVFADRC
                     NHIPKHYDELAKIAEDKKLQKFDTRLICVTWDLDTFPYYRLLRILSDRVVARGENHQT
                     LRPDPTLDAEHEAVVGRFIRDYTPPDPAIFEDIISVSVMDSAKVTLTKVVRGLTKSLG
                     LTMPSEDVINQGLEAASLYKTTTPYHPVARQGRSTRYFAVAPEINLYELACGAIEPFR
                     DTEKGQSAWSFLDELYKRGRITAKPHVTLSHENNVKAEMEVRNRTGAREGRDDSELAQ
                     SPGPEEILWETCKSIATSKYPPLYSFSLTHLVWDDRTMAFCLSGLSPVISPTPDEPDG
                     AASPSLCPDLDSVLPQATKTYLHVTVGTRDADVPAFESRSLVKIVRERLEAGEQEGEI
                     EEVVANGGNVKWMKIGLARSEGRIRGMA"
     gene            1016815..1023594
                     /locus_tag="CND03680"
                     /db_xref="GeneID:3257144"
     mRNA            join(1016815..1017197,1017374..1017634,1017688..1017746,
                     1017794..1018572,1018621..1021164,1021215..1022766,
                     1022822..1022920,1022973..1023090,1023152..1023284,
                     1023338..1023594)
                     /locus_tag="CND03680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657040.1"
                     /db_xref="GeneID:3257144"
     CDS             join(1016992..1017197,1017374..1017634,1017688..1017746,
                     1017794..1018572,1018621..1021164,1021215..1022766,
                     1022822..1022920,1022973..1023090,1023152..1023284,
                     1023338..1023433)
                     /locus_tag="CND03680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512766.1"
                     /db_xref="GeneID:3257144"
                     /translation="MDGAQDSRSQPPQPHSEQSSNPIHPNSNIRRSSRLSISTTAAEL
                     PSTASSRGKKRVTIDEASLHSTDRKQPPQPSSSSIPGPETDRKGKRRVTQLSSSAETP
                     PTKKPKRFSASSAGSTSTATKRYELRTKPEDQVSTSVKEEEKNKNFKNMPSKSNPRKG
                     SGFGNSSERGKKGETSARHLVSDEYDDEDDSLWIDEPEGDVTVAEESDMADDYDHEED
                     DEDDEDGDGDENGDNDGPGGGFGNSAYDRLARLASESGVNLDDATAALFGSGFRAFGG
                     VSSGLSNRLRRLKKKLHSKRIATRLAALRECSELLLVSNEDTLGGTFSPTSFATEFVA
                     ILDGRPNIEEGESDEEESVYDDMDEDAQLAAALALSSGDAPGTDGEEDEMECQLVACR
                     CLAHLMEALPGCGHALVQIGAVPILCSKLTEISYIELAEQTLSTLEKISAEYPSAVVR
                     EGGLGALLNFLPFFSTNVQRTAVTAAANCCRNISSEHFSKIKEVFPILRDTLSSGDPR
                     LVEQATLAIVRTTESYRHNADHLEGLLDVPTVSAINALLLPSGGSPLITPSTYTHLLK
                     ALTTSARGSAKVSIALLEAGMVNSIYQILTGVLPSSSEEGEHGDSSNAQGLAGSITDM
                     AVLQNLSHRPKEQVEEALALICELLPPVPKDGVFDAKAYSEKNLQRVKKGRKSDSPSD
                     RPRRSSRVAEASSSTNTAGPSTPVALNKDSSDRSPSDLISALQANREAAAQRARKDAE
                     TQMQLRCDLCQSNTELIGQFIKTVLPVLVDVYAASVVLRVRTKVLVGLVKAVSFAPEE
                     QLNVTLKYVPMASFLCAIISSKDNDAFVLHALQIVELLVTKLPDIYQVSFLREGVVYE
                     IEALANSETKKEKAAKEATKNKAGEVDNADSRPATPSNPPGASEIPGDLRSLLTLSGV
                     SNQILFGQTSGQSTPRKSSSHLDPHDANIIRARMLMAKKIFDTGGDNQKAASKVLANI
                     SDLVKRLCEPGASEADLREALRETASQFSSVEQSLSSFELLQSGLVDGLLDFVKIQGQ
                     VSPADRQAMLFDIFSDKSFSNPNPLTILVKRLHESLGRLESFDVETAFGGGSDPSRPS
                     TSSVHRTMRIRLVADEGEDIPKNVSQLVITIQAIASIKSVHDYLRPRIADGNFGSGFS
                     QMFAAYAAGRSGGAPGSSTSRLLNALAGNPGSGASPGSHAAAPSVPARASSNAESGPS
                     GGRSPQRRRSARLNPPGDAESAADEAPTAAARVTSPSSSTLLSPTTLTTSERRPILPA
                     MSMGMDFDDEEDYSEDEYDAPVIDQVMEEDLAATGPSESVVNMDVTADGSRVEAKTPQ
                     GTRIATPQQNIPVTGPSTATFSRIAPSRSSSYAGALKTEPTDWHLEFFLNGEKLDIHD
                     TIYGAIYKHKHATGLSGVNDFVTTPVIKFRKVEGPLPTKETVAERSSTTASSPLPSTF
                     EPSVSSTSKILHLLRVVHDLSIDGRDNLGDVKGSLDENLFVNNKLTAKLTRQLEEILI
                     IASNCLPTWAIDLPKHFSFLFPFDTRYNFLQLTSFGFPRLLLKVQQSSRSRDDMPNIA
                     NLLRRKVRISRTQLLESCAKVMEMYATFPGTLEVEYFDEIGTGLGPTLEFYALASKEF
                     ARRNLHVWRDEDPSIAGNYVHHPHGLFPSPLPRASAELVASRLKWFKTLGQFIGRSML
                     DSRIIDISFNKVFLKLLLDKPIKKNLSTLRAVDPSLARSLERLQGYYCVRKEIEALPI
                     PASSRRTKLAALTVGDAKLADLALDFTLPGYDIELKPGGAHIEVDDSNLGEYLEKVLD
                     WTLGSGVAEQVKAFQDGFSSIFPIKSIKIFSLDELYLLFGNADEDWSRETLEVAIKAD
                     HGYNQDSRAVQNLIEVMSSYNKEQRRQFLQFMTGAPKLPIGGFRGLTPPFTVVRKPHE
                     PPYKADDYLPSVMTCALYLKMPDYSSKEVLAAQFERAMRDGRGSFLLS"
     STS             1022073..1022856
                     /locus_tag="CND03680"
                     /standard_name="Hind8"
                     /db_xref="UniSTS:470944"
     gene            1023842..1025390
                     /locus_tag="CND03690"
                     /db_xref="GeneID:3256889"
     mRNA            join(1023842..1024026,1024140..1024338,1024391..1024480,
                     1024545..1024691,1024761..1025390)
                     /locus_tag="CND03690"
                     /product="thiosulfate sulfurtransferase, putative"
                     /transcript_id="XM_570619.1"
                     /db_xref="GeneID:3256889"
     CDS             join(1023910..1024026,1024140..1024338,1024391..1024480,
                     1024545..1024691,1024761..1025230)
                     /locus_tag="CND03690"
                     /codon_start=1
                     /product="thiosulfate sulfurtransferase, putative"
                     /protein_id="XP_570619.1"
                     /db_xref="GeneID:3256889"
                     /translation="MRLPSIANPYLRTARSFTTSAHLRVPLLLTPKQFNDLPKQTTLP
                     LDATWHMPNSPRSALAEYLNGPRIPNARRFDLDEVAELSVGKNPLSLTHMLPSAERFK
                     KELEKLGIHKDTHVVVYDTIGIFSSPRALYTFKAFGHDKVSVLDGGLPRWIEEGNEVE
                     MGEAGEVGSSEYPKVQGPNKDWVRSYEEIVSNSQKPLSDPTAEIVLDHRPAARFLGIN
                     SEPRPNLPSGHIPNSRSLPFTHYLVPATDKKPFTNYKPVPELKQVLVDGVGGEAMWDD
                     IERRDKPLVFSCGSGMTAAIGWLANELIRETEGKAPKSALYDESWTGYALREDSKIAR
                     NGHFKP"
     gene            1025642..1026508
                     /locus_tag="CND03700"
                     /db_xref="GeneID:3257123"
     mRNA            join(1025642..1025861,1025946..1026024,1026102..1026231,
                     1026334..1026508)
                     /locus_tag="CND03700"
                     /product="protein transporter, putative"
                     /transcript_id="XM_570193.2"
                     /db_xref="GeneID:3257123"
     CDS             join(1025837..1025861,1025946..1026024,1026102..1026231,
                     1026334..1026408)
                     /locus_tag="CND03700"
                     /codon_start=1
                     /product="protein transporter, putative"
                     /protein_id="XP_570193.1"
                     /db_xref="GeneID:3257123"
                     /translation="MSFLFGGNNRSVEGSVDPAKIEMAVAELDMITDVFNRLVNSCHT
                     KCISSTPLNHRYAEGDLLKGESVCIDRCTAKFFEVNKKVGERMSAMGSAAQATGSFGR
                     "
     gene            complement(1026353..1027552)
                     /locus_tag="CND03710"
                     /db_xref="GeneID:3257423"
     mRNA            complement(join(1026353..1026854,1026909..1026962,
                     1027013..1027094,1027153..1027283,1027338..1027552))
                     /locus_tag="CND03710"
                     /product="protein-tyrosine-phosphatase, putative"
                     /transcript_id="XM_570191.2"
                     /db_xref="GeneID:3257423"
     CDS             complement(join(1026690..1026854,1026909..1026962,
                     1027013..1027094,1027153..1027283,1027338..1027544))
                     /locus_tag="CND03710"
                     /codon_start=1
                     /product="protein-tyrosine-phosphatase, putative"
                     /protein_id="XP_570191.1"
                     /db_xref="GeneID:3257423"
                     /translation="MANKPPPQPLVQVPALFSIVEPGVYRSASPTPSQVPFLAGLNLK
                     TIISLTPEHPIKPLLQFVRTTGISFVHLGLTHWRRPGTDWRPVRYEIIKTALEAYILD
                     TRAHPVLLIDPLGVHQTGCLVGALRMMQGWNFASALMEYRAHAGSKHRYVDEQYIELF
                     DSDLINLPAPQYRPSWWLACDEADPQQVEALASSSGGAGLLADTNGRTQSIV"
     gene            1027747..1029744
                     /locus_tag="CND03720"
                     /db_xref="GeneID:3257034"
     mRNA            join(1027747..1028208,1028258..1028327,1028370..1028805,
                     1028864..1029358,1029411..1029744)
                     /locus_tag="CND03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_570620.1"
                     /db_xref="GeneID:3257034"
     CDS             join(1027831..1028208,1028258..1028327,1028370..1028805,
                     1028864..1029358,1029411..1029441)
                     /locus_tag="CND03720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570620.1"
                     /db_xref="GeneID:3257034"
                     /translation="MHLSALSPLLLALALANADANAQSFVPAHPRRHHARALAVADAN
                     RPLLPRAGAVVDNGTLASIAADEAAASSTAATSTTAILSSVSSVSSGISATSSSTLAS
                     SAISSASSSETSSSIMTTSAVQSSSSAAVSSTTSSEEMVPSTTSSDIESSTSISSTEI
                     IPSTTSSTTSTSSVVSSTSTIISQTDVTSSSSSSSSPISSTAAHSTVVLVTTASRSAT
                     QSSTASATSEADSSSTSSSGLSKSALIAIIVVASVVGLAAIGWTAFRKWKLRPRNRFD
                     SKMMPIDFSPQNDTMDDDFFEKTLERTTSQTSANRQRQELVAQLDDDPNRVAGVPEHD
                     FTAGAGVGAYGYHHDQYAGEQYEYDQYNAGYDNAYEHAYPPHPSHAMQHGYEYGQDGV
                     LQQPATAVTTDSEGYAELQRGPSIGSGSGHGHGQVPVMNDAGVHPGELQFPVADTYGL
                     GRPTHGADGPYAQAANFRY"
     gene            1030166..1033805
                     /locus_tag="CND03730"
                     /db_xref="GeneID:3256879"
     mRNA            join(1030166..1030675,1030741..1030870,1030939..1031339,
                     1031407..1031705,1031760..1032161,1032216..1032494,
                     1032548..1032816,1032877..1032981,1033027..1033314,
                     1033384..1033499,1033551..1033805)
                     /locus_tag="CND03730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657041.1"
                     /db_xref="GeneID:3256879"
     mRNA            join(1030166..1030552,1030622..1030675,1030741..1030870,
                     1030939..1031339,1031407..1031705,1031760..1032161,
                     1032216..1032494,1032548..1032816,1032877..1032981,
                     1033027..1033314,1033384..1033499,1033551..1033805)
                     /locus_tag="CND03730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658490.1"
                     /db_xref="GeneID:3256879"
     CDS             join(1030824..1030870,1030939..1031339,1031407..1031705,
                     1031760..1032161,1032216..1032494,1032548..1032816,
                     1032877..1032981,1033027..1033314,1033384..1033499,
                     1033551..1033753)
                     /locus_tag="CND03730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512782.1"
                     /db_xref="GeneID:3256879"
                     /translation="MHRGEECGESDGESPAKSRRLSFDSTASSRKLSLSSITTVSEAP
                     PLSNVMLSGPSHLLPPLHGTGLPIDPSEDSDPGRLSGGVQSILGLDTNLQRQQHGMFQ
                     SSPSSSNAPSRATPFMGQSTPGSGFIDPANLNVASSSTIKNLIDIPNDDILSTPTIPS
                     HPELLTFDPSWEWFGNLFGWGSDNNIDQDVGLQNSMFESNGVGPASSTDTLSAAWLLC
                     TTPRAGSPVTGEAVKAQGMADPFGRKDDTPWPNVFKPNVPDRPLTLGDVKASSNIRPP
                     RTGPNSISEASRNAMLSLIYLSHQPHWLMPDIDDFPDHDTLSDFVDLYFEKFHPMFPI
                     LHKPTFLESDTPAVLLLSVAAIGATFADLKYRPLAVALCELVRRMIAWMRGSDQRAKF
                     DRYALAAFTLQTALGLACGSREMFYHAEIFRCSIVTTCRRLHLLRGLDTATDELYKRT
                     EHPSNEERYKAYLKDEEMRRLGWGVYFLDAQMSAMLLIPPIFMVNEARIHPPTDEALW
                     EAPNAEAWASVIAKGEAPDPKLPTPRFLKLLSMSMAGQDGQIAMSDFTVGIVTYTIWR
                     LLMDQRLLQKAIGLGLSESGMDLASYPAQTDIFDTQPGYLLTRLATSTFPIRSPSYLR
                     LTPAALYHHARLIFTRPGLIQRIKHVSGKYEPDMTEEGSLSWLKTWLADGSEVRRIIW
                     HAGVLSELMAENPRGSIGELIWTFDCALLFWIVLKHAPQQLTSASPAAFFAANWLCIT
                     PPEMWISHGGQITFPLLGSSTTWTVSSMLRIFMDRLHKMPWGLAVQNRLVLNKLLEAE
                     GAGD"
     CDS             join(1030824..1030870,1030939..1031339,1031407..1031705,
                     1031760..1032161,1032216..1032494,1032548..1032816,
                     1032877..1032981,1033027..1033314,1033384..1033499,
                     1033551..1033753)
                     /locus_tag="CND03730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514343.1"
                     /db_xref="GeneID:3256879"
                     /translation="MHRGEECGESDGESPAKSRRLSFDSTASSRKLSLSSITTVSEAP
                     PLSNVMLSGPSHLLPPLHGTGLPIDPSEDSDPGRLSGGVQSILGLDTNLQRQQHGMFQ
                     SSPSSSNAPSRATPFMGQSTPGSGFIDPANLNVASSSTIKNLIDIPNDDILSTPTIPS
                     HPELLTFDPSWEWFGNLFGWGSDNNIDQDVGLQNSMFESNGVGPASSTDTLSAAWLLC
                     TTPRAGSPVTGEAVKAQGMADPFGRKDDTPWPNVFKPNVPDRPLTLGDVKASSNIRPP
                     RTGPNSISEASRNAMLSLIYLSHQPHWLMPDIDDFPDHDTLSDFVDLYFEKFHPMFPI
                     LHKPTFLESDTPAVLLLSVAAIGATFADLKYRPLAVALCELVRRMIAWMRGSDQRAKF
                     DRYALAAFTLQTALGLACGSREMFYHAEIFRCSIVTTCRRLHLLRGLDTATDELYKRT
                     EHPSNEERYKAYLKDEEMRRLGWGVYFLDAQMSAMLLIPPIFMVNEARIHPPTDEALW
                     EAPNAEAWASVIAKGEAPDPKLPTPRFLKLLSMSMAGQDGQIAMSDFTVGIVTYTIWR
                     LLMDQRLLQKAIGLGLSESGMDLASYPAQTDIFDTQPGYLLTRLATSTFPIRSPSYLR
                     LTPAALYHHARLIFTRPGLIQRIKHVSGKYEPDMTEEGSLSWLKTWLADGSEVRRIIW
                     HAGVLSELMAENPRGSIGELIWTFDCALLFWIVLKHAPQQLTSASPAAFFAANWLCIT
                     PPEMWISHGGQITFPLLGSSTTWTVSSMLRIFMDRLHKMPWGLAVQNRLVLNKLLEAE
                     GAGD"
     gene            1034050..1035622
                     /locus_tag="CND03740"
                     /db_xref="GeneID:3257202"
     mRNA            join(1034050..1034410,1034465..1034559,1034614..1034687,
                     1034739..1035399,1035464..1035622)
                     /locus_tag="CND03740"
                     /product="aldo-keto reductase, putative"
                     /transcript_id="XM_570189.1"
                     /db_xref="GeneID:3257202"
     CDS             join(1034254..1034410,1034465..1034559,1034614..1034687,
                     1034739..1035399,1035464..1035538)
                     /locus_tag="CND03740"
                     /codon_start=1
                     /product="aldo-keto reductase, putative"
                     /protein_id="XP_570189.1"
                     /db_xref="GeneID:3257202"
                     /translation="MSGLSYCPRVGGYLKLSRTPTFTILPIFNSLIMSAPTSFKLNTG
                     ASIPAIGLGTWQAKAGEVRQAVAHALKAGYRHIDGALCYQNEDEVGLGIKDSGVPRSE
                     IFLTSKVWSSYHDRVEECLDTTLKSLQTDYLDLYLIHWPVRLAPNGTHPLFPVKPDGS
                     RNLDWDWDQAKTWAQMEDVLKKGKAKAIGLSNAGIPIIEHIIKTGKVTPAVNQVELHP
                     YCPQHALLKYCKEKGILLEAYSPLGSTSSPLHEDPDLLAVAKKHNVPTATVLISYQVN
                     RGVVVLPKSVTPARIESNLKTIKLDEEDMNKLDKLAEGGKQTRFTAPPWGSDFGFPDW
                     FGPGNKDAPEGARLLAGKA"
     gene            complement(1035664..1040575)
                     /locus_tag="CND03750"
                     /db_xref="GeneID:3257225"
     mRNA            complement(join(1035664..1035973,1036028..1036549,
                     1036606..1038833,1038886..1039191,1039245..1040575))
                     /locus_tag="CND03750"
                     /product="GrfA protein, putative"
                     /transcript_id="XM_024657042.1"
                     /db_xref="GeneID:3257225"
     CDS             complement(join(1035896..1035973,1036028..1036549,
                     1036606..1038833,1038886..1039191,1039245..1040214))
                     /locus_tag="CND03750"
                     /codon_start=1
                     /product="GrfA protein, putative"
                     /protein_id="XP_024512651.1"
                     /db_xref="GeneID:3257225"
                     /translation="MLYRPYNPQPMPSPQLPLAGPSLPSARHRPRTLSLHSYDSHPRH
                     GDQTHPPRKYTDPVPHASPSQREAQGQDQELDVDLDAYSAADFEADEDSPDRDPTLSF
                     VTASTIDSVAGGPQVTTTYGHSSRMADAKGEQEPSLSMRSTSGRATTYSSAESSTGSG
                     AFSYHTYSDHIYTPPPPLPQVPDGYNSSDSPGMAADYPIPRSNADQSHARQIRPPLSP
                     SHSFTHRPWKRDIVNRLRSDSASSAFTAASVSTDNSAASSSRIPLPDAAYHYAYDDFT
                     LPYEQEQAEPEALAMIKEGREKLLNMEKIEAMGGAEALGDSVICSLAGVTHLLLPSCG
                     RRILDLLPRLLSVLAPSLVVLDLSDNNLARLPDSLQCCTSLEELNLSENPLRLLPQWM
                     GNLTALRVLVVDGCGLTVLPQGLCHLCFLHTICVRRNKLVCLPTWLCLLNQLETLKVD
                     GNPFTPEWAQIVPPILEGPFPMTASSSRRRNAHHRHLSINNGIRTPVSMASLESSDQE
                     PNSASSSTPNLDQSFGTASSSASQSTYLVSALSSIAENNLHSAPLPETHANGEALASP
                     GPVTETPQSHGGLRKMRSAGALLRSLDQSASNTTSNFTPPRPVIAERSATEGRRAASA
                     MGNYHEEPQIHPGKLVKSSTPKTTTPPTKTGRWGFLRKMSMNRLRPDKEKVAAIAASA
                     SDNLKSLPPLPPIRHQHSEPIQHVTIRPGMVSTMSAATLPSRKIADFEGSEFGQMSSC
                     STPSALTMPISGLPYQPSPMSIASIGFGSALRGKRRSFLPIDGPPSINVQIPTSAFST
                     AGSADNISQLATEAPTSQTTALPYTPAQPMVGSPVTDTEYEERYTRGLETIKLILRDL
                     HDLSRRSIMPRDGSTVMGNSSADSSYAGSTVPSEHPGSPLSSNRDSFINVRQARRPTL
                     EGGDSRDSPAADSEEFGEREPSLSGKKFKNDKSKRTRCIHEIWETERTYVRNLGELVT
                     IYVRPASQPVNQSKSVVETVIPAAERKIVFGGVESILAIHRDNFLPALETVLKQLIEN
                     GDDEKGILSIDTAYSVGEVFRTYIAYMKQYSTYITNFDNALARMKTWSLSNSGSSTPA
                     FSGKSSAANASVNALSAGMGAVSLSASAVPTTSGQSMSSSQRKRVKAFLKKAREHPMH
                     SQISLESYLLLPIQRVPRYKLLLTELAMCTPARSDGLRDALDDALTEISSLASLMNEE
                     KRDADSRLRLLDWQKRFTNSGRSPLVQPHRRLVMEGPLTLSRIVKKASTFVECETVVK
                     GDGDHTIMPGKAVVPVDYVMPESVEREVMLILCSDMMVLATDRGEGWDGHVNVFNVLR
                     MATMQEPASLTAGNILRVVDNNSIYYFRGTSRENTLQWCRAINSARR"
     gene            complement(1040797..1044099)
                     /locus_tag="CND03760"
                     /db_xref="GeneID:3257208"
     mRNA            complement(join(1040797..1041330,1041390..1041495,
                     1041567..1041811,1041858..1041983,1042038..1042112,
                     1042175..1042262,1042306..1042393,1042448..1042505,
                     1042556..1042580,1042631..1042700,1042754..1042815,
                     1042865..1042992,1043044..1043921,1043973..1044099))
                     /locus_tag="CND03760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657043.1"
                     /db_xref="GeneID:3257208"
     CDS             complement(join(1040977..1041330,1041390..1041495,
                     1041567..1041811,1041858..1041983,1042038..1042112,
                     1042175..1042262,1042306..1042393,1042448..1042505,
                     1042556..1042580,1042631..1042700,1042754..1042815,
                     1042865..1042992,1043044..1043921,1043973..1044030))
                     /locus_tag="CND03760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512785.1"
                     /db_xref="GeneID:3257208"
                     /translation="MSNYPHSAAIASSLSTSPYALQSNLENLISRSRTHPHPHRVAGE
                     HSPPHHNNYAQQPSPSHPHPAEGSDDDLDKSTTGHTLAAHHAPGVGTIQEASLDEPLI
                     FQDDEDSINTDRQRGERTSLLNHDWKRRVSRTARRSYGAASAPLGAYEGSRRVSSVDG
                     LGAGNSRSRSKARTPPRRESEHGRKNRDGDVAQPHGVPAQYSSDEDSTSTHRGRFQGQ
                     RPLSYTSSPYSSPTSPFRSKTVRVADESSDEDEGGDLARGLLATSGTGVFAGSGRVGD
                     AGLMDLDPVEELDAEDLELPVGEDGTEVRDRTKAIKAELPIILRSALPVFFTQAAEWS
                     LVLASVVSIGHLGTTELAASSLASMTASVSCFSILQGLATALDTLLPAAWTSSDPSRV
                     GLWTQRMFIVMGFSMIPMYLLWWNISPILVVLGQEPEVSHSAGVYLRWLSIGIPGYGG
                     NVLVKKYLQAQNLMHVPTYTLFFVAPLNLFMNWLLVWGPEPVRLGFPGGAFATAMSYN
                     LAFVISSLWAVFCGPREAFHPIRFKYAFSKLGTVTSLGLAGTIMLSSEWWAWEACALA
                     ASLLGPTTLAAQSVLLSTASTFFQVPASLGIASAVRVGNLLGAGRDWEAKWASRTCLF
                     LSVTFALVNSTICIIFRTNWGYLFNNDPEVVALVASVMPYIALFQIADGIAATSGSIL
                     RSLGLHTTGALINLTSYYIIGLPFGLWLAFTPTFSLGLIGLWLGLSVALGYASVLSAV
                     LVWKANWVRAVERVRERLGLGVHGVVGIDGKWDVREQAIEERQELP"
     STS             1044044..1044851
                     /standard_name="Eco8"
                     /db_xref="UniSTS:470945"
     gene            complement(1044210..1045200)
                     /locus_tag="CND03770"
                     /db_xref="GeneID:3256987"
     mRNA            complement(join(1044210..1044366,1044440..1044452,
                     1044514..1044551,1044613..1044688,1044745..1044787,
                     1044980..1044985,1045088..1045200))
                     /locus_tag="CND03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657044.1"
                     /db_xref="GeneID:3256987"
     CDS             complement(join(1044352..1044366,1044440..1044452,
                     1044514..1044551,1044613..1044688,1044745..1044787,
                     1044980..1044985,1045088..1045094))
                     /locus_tag="CND03770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512784.1"
                     /db_xref="GeneID:3256987"
                     /translation="MAPKAKTGGKKRSGQPSAYNIYMKVQLAKLKEEQEKSGKKADHK
                     ENFKKVAADWKTAPENPKNKK"
     gene            complement(1045633..1047420)
                     /locus_tag="CND03780"
                     /db_xref="GeneID:3257173"
     mRNA            complement(join(1045633..1045893,1045949..1046238,
                     1046289..1046680,1046729..1047000,1047059..1047183,
                     1047242..1047420))
                     /locus_tag="CND03780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570635.1"
                     /db_xref="GeneID:3257173"
     CDS             complement(join(1045731..1045893,1045949..1046238,
                     1046289..1046680,1046729..1047000,1047059..1047183,
                     1047242..1047388))
                     /locus_tag="CND03780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570635.1"
                     /db_xref="GeneID:3257173"
                     /translation="MPRVIKPSKPRHDPLHLELEGDESIRKFGRVTKPGKRKAKKEEA
                     DDDEPKAEDARMSKKILDLARDQQEEVARELGQDDDWEDEDEAEAEPSRRPRDIAQLP
                     SDDEEEEEFSDGEISGGEEYAELHIDPADHATLDALNRGSGTAPMGQDQGEEDGEPKT
                     LADMIFSKMQGGAVSRGVVDEHEGPPDPRKGLNPKVVEVYSKVGFLLSRYKSGPLPKA
                     LKILPSLPHWAQLLALTKPTEWTPHATFACTKIFVSNLKPTEVRVFLEGVLLDKCRED
                     MRMNNGKLNVHLYEALKKGLYKPAAFFKGILFPLCETGCSLKEAAIFASVLSKVSVPV
                     LHSAAALLRLASMDYSGPNSLFIRILLDKKYALPYKVVDALVFHFIRLANSPRSKDGE
                     DKLPVLWHQSLLVFVQRYASDLTPDQKDALLDVIRARPHPTISSEVRREIVNSVERGA
                     PRPEDGEDVKMQ"
     gene            1047757..1050297
                     /locus_tag="CND03790"
                     /db_xref="GeneID:3256986"
     mRNA            join(1047757..1047843,1047904..1048403,1048456..1050297)
                     /locus_tag="CND03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657045.1"
                     /db_xref="GeneID:3256986"
     CDS             join(1047799..1047843,1047904..1048403,1048456..1050229)
                     /locus_tag="CND03790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512642.1"
                     /db_xref="GeneID:3256986"
                     /translation="MPDDLDPASLASVLSAEYTLIDPALIAALLSDYPPNTLLQNLDQ
                     IKEHLGILEATLVPDSDDPRSQESMGGEGESWSGSDVNSGNSARMEALSDKMGRIDIS
                     WEKAKDKSSGRHMSGRNIRGHRELAGSGSAMSSSTSLEDTRQSQTWSRDSGDSREPVS
                     ECGSELEFNDEIDLLKSLFPNLTHGEIQKALSSEQSLPGAIDHLLSLDLIRETEQRGY
                     WIGESEEVLRPVVDNLEMVKDKKTKKKAGNVGSSLSSLAVSASASERKRKPKTSQTIP
                     LVDTLQRGARSLTPIPSIIRSVSSSSSSTSFSPAADTKEFSSATTSLATYLHELLPSL
                     PISHFLRYLQSSEHPSLYHATRASLTSIPRPRAPQFLALFNEDDVSSGLLQDVYGVSL
                     EAEGNPWSVPRVERERQKDLEMCVAIAGQDVATVMDLMDLLVDLRTFQSHEPVSEFDT
                     SPPSTSPPPAGEEQEDDGWAKPLAAPKRPVSSLPGPVTRPAPKASKSQKIRTVPGALP
                     GSMANATDSFGVASPSPGMIKPHAVGGPHPTNWQTVRSKSRTKDRGGQGHPLAGSIPA
                     YSRGATPHDGTPGSLYNHKSSINGGRAKTQMDEYLYQVQVERARREAAIRAAGRSFAG
                     GRAVRGAVSGHYAREAREAAERIRNLEMRAAELVIASQLESRPARPSREENRSKMIDL
                     HHLTVNEAVSVAEKAVDKWWINEREQRAEGWGAKGKQSQGRLVIVVGAGRHSAGNRGV
                     LGPAVAGHLDKAGWRVDKGETSRGYLVVHGRK"
     gene            complement(1050195..1051850)
                     /locus_tag="CND03800"
                     /db_xref="GeneID:3257432"
     mRNA            complement(join(1050195..1050612,1050665..1050823,
                     1050886..1051009,1051062..1051084,1051141..1051376,
                     1051427..1051456,1051523..1051573,1051623..1051659,
                     1051711..1051850))
                     /locus_tag="CND03800"
                     /product="GAMM1 protein, putative"
                     /transcript_id="XM_570168.2"
                     /db_xref="GeneID:3257432"
     CDS             complement(join(1050301..1050612,1050665..1050823,
                     1050886..1051009,1051062..1051084,1051141..1051376,
                     1051427..1051456,1051523..1051573,1051623..1051659,
                     1051711..1051785))
                     /locus_tag="CND03800"
                     /codon_start=1
                     /product="GAMM1 protein, putative"
                     /protein_id="XP_570168.2"
                     /db_xref="GeneID:3257432"
                     /translation="MLRTASRNIFRTMSSPVYKKIKSTKVIGTHSGTFHCDEALAVFM
                     LRLTDEYKDADLVRSRDPAKLDPLDIVVDVGGVYDPKTNRYDHHQRGFTEVFGHGGFN
                     RTKLSSAGLIYKHFGKEIIAKRIGAPVEDEKVEILWLQLYSELIESVDGIDNGVNISS
                     SPLAYTQRSDLSSRIKRINPNWNEPTSDEIYDQKFEVASKTTGEEFLSQLDYFAFAWL
                     PARDIVEEALKKRTEVHPSGAIVVFDKSCPWKDHLFTLEPTLPKTSSPILYILYPESE
                     SSSKWRIQCVPESPDSFVNRKSLPEPWRGMRDSKLSEISGIPGGVFVHASGFIGGNET
                     FEGTLAMAKKALEA"
     gene            1052013..1055787
                     /locus_tag="CND03810"
                     /db_xref="GeneID:3257017"
     mRNA            join(1052013..1052157,1052387..1053448,1053498..1053590,
                     1053645..1053720,1053773..1054461,1054524..1055787)
                     /locus_tag="CND03810"
                     /product="transcription factor binding protein, putative"
                     /transcript_id="XM_570167.2"
                     /db_xref="GeneID:3257017"
     CDS             join(1052022..1052157,1052387..1053448,1053498..1053590,
                     1053645..1053720,1053773..1054461,1054524..1055671)
                     /locus_tag="CND03810"
                     /codon_start=1
                     /product="transcription factor binding protein, putative"
                     /protein_id="XP_570167.1"
                     /db_xref="GeneID:3257017"
                     /translation="MSHRRRQSTASAATPRSAREHSALKSFRSTSIASATTRMDEDDD
                     SGGPRRNTRHRNPLPPTTGPLFPPLPPKQPKSAHKEGSMSKSPAKAIGDATETQDDYN
                     EEQEKSGGSTAVADDEEVGEDGQVREGNGLPSGSNTSLTPPPTSPAARVDVDVPPNTE
                     TTSLLHQDLEAEQVQDDMGQPKSINGGDNGGVDNDQPREEQEMDEDDVWETYRRHRAV
                     KGFVRKDDNVKSEFGEMERDDGDHLLDNPVHVNGDKSHDEHQHQHIDVLHDADEPEDS
                     NHPPRTRSKPIPRGMSAISASNGNTPASASGSDANLGRAGSRQGRRRRGEEQLLLDDH
                     LLPAEIRRTALAERAKKDVEKDEEEEVEVEEEEEGEEDEEEGDGLGEQEEDEEGRDIT
                     RCVCKREDIDVMMIQCDQCNVWQHGECMGIWGDEEAPDEYFCEECKPERHQALKKWLR
                     SRGRNTSPFIPPTPEILERLHSARDPYPPTQSKRWTEYSNSEPLPPKLLARSHHKKQQ
                     QQQQQQQQQGQEMLTGTTEGGDGRRTRGRQSSTREKPPSSASGVGHGGTPSTSSKKDG
                     KRGGRKQSVNGMESENESESSQNIGAGTSLSVKKRSTMNSRDAAYEEAVKAAMEASRK
                     EMAPQEEGDVNSETKEVEVKEKDRARPGKRRRNEDEELDEEEKEDEKDKPKKGKRKKE
                     DETESDPTSAGPSKPKHPNQYTYRPKPPSTTGPAASPSRRLGGTPGPTTIPTHHEHGT
                     RRAGALANAPVVFHPLSEEGASQLNWHLPDYLTQFNDVLPSDSPVALEVPAPRVMAYL
                     PKNHFHNQRYGPFSEERDATGKLILPDDQQDREVVGHPTTQLEPPTRIKFPAKRISAG
                     DVKKRVRAVLEYVGKMQADEGKRLRRAKTLGITPVSTAAIRWKERQRKEREREEGAGD
                     DDVVMSEAYAEDGPFPAELGLATNQPRSAHLMAELTEMLIGFQEAFSSNDFAAFENGA
                     TVGSAPPTPQIPDTSTVPPTPVLPSLHSDHPHGSSAGVISRSAEREVDGTEETTTEEV
                     GAGKGLDVYRAGIVNKVVTINSTERDVVKKVEEITQA"
     gene            1055889..1060759
                     /locus_tag="CND03820"
                     /db_xref="GeneID:3257045"
     mRNA            join(1055889..1056029,1056208..1056261,1056323..1056410,
                     1056473..1058765,1058816..1060188,1060242..1060370,
                     1060426..1060647,1060700..1060759)
                     /locus_tag="CND03820"
                     /product="myosin I binding protein, putative"
                     /transcript_id="XM_570166.2"
                     /db_xref="GeneID:3257045"
     CDS             join(1056001..1056029,1056208..1056261,1056323..1056410,
                     1056473..1058765,1058816..1060188,1060242..1060370,
                     1060426..1060647,1060700..1060720)
                     /locus_tag="CND03820"
                     /codon_start=1
                     /product="myosin I binding protein, putative"
                     /protein_id="XP_570166.1"
                     /db_xref="GeneID:3257045"
                     /translation="MSYPYLARTTLKYKSPHATDLSFAKGETIRVTGQSPEDEDWLVG
                     ETLDGSHAGGFPKDFVEAIDEGSVEATENESKTGDNTAQQLQPVTQDSSKESERPNIL
                     SETDPKAVEVPSELDTGSSEAQAQAQAPAQAPVPASQSESHADDVSRPQSMKDRLAFF
                     TAAQNKPAPPPPVKPKPAAGGLTWSQRQKLRQEQEAKEREGTVAASPATSTPIAAPAP
                     SVPETKPTDNAENKEEQGSAMSAADALTSISKGGSLKERMAALQGVGAFGGGEKKPPP
                     PPPTGKVWKRPTVQEKEPESQDEPEAENQSSDVHEPLPISDEPRALESDSKDEVAKEE
                     ETEEEQEKAKRAAIAARMAKLGARGPMGMVPPAKPVKKPTREMTTTAEDKSLTSSEAA
                     GGDTDQVAEAPTIDSKPSAASAKPESVSSPTDAPVTAPPKSIPIAAMPRRTAGPRRRT
                     QTSSANPSSDDVSSPPAETHPVPLAPTEAPASEGVAAPADTEAEPHDRLETVNSKGEP
                     VPPKQMMVYDEEAPLQKTEEQMKQEREAEERGRGIGGLEGAEAAGIAVYKTGEAREEL
                     AVESQASQDDMTRVDEPPTGSDTSPNKPFGTDAVMTDSGSGDGKLFSGPRSGEQSVER
                     GGEREDDMSFAQGEVFQASESRPARAAENGIPGENVDPVDIVPLHPAADEGLPGEEDA
                     PPPPPRRGTMTMEDMPLDELEKKHLQEAREEPPAESPVSDDETHEEEEEGASPSPPPS
                     AAHPRGEENLEEGTSDRLEQEGSEMGSKGGDVVTSQAGEEPRVPPPPPRIRKATSSVE
                     LREESPTREEAPTSEEEARAFVTETPHRSESHHSETHHSETPAKEAKELPETPAAVGE
                     TTVSQEEEEDAARRSGIAARMAKLGGIKFGIPPPHPAKTHSVDTAPAGSDSIPSRSEN
                     LSPVEKEAPLAANLEPERPERGEGEGKTASSEEETPEQEAARRRATLARLRAGGALGF
                     GMFNQPSQKEPEEVEEKDATGGEEAFEERGPPPLPLGRPGQETPLSTDEDVGAREEQD
                     EEQVEDVPPPPPARPVINTAYGEGDAHPLSQFVPPRPAVAPPGSAAVPLSPVDPDGMS
                     RSPVESGEGDDIHKAGAASMDDRRLPPLPPAPAPALQQGEYTVGEESGDGNPPPPPPR
                     AGGHRMSVQGGPERGASMSGGSTSGAGRQASLEQPGSPSGSAAPAASQLRMSPEPFAA
                     GGFVAAPSSQTMNLNKQVSSDSQEAPVSSLGRHVSVRQGTRPGYDQLKEASATYGQGV
                     VRAARGIFAQGKKGFYGDGSPSGFVAVVMDSAGVSRPSEDSWGQVIFEQEGGSILRRY
                     DEPRPGDIAAFYDAKLKGKKGLHTYTQHVGSVEEPLVGIVGEFEDRKHKVRVLQVERG
                     VPDEVSYRCEDLKGGKVVIFRAGV"
     STS             1056355..1057179
                     /locus_tag="CND03820"
                     /standard_name="Hind24"
                     /db_xref="UniSTS:470946"
     gene            1060859..1062207
                     /locus_tag="CND03830"
                     /db_xref="GeneID:3257093"
     mRNA            join(1060859..1060974,1061009..1061483,1061529..1061660,
                     1061707..1062019,1062073..1062207)
                     /locus_tag="CND03830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570624.2"
                     /db_xref="GeneID:3257093"
     CDS             join(1060875..1060974,1061009..1061483,1061529..1061660,
                     1061707..1062019,1062073..1062084)
                     /locus_tag="CND03830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570624.1"
                     /db_xref="GeneID:3257093"
                     /translation="MADIQDKIAGARREADGLKDKIRAAREQTADTSLRAMASDTPPL
                     PRAALKARRTLKGHLAKIYALHWAADTRHLVSASQDGRLIVWDAYSTNKVHAVPLRSS
                     WVMTVAYAPSGAFVACGGLDNVCSVYALAPGGQAKVRRELSAHSGYLSCCRFINDRQI
                     VTSSGDMTCMLWDIEQGTRTMEFNDHTGDVMSISLAPNANLFVSGACDATAKVWDIRT
                     GKAVQTFTGHESDINAVQFFPNGDAFATGSDDASCKLFDLRADRELNSYAHDNILRGI
                     TSVAFSISGRVLFAGYDDYNCNVWDTLKGERIGVLAGHENRISCMGVSGDGVALCTGS
                     WDSLLKVWS"
     gene            1062291..1065465
                     /locus_tag="CND03840"
                     /db_xref="GeneID:3256912"
     mRNA            join(1062291..1062388,1062439..1062954,1063010..1063213,
                     1063277..1063337,1063389..1063546,1063615..1063849,
                     1063903..1064987,1065051..1065465)
                     /locus_tag="CND03840"
                     /product="vacuole fusion, non-autophagic-related protein,
                     putative"
                     /transcript_id="XM_570625.2"
                     /db_xref="GeneID:3256912"
     CDS             join(1062365..1062388,1062439..1062954,1063010..1063213,
                     1063277..1063337,1063389..1063546,1063615..1063849,
                     1063903..1064987,1065051..1065326)
                     /locus_tag="CND03840"
                     /codon_start=1
                     /product="vacuole fusion, non-autophagic-related protein,
                     putative"
                     /protein_id="XP_570625.1"
                     /db_xref="GeneID:3256912"
                     /translation="MKFGRRIKDTLYSEWADQYIDYGGLKKQIKANLPWNDTAEADFV
                     QALQNQLTKCETFQRNKSDELMNHIQQLEEEVKGLVEKAGYSDGGTSDEDDRAENEAT
                     TPGDVERNVRDRRDDDAGSDDDDDDDEDVSSDMLIDAIEERFRELEEQVAVLVADVHD
                     LALFTKLNFTGFIKIVKKHDKLTGYNLKNTFNRQVLEAHPFYRMNYDPLIVKLSKLFD
                     LVRTRGHPIEGDASAGGNQNAFVRSTTKYWVHDENIVPLKLAIMKHLPVLVFNPNKEF
                     SMADSAITSIYFDNEDLELYLGRLEKTEGAEAIRMRWYGDVTGNTIFVERKTHREDWT
                     GEKSVKERFTIKEGKMNDFISGRYTMDDEFDELVKRNKKTEKEVEGMKQLANEVQYAI
                     VTRKLRPVMRTFYNRTAFQLPGNATVRISLDTELTMVREDNFDGVDRTHGNWRRTDLG
                     INHPFDSIPNSEKELFPYGVLEVKLATKVGEEPPQWIRDLINSHLVEAVPKFSKFIHG
                     CASLLSERVDLVPFWLPQMDQDIRKPVSAKSKILIERPQSNIHSNASMEGSALPSPAA
                     KSSTSQASYHEPVSEGEDDEEYLVHKAKNEEDHLRLPSDVAAQARAAREHREKYIRDE
                     AARQVGITHGEAQAQAEAEAESSAAVSSSRPARQSRNQQQYDASLRIDPLASSDRFDK
                     NMQLLDDKSMKKLQEAAKDRREDQVEEGEEEEEEDDEEEGDSERVIYVDQFRAPPGKK
                     IAIPVRVEPKVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTDAVGMVSAGCFTFTS
                     LSAILYCGGMYAWRILKMRKREAVDYHDRWGPTALCAALLASVMVNLVLRLREL"
     gene            complement(1065443..1067286)
                     /locus_tag="CND03850"
                     /db_xref="GeneID:3256906"
     mRNA            complement(join(1065443..1065705,1065767..1065847,
                     1065903..1065950,1066015..1066572,1066625..1066746,
                     1066835..1067003,1067103..1067286))
                     /locus_tag="CND03850"
                     /product="isocitrate dehydrogenase, putative"
                     /transcript_id="XM_570634.1"
                     /db_xref="GeneID:3256906"
     CDS             complement(join(1065480..1065705,1065767..1065847,
                     1065903..1065950,1066015..1066572,1066625..1066746,
                     1066835..1066912))
                     /locus_tag="CND03850"
                     /codon_start=1
                     /product="isocitrate dehydrogenase, putative"
                     /protein_id="XP_570634.1"
                     /db_xref="GeneID:3256906"
                     /translation="MANILKRSALKLGMIPADGIGKEVLPAAQRVIEALGSSIPKTTF
                     VPLVAGWEEFNKNGKALPDDTVSALRECDGAMFGAVSSPSHKVAGYSSPIVALRKHLD
                     LYANVRPVSSVPIPGQPSPKAVDLVIVRENTECLYIKQEEISGEGEDRVALATRKISA
                     KASSRIGRMAFEIALRRGQEREAARAAGKDVWWKGEPKVTIVHKSNVLSVTDGLFRET
                     VRAVKEGKGGEKYAGVKLEEQIVDSMVYRMFREPEFFDVCVAPNLYGDIISDGAAALV
                     GSLGLVPSINAGDNFIMGEPVHGSAPDIEGKNIANPIASIRSAALLLSSLGYIEPAAK
                     INAAVNAVLVEGQYLTPDLGGKSSTTEVTEAVLKRL"
     gene            1068082..1069383
                     /locus_tag="CND03860"
                     /db_xref="GeneID:36392833"
     mRNA            join(1068082..1068317,1068364..1068406,1068459..1068521,
                     1068576..1068665,1068727..1068879,1068949..1069038,
                     1069091..1069178,1069249..1069383)
                     /locus_tag="CND03860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658491.1"
                     /db_xref="GeneID:36392833"
     CDS             join(1068232..1068317,1068364..1068406,1068459..1068521,
                     1068576..1068665,1068727..1068879,1068949..1069038,
                     1069091..1069178,1069249..1069295)
                     /locus_tag="CND03860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514344.1"
                     /db_xref="GeneID:36392833"
                     /translation="MGIWQDTLVRLGVAQAGPKITTQDRAILDLKLQRDKLKQYQKRL
                     EVILDREHEIAREALKSGNKKRALTALRQRKYQEQLLSKTDSQLVTLQELVSTIEFTQ
                     IQNTVLHGLEMGSHVLGELQKEMSLERVDRLMDQTREGVEYQREIDEALMSKMSPEEE
                     EAVQEELERLQSEALPNVPESSAQVALPDVPVEEPSVPEPVEPSGSEVVVQEERVAVA
                     A"
     gene            1069588..1073569
                     /locus_tag="CND03865"
                     /old_locus_tag="CND03860"
                     /db_xref="GeneID:3256968"
     mRNA            join(1069588..1070832,1070884..1071316,1071370..1071702,
                     1071769..1072222,1072275..1072546,1072606..1072717,
                     1072770..1073130,1073186..1073569)
                     /locus_tag="CND03865"
                     /old_locus_tag="CND03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_570626.2"
                     /db_xref="GeneID:3256968"
     CDS             join(1069677..1070832,1070884..1071316,1071370..1071702,
                     1071769..1072222,1072275..1072546,1072606..1072717,
                     1072770..1073130,1073186..1073379)
                     /locus_tag="CND03865"
                     /old_locus_tag="CND03860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570626.2"
                     /db_xref="GeneID:3256968"
                     /translation="MLPLRAFARLAQRPRLSRPTQLARSSLPRPSPSRPAAHYLALAP
                     APSTRFLHSSPPVLKEKRWLNNTPPEDDGEDGQNPKQDDQVEKPLPDAESSKSAEERA
                     KSQSSKPDIKASSSDSVSSSAPAPGSADGGSPPGAGGPKEVAKPVIPEIYPQVLAIPI
                     THRPLFPGFYKAVTVRSPPVIKAIRELQAHGQPYVGAFLLKDSTVDSDVVTDINQVQP
                     VGVFCQITSCFTSQEGEGKPEALTAVLFPHRRIKINELVKSSGTKGDGTVGVGGLVEG
                     SQDSAKGEGEVKSFESEVPGVEEVREELGTVSIDSEQPDVHKENRDLETKEVTQIDFL
                     HSLLPQVSLTNVSNLSIEPYEKDSQVIRAIMSELISVFKEIAQLQPMFREQVTSFAIS
                     NTSSQVFDEPDKLADLAAVVSTADVSDLQAVLSSTSIEDRLQRALVLLKKELINAQLQ
                     FKISRDVDTKIQKRQREYYLMEQLKGIKKELGMESDGKDKLVEGFKEKASKLAMPEGV
                     RKVFDEELNKLVHLEPAASEFNVTRNYIDWLTQVPWGVHTPENYNISHAIKILDEDHY
                     GLKDVKDRILEFMAIGKLRGSVEGKILCLVGPPGVGKTSIGKSIAKALGRQFFRFSVG
                     GLTDVAEIKGHRRTYIGAMPGKPIQALKKVATENPLILIDEVDKISKAYNGDPASALL
                     EMLDPEQNKSFLDHYLDVPIDLSKVLFVCTANVLETIPGPLLDRMEVLEVSGYVSAEK
                     MNIAERYLSPQAKVAAGLEDVNIELEPGAIEALIRYYCRESGVRNLKKHIDKIYRKAA
                     FKIVTDLGESGLPEPATPPAENQVEAQYPDIKPASELTYNVIPGTEVSGVDTKTDVTT
                     VPREPMKVPAGIHVKVTQENLKDYVGPPLYHKDRLYTHSPPAGVSTGLGYLGNGSGAV
                     MPVEINSMPGKGNLQLTGKLGEVIRESAQIAMSWVKSNAYLLGITKSEAEATLNDRDV
                     HLHMPEGGIGKEGPSAGTAILTAFVSLFTKTRVDPDIAMTGEISLLGQVLPVGGLKEK
                     ILAAHRAGIKKLIVPAGCKPDIDENVPESVKGGIEFVFVEDVRQVLHEAFRGTEVEKR
                     WQETLPMEEEPQRERH"
     gene            1073710..1074837
                     /locus_tag="CND03870"
                     /db_xref="GeneID:3257193"
     mRNA            join(1073710..1073883,1073943..1074077,1074130..1074291,
                     1074345..1074555,1074624..1074837)
                     /locus_tag="CND03870"
                     /product="expressed protein"
                     /transcript_id="XM_570165.2"
                     /db_xref="GeneID:3257193"
     CDS             join(1073737..1073883,1073943..1074077,1074130..1074291,
                     1074345..1074555,1074624..1074748)
                     /locus_tag="CND03870"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570165.1"
                     /db_xref="GeneID:3257193"
                     /translation="MSYLNSYQHPFSNLPKDIHLTTPPDQYDFNYVFEVKELRSDRVE
                     LRPLVPSLHAQLIYDGVTKYPEVLRWLGVKPFEDLGDVLVWIETTCRAPSDSQFFAIF
                     SEPPNSQDKTVAPEDYEFAGIIGMINSSYQAMISEPGYITILPPYHRTHVQTHCSGLI
                     MHRILDHPSQGGLGLRRCQWLTTTLNSASQAASKRMGFSFEGVLRCMKVLPQGKEGIR
                     DGRPNVRQAECMVRNDWYSSVTWYEWEESVREHVDKLMARR"
     gene            1074854..1077005
                     /locus_tag="CND03880"
                     /db_xref="GeneID:3257094"
     mRNA            join(1074854..1075138,1075197..1075252,1075311..1075389,
                     1075450..1075737,1075805..1076107,1076168..1076226,
                     1076285..1076652,1076739..1077005)
                     /locus_tag="CND03880"
                     /product="expressed protein"
                     /transcript_id="XM_570164.2"
                     /db_xref="GeneID:3257094"
     CDS             join(1074966..1075138,1075197..1075252,1075311..1075389,
                     1075450..1075737,1075805..1076107,1076168..1076226,
                     1076285..1076652,1076739..1076873)
                     /locus_tag="CND03880"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570164.1"
                     /db_xref="GeneID:3257094"
                     /translation="MTYPVYHHISQPYTYHTYIPVDENGGTSPIYALLMLGLVLFMAA
                     NVMPALIPAVDRVWYVADPALKWGFFIIISALLVQMLGLLPGVPPIHVTYVHMVTAFL
                     LVAIVWNTFVPVPSTQVEENKTPSVKEDKPTAGKKREISKEETKKEEEISPWDDLRAH
                     PSAFLATRLNKMMPWPFPMGKAAREGKELWWEKGTHLQLGHFNRVRLGKVEEEEGSEK
                     NMKPKPETEKKLKGKTEKGESEKELGKDSMTAGKQKLSSKKGKASGEPATVTATPKRE
                     EGKRNQEIAKINEGKANKQAVEDRQRRKLCRTKNLVTIIGISSMNMTLGFLLLIFYSF
                     QIVSQELNHPIPQGEKLSTILSNSSSSSSSFSQTISNSDSTNEKELTKLKVVREKEVS
                     NEKVSGSKAPSVGPKKEPAISRSIQKAAGPITMTKVNPESGGTGSDVPYETEIGMHYI
                     FNPDGKGENVEDPSMQIPSFGMSHPLMTTTYKQCAS"
     gene            1077198..1079116
                     /locus_tag="CND03890"
                     /db_xref="GeneID:3257117"
     mRNA            join(1077198..1077215,1077284..1077543,1077644..1077761,
                     1077823..1077960,1078008..1079116)
                     /locus_tag="CND03890"
                     /product="asparagine-tRNA ligase, putative"
                     /transcript_id="XM_570627.2"
                     /db_xref="GeneID:3257117"
     mRNA            join(1077227..1077543,1077644..1077761,1077823..1077960,
                     1078008..1079116)
                     /locus_tag="CND03890"
                     /product="asparagine-tRNA ligase, putative"
                     /transcript_id="XM_024658492.1"
                     /db_xref="GeneID:3257117"
     CDS             join(1077287..1077543,1077644..1077761,1077823..1077960,
                     1078008..1079036)
                     /locus_tag="CND03890"
                     /codon_start=1
                     /product="asparagine-tRNA ligase, putative"
                     /protein_id="XP_570627.2"
                     /db_xref="GeneID:3257117"
                     /translation="MRSTQRRLSSLPPTIRSLLSSRRSTLPSVSSTTHLETVSCANEP
                     VEVNGWIKSVRAHKNVAFVEVSDGSTGENIQAVLKGKSKAEGLSIGASAKLKGRLEQS
                     RGRGQDVELVVEDAQVLGTCDAEAYPIQKKSLPASVLRDNAHLRFRTSQTAAVMRIRD
                     ALARDWHDWFESHDFVHVHTPILTGSDCEGAGEVFTIVDHPPPSSSSSPQPFFPHPVH
                     LTVSAQLHLEAPTHALSRTYTLSPSFRAEPSLTSRHLSEFHMLEAEVAWENDLDGLLS
                     VVEEGVKSTVGNILNGEKRGKRLRDDLSIVAKSLRDVDDLGSVIDPAQEFADPLYHLQ
                     LVMDKPFTRITYTSALELLSSLHADSPSTISPPPLWGQGISTDHEKLLAAHFNGPVFV
                     TRYPKELKPFYMLPTPSTIENEKTHASQGSTVECFDLLFPHWGEMAGGSLREHRLTEL
                     THAIEEMGMKKEEYNWYLDLRKYGSAPHGGWGMGWDRWVGWVTGLGNVRDVVPYARWK
                     GHCKY"
     CDS             join(1077287..1077543,1077644..1077761,1077823..1077960,
                     1078008..1079036)
                     /locus_tag="CND03890"
                     /codon_start=1
                     /product="asparagine-tRNA ligase, putative"
                     /protein_id="XP_024514345.1"
                     /db_xref="GeneID:3257117"
                     /translation="MRSTQRRLSSLPPTIRSLLSSRRSTLPSVSSTTHLETVSCANEP
                     VEVNGWIKSVRAHKNVAFVEVSDGSTGENIQAVLKGKSKAEGLSIGASAKLKGRLEQS
                     RGRGQDVELVVEDAQVLGTCDAEAYPIQKKSLPASVLRDNAHLRFRTSQTAAVMRIRD
                     ALARDWHDWFESHDFVHVHTPILTGSDCEGAGEVFTIVDHPPPSSSSSPQPFFPHPVH
                     LTVSAQLHLEAPTHALSRTYTLSPSFRAEPSLTSRHLSEFHMLEAEVAWENDLDGLLS
                     VVEEGVKSTVGNILNGEKRGKRLRDDLSIVAKSLRDVDDLGSVIDPAQEFADPLYHLQ
                     LVMDKPFTRITYTSALELLSSLHADSPSTISPPPLWGQGISTDHEKLLAAHFNGPVFV
                     TRYPKELKPFYMLPTPSTIENEKTHASQGSTVECFDLLFPHWGEMAGGSLREHRLTEL
                     THAIEEMGMKKEEYNWYLDLRKYGSAPHGGWGMGWDRWVGWVTGLGNVRDVVPYARWK
                     GHCKY"
     gene            1079659..1081326
                     /locus_tag="CND03900"
                     /db_xref="GeneID:3256908"
     mRNA            join(1079659..1079854,1079905..1080647,1080701..1080847,
                     1080911..1081150,1081198..1081326)
                     /locus_tag="CND03900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570162.1"
                     /db_xref="GeneID:3256908"
     CDS             join(1079725..1079854,1079905..1080647,1080701..1080847,
                     1080911..1081150,1081198..1081236)
                     /locus_tag="CND03900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570162.1"
                     /db_xref="GeneID:3256908"
                     /translation="MSHTPTSTSSGNAPTTDKKPSLTGVRIKQRKGQAKATAKFEPEA
                     FRDALLLHLALLPHPITKDALVAKLVQAGSTLEFLKYSEQLFELLFVGGLLQPGGSYL
                     DDKRSPVYILQPDDAPDAFKDGVKGMIEVLKRVMQRYKYLQKPLEENFLPGVLSYLPK
                     WDVKSREKLAEATALLTIELQISSRCLQSLAKEHVVKDNVALNFLTAFIKTYLSRQSI
                     DQFGSTLRRSGLKSILAVFPLQIRDRKHLEAHFREENLQVVNDWYAKLALGEVKDETV
                     QAVERMINDDETSDQIIEALKLQQSERPVSEADLSEWIWLALMGTVDWTARSDQIDTF
                     VISHITRYASILETFCQSAKAQVNLINAVQVYCYTDTRIIKSFVQILKVLYNADVVSD
                     QAIIYWHQKGAKPNGKGHFLKVAEPLVKFLSEQESDSEEE"
     gene            1081865..1083236
                     /locus_tag="CND03910"
                     /db_xref="GeneID:3257141"
     mRNA            join(1081865..1082174,1082251..1082425,1082485..1082675,
                     1082741..1083236)
                     /locus_tag="CND03910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570628.1"
                     /db_xref="GeneID:3257141"
     CDS             join(1081973..1082174,1082251..1082425,1082485..1082675,
                     1082741..1083219)
                     /locus_tag="CND03910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570628.1"
                     /db_xref="GeneID:3257141"
                     /translation="MARNSEKAQSMLYRFREQQAIDMGIGTRQKGDRRPRMASSCTSL
                     REAERWRGDILRDISRKVSKIQDVALTDYQVRDLNDEINQLFREKRAWENQIINLGGA
                     NYRRAAGVMTDDEGREVPGTRGYKYFGRAKELPGVKELFTRSTQQATEESARTASFQM
                     FRHQGPDYYGDEDELDKELIDTEDVEAREGWEDQVRKSASTLGISDETLLPRYPVSIS
                     SKLPDASVDPTQLQENEEAPQKSEKALKGTGKSKRKYKGVNDLEEGGQKEEQEEAKKS
                     KTDTSVAINSVAEGQNIASETAVAAAQAQAAAFLGVLDAESLEFPTMPSKDEMAKVLL
                     EVRKQALKEEYGVY"
     gene            complement(1083307..1085047)
                     /locus_tag="CND03920"
                     /db_xref="GeneID:3257303"
     mRNA            complement(join(1083307..1083638,1083693..1083743,
                     1083800..1084201,1084417..1084462,1084555..1084573,
                     1084627..1085047))
                     /locus_tag="CND03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_570633.2"
                     /db_xref="GeneID:3257303"
     CDS             complement(join(1083479..1083638,1083693..1083743,
                     1083800..1084201,1084417..1084462,1084555..1084573,
                     1084627..1084704))
                     /locus_tag="CND03920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570633.1"
                     /db_xref="GeneID:3257303"
                     /translation="MNFKALFATVALLATAWAEDLTVNSPASVVVCQPVALSWSGGTA
                     PYIVAVIPGGQSSAAALETISDSESGTQVTWNADIDAGTSITFKITDASGSIQYSSPV
                     TIQDGDSSCVSSSSSNSTSAASGSDSSASSSATSSADSTGAAAGGAASGSSAAASDAS
                     TAAASGSSTAAASGSSDTASASTSASGSSAASSAADSTAAGSSGSAGTASGSGTAAAS
                     AADSTASDSAAVPLAVQIPAVGLAVIGGLAALL"
     gene            1085524..1086950
                     /locus_tag="CND03930"
                     /db_xref="GeneID:3256946"
     mRNA            join(1085524..1085692,1085762..1085775,1085835..1085876,
                     1085955..1085965,1086022..1086076,1086136..1086293,
                     1086356..1086599,1086661..1086950)
                     /locus_tag="CND03930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570629.2"
                     /db_xref="GeneID:3256946"
     CDS             join(1085771..1085775,1085835..1085876,1085955..1085965,
                     1086022..1086076,1086136..1086293,1086356..1086599,
                     1086661..1086700)
                     /locus_tag="CND03930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570629.2"
                     /db_xref="GeneID:3256946"
                     /translation="MFGAAAVPGSRQGCFKCGNLGHIAENCQAPGRLCYNCREPGHES
                     TNCPQPRSTDGKQCYACGGVGHVKSDCPSMRGAFGPGQKCFKCGRPGHLARECTVPGF
                     VGAFRGRGGFGGAFGGRPRPPINPDGTPVKCYRCNGENHLARDCLAPRDEAAILASKK
                     CYKCQETGHIARDCTQENVSPPAE"
     STS             1086208..1087069
                     /standard_name="Pst16"
                     /db_xref="UniSTS:470948"
     gene            complement(1088100..1091408)
                     /locus_tag="CND03940"
                     /db_xref="GeneID:3256913"
     mRNA            complement(join(1088100..1088520,1088571..1089259,
                     1089307..1089651,1089691..1089943,1089999..1090177,
                     1090232..1090365,1090412..1090839,1090887..1091045,
                     1091103..1091290,1091328..1091408))
                     /locus_tag="CND03940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570632.1"
                     /db_xref="GeneID:3256913"
     CDS             complement(join(1088167..1088520,1088571..1089259,
                     1089307..1089651,1089691..1089943,1089999..1090177,
                     1090232..1090365,1090412..1090839,1090887..1091045,
                     1091103..1091290,1091328..1091364))
                     /locus_tag="CND03940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570632.1"
                     /db_xref="GeneID:3256913"
                     /translation="MSFKKDDEAGGISFYHDKSTVIQEARVFNESPISPRKCRALLTR
                     IVYLLYTGETFSTQEATTLFFGVTKLFQHKDSALRQMVYLVVKELSTVAEDVIMVTSS
                     IMKDMQPNLEVVYRPNAIRALARIIDAQSVQSVERFFKSALVDRSPSISSASLISSYH
                     LFPLSPTIIKRWSNEAQEAVNAKSVSSYSGASAYFSGGSAGGYQAVASSSYIMQYHAL
                     GLLYLIREKDRMAITKMVQQLGASGKGSSIVRNPMAICMLIRFARKIMDEDPNLRKQM
                     HEYLETLLRHKSEMVNIEAARAICETKDVQPGDLYKTIAVLQLFLSSPKPVIKFAAVK
                     TLSKLAQTLPQSVAALNVEMENLITDSNRSIATYAITTLLKTGNEASVDRLMKQISSF
                     MTDITDEFKIIVVDAIRSLCLKFPAKQAVMLSFLSGVLRDEGGYEFKHAVVEAIFDMI
                     KYIQDSRDAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFIRYIYNRVVLE
                     NAVVRAAAVSSLAKFGVCVDDPSVMKSVNVLMRRCLDDVDDEVRDRAAMYIKVLEEKS
                     LADLLVKDEAQFSLANLEEQLMSYVRDNSKHASAFDISAVPKVSREQAHAEMAQTRSS
                     ALDVAGPSTAAVITPASPIPSAKEAQSSYAAQLSTIPEFEPYGPVLKSSAKPIELTES
                     ETEYVVTAVKHVFRKHVVFQFNVANTIPDTVLEQVAVIMQPSPDCGLIEDFIIPINSL
                     TTQVGQAPVYVSFTRENPQEYAAGSFGCTLKFVSKEVDPSNGQPEEEGYDDEYQVEEL
                     DLGAADYITPTFVTFVNEWDKLASSPSLTETFALSSSESLREACRSLIEVLGMLPLGG
                     TDTPTSNSVHTLNLAGLAIPIADGEKSSKVLARCRMTYAPGTGVTIELNVRAEEEEAA
                     RLIMAAI"
     gene            1092003..1094315
                     /locus_tag="CND03950"
                     /db_xref="GeneID:3256836"
     mRNA            join(1092003..1092305,1092373..1092501,1092569..1092684,
                     1092735..1092755,1092816..1092897,1092954..1093091,
                     1093142..1093166,1093215..1093303,1093363..1093419,
                     1093478..1093648,1093702..1094315)
                     /locus_tag="CND03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657046.1"
                     /db_xref="GeneID:3256836"
     CDS             join(1092105..1092305,1092373..1092501,1092569..1092684,
                     1092735..1092755,1092816..1092897,1092954..1093091,
                     1093142..1093166,1093215..1093303,1093363..1093419,
                     1093478..1093648,1093702..1094139)
                     /locus_tag="CND03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512783.1"
                     /db_xref="GeneID:3256836"
                     /translation="MVPALSSLSFLILLFPLLVSAACTDNSTDTAGLQKLLTDGSAGY
                     KLQLCQNQIYSLTNTLNYTASNQEISTEGYPIGDARAVLVVAGFNQTTAVKASGTTQD
                     SAALRHVIINGNRAANESVYKGGGGNIEFGGANSNQVIEYVKSYDPRGWSCMHISEGQ
                     LNCVNATVQYNDIGPCGTDYFQNWADGISLSCSASLVQNNEIIDATDGGIVVFGAPFS
                     TVRNNTIKAKTRVMIGGINMVDVKPWKPIGNYSHTVVEGNTIYGGFATSMGNETRGPQ
                     EYQAIIKIGLALGPDAWFSDQRFGSNKSFGGVIQDNRFSGAFAFGMGVTSAKDFIIQN
                     NTFFGNTSFIGNYGPNCTTGNKTPHPSDPLLEELSTLQNTTISVPASSPFQFVNGTAI
                     GLTCFVPPESTSYSWPYGDGQVNSEQADKGNGTSGTSTSTGSASQTSAASTVSSNGNE
                     SAARRVAGLPSMKGFVLAIAITWTMSRSITTGDFTAVF"
     STS             1092168..1092968
                     /locus_tag="CND03950"
                     /standard_name="Eco7"
                     /db_xref="UniSTS:470949"
     gene            complement(1094301..1099198)
                     /locus_tag="CND03960"
                     /db_xref="GeneID:3257137"
     mRNA            complement(join(1094301..1094704,1094756..1095096,
                     1095151..1095412,1095467..1095585,1095645..1095782,
                     1095837..1095992,1096043..1096162,1096220..1096334,
                     1096386..1096460,1096516..1096691,1096749..1096884,
                     1096939..1097501,1097551..1097697,1097761..1097841,
                     1097891..1098130,1098188..1098576,1098629..1098743,
                     1098798..1098989,1099048..1099198))
                     /locus_tag="CND03960"
                     /product="DNA repair-related protein, putative"
                     /transcript_id="XM_024657047.1"
                     /db_xref="GeneID:3257137"
     CDS             complement(join(1094680..1094704,1094756..1095096,
                     1095151..1095412,1095467..1095585,1095645..1095782,
                     1095837..1095992,1096043..1096162,1096220..1096334,
                     1096386..1096460,1096516..1096691,1096749..1096884,
                     1096939..1097501,1097551..1097697,1097761..1097841,
                     1097891..1098130,1098188..1098576,1098629..1098743,
                     1098798..1098989,1099048..1099128))
                     /locus_tag="CND03960"
                     /codon_start=1
                     /product="DNA repair-related protein, putative"
                     /protein_id="XP_024512639.1"
                     /db_xref="GeneID:3257137"
                     /translation="MARTGSRRQIDQLDSDNELARPHQSSQFKRAKTEPGTGDISSSD
                     FNSDNDDAGMDMDDSSDESEYEEPSYEEEALLAAYSDLRRSQKGYVGSASSAGIIKSI
                     SLIDFMCHRHLTVDFGPRMNFVVGHNGSGKSAVLTAIAVALGGKANLTGRGTGLKDLI
                     RTGAERAVITITLANSGDSAYRPEVYNPNIVIERTIHSNGSSGYKFKASKDGKTIANK
                     RSELTSISDYFNINIDSPLTVLTQDQSRSFLQNADPSKLYKFFLNGTQLSNLLESYEA
                     SSQNIESLVNFIKRQREALPDLKAKVESYKRKIQASKKVMRQKRRNKQLLIELAWSYV
                     IEKEKARDEKKSDVLELREKIEKVQEEIHKTDKELPQVNDAILETESDLKNLDESSKP
                     LALAVRQAKARSQEASKELRSMQSSVAEIEEKIISEKSTLERLERKIEEQLRLNEPEQ
                     QEERRRLLQRRAKAEDILSKLQLERPARERERDDKFQAQKRAKEELQSINANLRDVNQ
                     SKAQMQRQIQNISRQANSRIAAFGLHIEPLLEEINSTNWKHSKPIGPMGMFVHLEDMR
                     YADVLQVMLGSALCSFAVRDHEDRVKLSNILSKHFARGYRPGNFTARDGARIPTIYRH
                     SGELFDFSNGDLSRHGPTILSKLRIENEEVLRILIDHHNIEKTMLAPTLIEGNRLMDD
                     LLNKNVAQYVTVHCADLMTTSGTKSNRHSGPTNKYRGNPLFALDVGSEIAKCEAQLQD
                     YESQCQQLCNSASMTENRIASLQQDMAKLSAGITDLQKKMIPLEKDLDQTKRKLADMA
                     STEIDTSESIRDDLKERINELEMKLQEHNADIIKQEDVIKQLDADVVQKRAAFDAQAP
                     TKELLLKNLESQVQRRTNILTRQSHWAQSLINYETKLEEAEEILVDLEQNVQEWTNKA
                     LDYAPEKINTIKTPAELEAERKALDQSITEASKALGVNLDELTAEYRLQRQRYQKANE
                     NIKDLNFLRIVLRKAMTNRHTWWHQTRSHIAIRAKTAFVVFESFRAMEGRLNFDHGHE
                     KLSLVIHNQTTTESQDGTYTQISHYKGAKALSGGERSFSTVSLLLALWSTVPCPIRAL
                     DEWDVFLDAANRKVAAKNLMEGARESDGKQYILITPLDMQGIDTSGPDKKVIRMADPE
                     RGQGTLNMSR"
     gene            1100588..1103552
                     /locus_tag="CND03970"
                     /db_xref="GeneID:3257242"
     mRNA            join(1100588..1101251,1101572..1102112,1102173..1103552)
                     /locus_tag="CND03970"
                     /product="expressed protein"
                     /transcript_id="XM_570631.1"
                     /db_xref="GeneID:3257242"
     CDS             join(1101806..1102112,1102173..1103410)
                     /locus_tag="CND03970"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570631.1"
                     /db_xref="GeneID:3257242"
                     /translation="MMSEAFLLSTHSYAPSSPDPTHLRLLAFSVAEAALQSDPNSPPI
                     SLTMDKAPVLPEIPHNLCDWPIQVEDVEEDWIEDRWRDTEHERRTQWEMGQKETGMKK
                     SALGKILSGSPFSPSYYGFSLPRNSSLAATASDCVWDDLYERPKIASGKPTKEIRRQR
                     LRSCTHFTDPCSFLPTSSQPDRRHPSPDFEPRLAARKCSTHPGQGPVSNKHSSIKSDM
                     FHPNQPIDSPPCTNVRLPSLAQIHAKMGSPARQQSASGMGAVRMDTSESIEILQTPTE
                     EYTSSRIEARLALSTVLHRRPSTPPSPVTMSAVSSPKEKEAPRLAPFLRERTNGRISG
                     RPSSMPPMTFPAEHMTSLADLGKSHYTPPKSAVMVTPPKNRYKFEGGGDVPEPVRPPL
                     IQSISGGTPVSRIGGSSFPHMTTTPSSERTAVSPTYITSPTGSASSTMSIPRITCTPA
                     PVKVVKDGLEIDSDEDEGDVVLFEADTCGSERGKPSLLQAAQEKERVARAAAMKKRLL
                     QRRMSN"
     gene            1104268..1110733
                     /locus_tag="CND03980"
                     /db_xref="GeneID:3256873"
     mRNA            join(1104268..1104538,1104592..1105539,1105600..1105948,
                     1106008..1106442,1106497..1106528,1106672..1106698,
                     1106743..1106842,1106900..1106969,1107029..1107077,
                     1107131..1108497,1108548..1108768,1108817..1108876,
                     1108925..1110733)
                     /locus_tag="CND03980"
                     /product="phospholipid-translocating ATPase, putative"
                     /transcript_id="XM_024657048.1"
                     /db_xref="GeneID:3256873"
     CDS             join(1104642..1105539,1105600..1105948,1106008..1106442,
                     1106497..1106528,1106672..1106698,1106743..1106842,
                     1106900..1106969,1107029..1107077,1107131..1108497,
                     1108548..1108768,1108817..1108876,1108925..1110572)
                     /locus_tag="CND03980"
                     /codon_start=1
                     /product="phospholipid-translocating ATPase, putative"
                     /protein_id="XP_024512638.1"
                     /db_xref="GeneID:3256873"
                     /translation="MTSSSTYQSHGQPSTSTTHLSARLSSRSSFEHQGTDDESLDVFD
                     PMSIDPDLRLRTVKTAHSVLAESIRSEALAEKREKRRRLFRSMKRKASDIGKGTLKRK
                     GPAGDNGKPDSGKTEAGNTDAISTAGSLTSQPPPITPPEHQHQSGKTKGKAKNRKAEL
                     PRRTVYVNIPLPSSLRNSQGEPVVRYVRNKVRTSKYSLITFIPKNLLEQFRRVANIYF
                     LFLVILQLFSIFGAPNAQIGMLPLLAILGMTAIKDAFEDWRRAKLDNEVNNSATTKLG
                     AWKNVNQPKDPRNFVEKLFGLGPNPNKTSKGVQKLRAREANQGNQMVLDSRRAEEQDP
                     LEDLAVSDKESYPLGPMSRAEFSTVSAVDSTSDSLALEGYRRSFSAGISRSSLPSMMS
                     RKSVGVVDWSRSVPGAAQWERTLWKKLEVGDFVLLRDNEQVPADVIVLSTSNADALCF
                     VETKNLDGETNLKIRRSLKATSAITSEEDLEHAHFVVDSEAPHANLYSYNGVLRYTPT
                     DQYGKQMEEKQEAITINELLLRGCTLRNTKWVIGMVIFTGSDTKIMLNGGETPSKRSK
                     IEKETILCLITAILHGWYRSLSGTSADWYEPDAEASDNIYVDSVIIFFSCLLIFQNIV
                     PISLYITVEIVKTIQAYFIFQDVEMYYEPYDTPCVPKTWDISDDLGQIEYIFSDKTGT
                     LTQNIMEFKKCSIHGVPFGEGMTEAMMGAKKRDGQDISTAMEDQEDELQVLKEKMLEL
                     MTGVMDNRYLRQDKLTLIAPDLVQHLTTPSDPLRSPIIDFFRALAVCHSVLADTPDQS
                     KPFELEYKAESPDEAALVAAARDIGFPFVSKNSHFLEIVVLGKPEKWIPLRMLEFSSS
                     RKRMSVVARDPNGKIVLFCKGADSVIYNRLSVNHDQELKDATLKDLETFANGGLRTLC
                     IAYRNLSEEEFSDWSKKYDAASAATVDREGEIEKACDLVEHSLTILGATALEDKLQEG
                     VPDAIATLHRAGIKLWILTGDKLQTAIEIGYSCNLLTNDMEVMIISADSEDGARQQIE
                     AGLNKIASVVGPPPTTSGGRIMTAGMNPAVKFAVVIDGESLRYALEPSLKSLFLSLGT
                     QCAAVICCRVSPSQKASTVRLVKEGCNAMTLAIGDGANDVAMIQEANIGVGLYGLEGS
                     QAAMSADYAFGQFRFLTRLLLVHGRWSYVRVADMHANFFYKNIIFTVSMFWFFIFSSF
                     DATYLFEYTLLLMYNLFFTSLPVGFLGAFDQDVNPTAAMVFPQLYKRGIASLEYTRTR
                     FWLYMFDGLYQSAVIFFIPYFAYGTGESWSSQGRDTNSLWDIGTTVACAGVLSANGYV
                     SINIRYWTVMTWIINVASTLLIYIYIPIYSAVTALPYAGEVGVIYPTFSFWAVILIAT
                     IIAIGPRWLVRSFKQSYFPQDKDIIREAWVTGQLKRDLGIKSRKQKRRQNKEKADAAR
                     CEENEQELEDVPGLELVTGKDLVQQFQKGNMEGDAFRGLYEPAATYSPRKEAVRSPLM
                     SEESSPRNMRAYHPAYTNYSTNDISSIRQIQTSIPPPFTARTSFNSAEQPSPLGQSIA
                     SSDHSFQNPLRTYDCHPSPSSIHQVEAEISREVGRLKRTSKDIQRASSLYDKEEESVR
                     MSRASLFSQKGFEALPQSGDSRGSISNLSRKQSISVLGGSVPASWKDSSPLSNVDELG
                     RGNLSSMRGALDVTAKHSELFENRVENQSWRPSDDHLLYARERSSSAVQQTKNIFDFT
                     DASSSQWGAEASKKDNEWEGAGYAI"
     gene            complement(1111046..1111136)
                     /locus_tag="CND03990"
                     /db_xref="GeneID:3256869"
     tRNA            complement(1111046..1111136)
                     /locus_tag="CND03990"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:3256869"
     gene            1113949..1114872
                     /locus_tag="CND03995"
                     /db_xref="GeneID:36392834"
     mRNA            join(1113949..1114266,1114327..1114482,1114570..1114872)
                     /locus_tag="CND03995"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658493.1"
                     /db_xref="GeneID:36392834"
     CDS             join(1114105..1114266,1114327..1114482,1114570..1114758)
                     /locus_tag="CND03995"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514346.1"
                     /db_xref="GeneID:36392834"
                     /translation="MIFMIPIHISTLILHLFASAAYASSQPFLGGCLKSNPAPANSLA
                     ITAISPSQCVTQCWNEREDTRYAYWDSRSEDKCLCSPFPANAIDFTLSNQAEAFETCA
                     EGITMYVRAPEPPNFQIERKRAGKGRPGDVSSRAEGLCPSPLTACSVAGDSSIYEVKV
                     FFLISCTP"
     gene            complement(1115179..1115277)
                     /locus_tag="CND04000"
                     /db_xref="GeneID:3257462"
     tRNA            complement(1115179..1115277)
                     /locus_tag="CND04000"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3257462"
     gene            1115402..1117148
                     /locus_tag="CND04010"
                     /db_xref="GeneID:3257145"
     mRNA            join(1115402..1115591,1115652..1115784,1115934..1116011,
                     1116105..1116217,1116301..1116396,1116479..1116517,
                     1116573..1117148)
                     /locus_tag="CND04010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570639.2"
                     /db_xref="GeneID:3257145"
     STS             1115432..1116185
                     /locus_tag="CND04010"
                     /standard_name="Xba24"
                     /db_xref="UniSTS:470947"
     CDS             join(1115589..1115591,1115652..1115784,1115934..1116011,
                     1116105..1116217,1116301..1116396,1116479..1116517,
                     1116573..1116851)
                     /locus_tag="CND04010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570639.1"
                     /db_xref="GeneID:3257145"
                     /translation="MALTPQALRLLSRQIMALKSDPPEGVRIAVGEEDFTALEGWVQG
                     PSGTPYEGGYFRIRFAFGSEFPNLPPKCTMVTKIFHPNISKSGEICVDTLKKGWKKEY
                     GVGHVLITIKCLLIFPNPESALDEEAGKQLLEDYEGYSKYARLMTSIHAIPKVAPPEF
                     RVAKMSRSDEHMPTGTSPSPMNNLLHRPIPLGNSSSQEQGPILSHPGQHVQDAKNDLK
                     AFGNSRAACSGGIKTAPMSKVKRGAKRL"
     gene            1117476..1118846
                     /locus_tag="CND04013"
                     /db_xref="GeneID:36392835"
     mRNA            join(1117476..1117580,1117643..1118196,1118246..1118616,
                     1118694..1118846)
                     /locus_tag="CND04013"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658494.1"
                     /db_xref="GeneID:36392835"
     CDS             1117673..1118179
                     /locus_tag="CND04013"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514347.1"
                     /db_xref="GeneID:36392835"
                     /translation="MTRTMASPTILSSPLLSLESINILLASPAPQNVDVRIQLLSAKI
                     LALSNLPLSPACRLDVQKTRFQLGKTYLRDKFDLKCAEIELGMVQRECKELARKKSYK
                     ADELEHYPSQENIIKEMAVEYEALQSQAKELRMEAMRLLVEVEEGLGRLGRAATWRNL
                     IEAAVKDA"
     gene            complement(1118665..1119914)
                     /locus_tag="CND04015"
                     /db_xref="GeneID:36392836"
     mRNA            complement(join(1118665..1119496,1119561..1119719,
                     1119813..1119914))
                     /locus_tag="CND04015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658495.1"
                     /db_xref="GeneID:36392836"
     CDS             complement(join(1119444..1119496,1119561..1119719,
                     1119813..1119903))
                     /locus_tag="CND04015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514348.1"
                     /db_xref="GeneID:36392836"
                     /translation="MNSHQTQLLRRLHCILLHFTHWVYTQLCRNYKSDIQLLCVSLVY
                     LGQASFRRTTGVNDEGMGICASTESSVYNGGPSQCTGAYGTMPDKMNECQKRVIMP"
     gene            1120019..1123213
                     /locus_tag="CND04020"
                     /db_xref="GeneID:3257203"
     mRNA            join(1120019..1121074,1121130..1121605,1121654..1122331,
                     1122378..1122743,1122796..1123213)
                     /locus_tag="CND04020"
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /transcript_id="XM_570640.2"
                     /db_xref="GeneID:3257203"
     CDS             join(1120087..1121074,1121130..1121605,1121654..1122331,
                     1122378..1122743,1122796..1122927)
                     /locus_tag="CND04020"
                     /codon_start=1
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /protein_id="XP_570640.1"
                     /db_xref="GeneID:3257203"
                     /translation="MFAVSLQDRLKAAVNSLEATGSTLQARALNANQHPQDTRDSSPQ
                     DATSANPRPASPSPPFPHSNNSKQDVRSKSVPVPLNQAAYTGATTSQLAENALSGLRK
                     SFQFGRSSLDLSDPVGISSSLPATPSGQGVKDIDLPSPSASVPAEPSAFAGKSPAVSF
                     LQITDAANGPTEIHARSTTMRTLIPGDPMSIPLPPSPTLSSILPSPEADPLGASTSYD
                     SVDEGTIPGHKELKPVEKPDQDEKDLNQPDEEMASTNVKKLADLERRYDDLSNRFTTL
                     LIQAHQANKIFKELTPLESCISDVEALEGWIRMMVGKVEMMGTEMKRLQDNLTLQDSR
                     IEELRDTHRLESASQNELVSKLRSDLSESQSKLSTYSSTAATVTQLRADLAKAQTQAK
                     EEEEKRIKAISLLKTVRLKLVKVEKEKEELEKDRASERAERSRLNEEMEKAKIEKEKE
                     VSSLKKGFERELGGAKERYEKELKDKKASWELEMITTKAAHAKELSQKSVKISGLEAI
                     IKELNTNKQTIHALLQSKQAEAESARADMEEMQTKSKELEFQLREANERCSLLEDSLR
                     DDGMGRGGPVGMTVLETRRDSLSSSRNNSLSGTSPMEIQRLLAESESRAESKLSELRA
                     RIRSLECERNELEEEWAGKMQERVRELEKMRRVLLDKEKEHARSLEGLRERESTIQEV
                     EQKTRDLEAEISRMKLRMEEVEGDKAVASESERAAREELSSLQHELVDLRSQLDDSKS
                     HISFLKSTNKTLRDEMRKIQSSVQLMEKQRNPGVGYWAAAAGQRSSMVGSPMSSVNVD
                     SPALGRKSVESIRTTAGTEIGSDLGESKRTPEEDLNLEYLRNVILQFLEHKEMRPNLV
                     RVMSVILRFTPQELRRLNAKLLS"
     gene            complement(1123214..1126601)
                     /locus_tag="CND04030"
                     /db_xref="GeneID:3257107"
     mRNA            complement(join(1123214..1123617,1123684..1123758,
                     1123821..1123890,1123944..1124003,1124079..1124165,
                     1124224..1124310,1124373..1124752,1124804..1124897,
                     1124955..1125069,1125128..1125464,1125521..1126083,
                     1126141..1126601))
                     /locus_tag="CND04030"
                     /product="CAP1-related"
                     /transcript_id="XM_024657049.1"
                     /db_xref="GeneID:3257107"
     CDS             complement(join(1123318..1123617,1123684..1123758,
                     1123821..1123890,1123944..1124003,1124079..1124165,
                     1124224..1124310,1124373..1124752,1124804..1124897,
                     1124955..1125069,1125128..1125464,1125521..1126083,
                     1126141..1126426))
                     /locus_tag="CND04030"
                     /codon_start=1
                     /product="CAP1-related"
                     /protein_id="XP_024512637.1"
                     /db_xref="GeneID:3257107"
                     /translation="MEVQEASPRIPFRAASTPPASAPHLYTTPASYNPSTRASQDGYP
                     ESPVGLRPQATFQKPYIFTLGQLPTRRRRFRILGSPKRLFLIVFLAVLALLGRFWHAS
                     DKSKIAGLKDFDGLCRFVSPIDAYHRDLTRLRTVFRGSSFSRNSSIYHGRSKTFKHYH
                     SYSPTGHLIVSHDPEAPHPIPLLLDLGEKRWEELLSRQSRTLEEAVREYIRRYGRQPP
                     KGFDKWWDFAMQHNLVLPDEYDRINLDLAPFLALPKSEMMRRMEMVDNMAETFTLVVR
                     NGSVDIEIKDEGGLQWGGTLPRARDTASLLRGFSDYLPDMRATFSIFDQPQIYLSWAR
                     RGSLVDLGLRGEKTSHLEETDSAKVKLSRSCAPDSNYRKNENFSEGKSLIYDSLEAGD
                     LCQNPYLIPLHGLTIEPHEPYSHPRPHTQLLPLFSLAKTSINSDILVTPLDQFHDPPG
                     NDPEWENKPSSKLAWRGSPTGISWMTSDLDWRSAHRFRLHNYANNRSLEPMNYLVPNL
                     GQREEDDYDELDVYSAMGGDEDLDGWREGNTEVKEHRATETEGPLRYKEEKILTAQAM
                     EFFYDIKLAGEPIQCSQDDGTCQSMWDEIEWAPRQSGDDLNLNKFLLDIDGNGWSGRF
                     RKLMSTNSLVIKMTMFTEWFQPHLIPWFMYIPAKLDFSDLPDIMAFFRGTPTHPELAF
                     DETAQALARNGKCFVQRMFRMEDLQAYMMRLFLEYARIAAKEGVDMDFHLNNDNWTQI
                     NSFERFSSPEDTLVDGGYSSHLTKMPLPDAKEEAPRHKAGVIMEEAKKDMDGMDGVKL
                     EVWISGDDVAVDTTAGERK"
     gene            complement(1127643..1129265)
                     /locus_tag="CND04040"
                     /db_xref="GeneID:3256848"
     mRNA            complement(join(1127643..1127815,1127876..1128146,
                     1128203..1128274,1128319..1128407,1128458..1128536,
                     1128599..1129043,1129100..1129265))
                     /locus_tag="CND04040"
                     /product="ATPase, putative"
                     /transcript_id="XM_570595.2"
                     /db_xref="GeneID:3256848"
     CDS             complement(join(1127696..1127815,1127876..1128146,
                     1128203..1128274,1128319..1128407,1128458..1128536,
                     1128599..1129043,1129100..1129136))
                     /locus_tag="CND04040"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_570595.1"
                     /db_xref="GeneID:3256848"
                     /translation="MAPRDIGRVFMDVAFFAASQVALYYTLRYVVSSLDPASGSSRKA
                     KEKSKSLLAQTGLSEAQLASLELDEYEQAIAAEIVPPSSIDVTFEGIGGLDDIIASLR
                     ETVIYPLTFPELFGSGNGLLSAPKGVLLYGHPGCGKTMLAKALAKESGATFINLPLSS
                     LTNKWFGESNKLVAGLFSLAKKLQPSIIFIDEIDSLFRERSAGDHEVTAMMKAEFMTL
                     WDGLTTGSDSRILVLGATNRPNDIDPAILRRMPKRFAIRLPNHEQRVKILTLMLMHTR
                     LASDFSIEKLAQRTDGLSGSDLRETCRNAVMTPVQELMREKGKSGVQGLEKARKEGFQ
                     IRPLNMDDFVLHDSHAYAYVDPSRRPPGAYVTESLD"
     gene            1129517..1131406
                     /locus_tag="CND04050"
                     /db_xref="GeneID:3257153"
     mRNA            join(1129517..1130167,1130218..1130421,1130474..1130612,
                     1130659..1130790,1130844..1130996,1131046..1131144,
                     1131204..1131406)
                     /locus_tag="CND04050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570581.1"
                     /db_xref="GeneID:3257153"
     CDS             join(1129587..1130167,1130218..1130421,1130474..1130612,
                     1130659..1130790,1130844..1130996,1131046..1131144,
                     1131204..1131317)
                     /locus_tag="CND04050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570581.1"
                     /db_xref="GeneID:3257153"
                     /translation="MSSQNVSGLMAGLSLYAPQSPKGSKAQQAGKTQESSHSSQSQNR
                     LPPVLKKYMNPGLVRPPNSGLANNSHPSSSYSDPSSRGPLLTLAGVNVSYPKSGTVSP
                     MNKSKGAVGHHSAHGIHGPAHSTSSRAMASSINPGASKHAVTTSSSHITNLVSENCKS
                     LELGRYDGGLEEDEANHGDASGPTAKMLELSSVSEGAIPLSLPSFTIGRPLGKGKFGR
                     VYLARSKAPPHFIVALKCLHKAEIIQGKVESQVRREIEIQQNLRHPNILRLYGYFHDS
                     KRIFLVLEFAAKGELYKQLSRLGRFDEKKSSRYIAQMADALSYLHRKHVIHRDIKPEN
                     LLIGLNGELKIGDFGWSVHAPSNRRSTLCGTLDYLPPEMVEGKEHTAAVDLWALGVLT
                     YEFVVGGPPFEDLSGNAATYRRIRNVDLHVPSWVSPEATDLIKRLLRYKPEDRLPLSQ
                     VMIHPWIKMYEKKRSASNGIRRS"
     gene            1131976..1134080
                     /locus_tag="CND04060"
                     /db_xref="GeneID:3257377"
     mRNA            join(1131976..1132438,1132489..1132866,1132942..1133526,
                     1133583..1133778,1133838..1134080)
                     /locus_tag="CND04060"
                     /product="expressed protein"
                     /transcript_id="XM_570582.2"
                     /db_xref="GeneID:3257377"
     CDS             join(1132031..1132438,1132489..1132866,1132942..1133526,
                     1133583..1133778,1133838..1133950)
                     /locus_tag="CND04060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570582.1"
                     /db_xref="GeneID:3257377"
                     /translation="MPSKRSATASITTASKRRRIHTSSVWTHKDDWSTLLSDSSLSTS
                     SISVRPPRFRTFPTLTRCASDAVVKGFPSFWRLAKHADRMTKYSGPDEIVREDWERWW
                     KEWWERVPSRLQETVRDNIFKKWGGALSIPVIQELFVIPGVLFLPGDLLPAVAQATRL
                     KPLIPPTHISSLLNTLILTHSPTSSDVGIAGLIYHLPNLEAINLKGCTSVAEKTVKTI
                     LNRCAGLRKINLKGTKIVERGVKDLLGTFGGQLESFKIDNVTFDNTDDTFSSSPYPLI
                     SHLCLPGDILNRSSSSANRNTIRFTGMGYPQPRNTLTTGIIQWSGFSRCFPRLTHLYL
                     PGLLVPSGTKIDTSFLKLEKIVLGPRGPPVPISTVISLIAGHESTLRSLHLGNVYPDI
                     PSSRASHMAAYDDLANHLRQSKLLEQFRWQTDIKGTNDSVADISMRQWGEMVFEHFFD
                     TRKGPLKHLVLEVPCPFRTPQMADLACNTVNPSQLETLEIPGAYLLDHKQFTLIIASY
                     PKLRHLDLSGTTIDDDDMKIIIRHCQLLSRINLTSCRGINVRHRRNIFDVR"
     gene            1135654..1137558
                     /locus_tag="CND04070"
                     /db_xref="GeneID:3257333"
     mRNA            join(1135654..1136015,1136070..1136100,1136153..1136286,
                     1136339..1136885,1136943..1137262,1137317..1137558)
                     /locus_tag="CND04070"
                     /product="NADH-ubiquinone oxidoreductase 51 kDa subunit,
                     putative"
                     /transcript_id="XM_570152.2"
                     /db_xref="GeneID:3257333"
     CDS             join(1135709..1136015,1136070..1136100,1136153..1136286,
                     1136339..1136885,1136943..1137262,1137317..1137465)
                     /locus_tag="CND04070"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 51 kDa subunit,
                     putative"
                     /protein_id="XP_570152.2"
                     /db_xref="GeneID:3257333"
                     /translation="MLSRTPLLRSSPRSIAAARRSLATVSDAPVRHYGGLKDQDRIFT
                     NLFCKHDHGIKGALARGDWHKTKDIILKGDAWLIQTVKDSGLRGRGGAGFPSGLKWSF
                     MNKPGWEKDPRPRYLVVNADEGEPGTCKDREIMRGDPHKLVEGCLVAGRAMNANAAYI
                     YIRGEFYQEASHVQQAIDEAYKAGLIGKNACGSGYDFDVYLHRGAGAYICGEETALIE
                     SIEGKQGKPRLKPPFPADVGLFGCPTTVANVETVAVAPTIARRGGSWFASFGRERNSG
                     TKVFCVSGHVNNPCVVEEEMSIPLQELLEKHCGGVRGGWQNLKGIVPGGSSVPVVNRE
                     TSEKCLMDYDSLKDNGTSLGTGAVIVMDNSTDMIAAIARFSKFYKHESCGQCTPCREG
                     TSWMMNMMDRMVEGRAQEREIDMLLELTKQVEGHTICALGDAAAWPIQGLMKNFRPEV
                     EQRLAQFHAKNGQVLFGGKLLSDADRRYALPDNLGGDAIRQIASP"
     STS             1136091..1136892
                     /locus_tag="CND04070"
                     /standard_name="Eco22"
                     /db_xref="UniSTS:470950"
     gene            1137744..1139583
                     /locus_tag="CND04080"
                     /db_xref="GeneID:3256981"
     mRNA            join(1137744..1137979,1138038..1138229,1138295..1138372,
                     1138439..1138608,1138668..1138978,1139052..1139583)
                     /locus_tag="CND04080"
                     /product="mitochondrial carrier protein rim2, putative"
                     /transcript_id="XM_570145.1"
                     /db_xref="GeneID:3256981"
     CDS             join(1137837..1137979,1138038..1138229,1138295..1138372,
                     1138439..1138608,1138668..1138978,1139052..1139390)
                     /locus_tag="CND04080"
                     /codon_start=1
                     /product="mitochondrial carrier protein rim2, putative"
                     /protein_id="XP_570145.1"
                     /db_xref="GeneID:3256981"
                     /translation="MSTQSFSQSFLSSTNPSSSPSPPAAPPLNLSAKTEKKLQGWQHS
                     AAGSMGGMTGAIVTSPFDVVKTRLQSDMFRHSSDEGVRHAAEVAKKGGSSGGVRGVMW
                     QFVDTVYLIKRIAVEEGWRALYKGLGPSLVGIIPARAINFYFYPTSKVYLAKQFPNAP
                     TEKPGQTAEDSPVIHLGAAVVAGIMTSTGTNPIWVVKTRLQLSARKKETGVVSAKSGS
                     ILPKPIAASAASLASQASTPITAAAASAASTRTVARSSLTPAFSMTMDIIKKEGIRGL
                     YRGLSASYLGVSEGVIQWVLYERFKRLNAATTTGLESQPLLSYIPHIVGASGGAKAVA
                     SLITYPHEVIRTRLRQPALPDGTVKYKGLLQTLKLVWMEEGVGALYGGLTAHLFRVVP
                     NAACMFLIYELVAAKLGA"
     gene            complement(1139528..1140414)
                     /locus_tag="CND04090"
                     /db_xref="GeneID:3256957"
     mRNA            complement(join(1139528..1139894,1139979..1140077,
                     1140189..1140414))
                     /locus_tag="CND04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_570143.2"
                     /db_xref="GeneID:3256957"
     CDS             complement(join(1139849..1139894,1139979..1140077,
                     1140189..1140310))
                     /locus_tag="CND04090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570143.1"
                     /db_xref="GeneID:3256957"
                     /translation="MSGKKPEFPEPPCKLFAITQYQCSPESGRVTCWPIERIFRQCGE
                     NKPVIEVTNRILRDRSGSNKNEIVVDPLFIKNPPKAKSWGDLRG"
     gene            1140525..1141173
                     /locus_tag="CND04100"
                     /db_xref="GeneID:3256978"
     mRNA            join(1140525..1140868,1140936..1141173)
                     /locus_tag="CND04100"
                     /product="expressed protein"
                     /transcript_id="XM_570583.2"
                     /db_xref="GeneID:3256978"
     CDS             join(1140596..1140868,1140936..1141103)
                     /locus_tag="CND04100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570583.1"
                     /db_xref="GeneID:3256978"
                     /translation="MASLTSDPILLNPLSEIIAALSSSSFGILPAPDSEPLLEQTFPR
                     TAEELKSVQEESNRSRKISERIVGMCRVGLLDGEGHVVIRLDRAGWTIETADGERHVT
                     NKIGTTYESMESLLISASKKYVEAMNREIWKRFEDHPQAVEERE"
     gene            complement(1141176..1141860)
                     /locus_tag="CND04110"
                     /db_xref="GeneID:3257138"
     mRNA            complement(join(1141176..1141365,1141410..1141514,
                     1141567..1141590,1141637..1141860))
                     /locus_tag="CND04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657050.1"
                     /db_xref="GeneID:3257138"
     CDS             complement(join(1141253..1141365,1141410..1141514,
                     1141567..1141590,1141637..1141826))
                     /locus_tag="CND04110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512635.1"
                     /db_xref="GeneID:3257138"
                     /translation="MFRPSLARTAAPLARAHARSFVSRATFVGRLGTAPEKSTTSAGQ
                     PYYKYPLAVSKPPKRDAEGKVILDEGGYPVRADPSWFTIFNFNERAEARIESLVPGSL
                     LYVEANIDTITSPSAAEGSPGTKQYVFREVSHKVLSKPRQE"
     gene            1141874..1145618
                     /locus_tag="CND04120"
                     /db_xref="GeneID:3257040"
     mRNA            join(1141874..1142105,1142158..1142313,1142367..1142826,
                     1142892..1143022,1143092..1143478,1143541..1143925,
                     1143969..1144281,1144353..1144433,1144511..1144565,
                     1144642..1144666,1144731..1144800,1144872..1144975,
                     1145034..1145302,1145370..1145618)
                     /locus_tag="CND04120"
                     /product="Pol II transcription elongation factor,
                     putative"
                     /transcript_id="XM_570584.2"
                     /db_xref="GeneID:3257040"
     CDS             join(1141992..1142105,1142158..1142313,1142367..1142826,
                     1142892..1143022,1143092..1143478,1143541..1143925,
                     1143969..1144281,1144353..1144433,1144511..1144565,
                     1144642..1144666,1144731..1144800,1144872..1144975,
                     1145034..1145302,1145370..1145528)
                     /locus_tag="CND04120"
                     /codon_start=1
                     /product="Pol II transcription elongation factor,
                     putative"
                     /protein_id="XP_570584.1"
                     /db_xref="GeneID:3257040"
                     /translation="MPARRLRPVIELAPLPPAVRALYARPPSAAPAHTQHRTFCEKCR
                     RPPAALILESLHSRPKKRPRTKRPSPEDDDLLSDSELVHILQGWVTCRRCVVASHYGC
                     LSASQKKAVLESLRSQDLAALGNIDPTTQASDVPLRKTVPIQQEADFLCAKCGEGVPC
                     FVCCKDELLNVDPVTVGRRKDDDAGVVDVGKEDSMTDMDSSKAPQLPPLAEAVSDKEI
                     GSPQPKSTRPLFRCLRCRQAAHYEHLKVPEPLGENPDLAEIAHHYQTQTDDGDAWTCH
                     QCRASPWGIDIVIAWRPLPATSPFHSLPPPPPKTPLYKTVLPREYLIKYSSRSFRHVE
                     WVPHAWLSGIAPMKLRRFLEKGPLLDLVTDETLEARGDEVVRPSIADIDNRAHGKDVH
                     HEKGVGLIVDAEEDAESGLPILWSTIDRVLDVLLIRPTAAQIKGKSKKSQSGNDRRNQ
                     RRIVSLSPSPYDGAAPFPPDSSPNAQAVAVKTPFEQLQADLNIPDGLPLPDDELIEIE
                     EWEILTGRRLLETDVEEVAGLVGWGLFKWQDLQYDQAHPRTEKACWDTPPPSSSPLYT
                     AYKHGLSKYLAARHITIPVLTPAQIRARDNDPARGFVPPQEQPDCIAGGNLMPFQMEG
                     FQWLLYKYFKRESCILADDMGLGKTVQIASVLGYLGSAEHEIYPCLVVVPNSTITNWV
                     REFEKWSPHLRVVPFYGEAASREIISKYELFHKGTQGKPVGLKAHIVLTTYDMITSSE
                     FRVFSAIPRWEVLCVDEGQRLKSDNSKIFNNLKTLNSVHRILLTGTPLNNNIRELFNL
                     LNFLDQDNFKDLESMEQEYSDLNEVKVQKLHQMIKPYILRRIKADVLNLPPKVEIIVP
                     ISLAPLQKQMYKGIFENHAGIIEDILKARQKRRQAIKSVQSAVPTN"
     gene            complement(1145626..1152495)
                     /locus_tag="CND04130"
                     /db_xref="GeneID:3257104"
     mRNA            complement(join(1145626..1146004,1146054..1147548,
                     1147613..1147978,1148028..1148373,1148426..1148705,
                     1148757..1150227,1150278..1152028,1152085..1152220,
                     1152268..1152495))
                     /locus_tag="CND04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657051.1"
                     /db_xref="GeneID:3257104"
     CDS             complement(join(1145733..1146004,1146054..1147548,
                     1147613..1147978,1148028..1148373,1148426..1148705,
                     1148757..1150227,1150278..1152028,1152085..1152220,
                     1152268..1152270))
                     /locus_tag="CND04130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512633.1"
                     /db_xref="GeneID:3257104"
                     /translation="MNKIVSFSDEACAGEASLVSTPASSSVPTDSSSTRQAMPLGAAR
                     TLSLNRRAVIFSPRNDTKYFHSDDSILPSASAGQPLDLKLHPTSDPVTPHNSSRRSRT
                     VRGTPSLVKSILKSRAQQIRIAASVEEGTLSNREPARLLISGKRPALAARDSFELVAM
                     VGGEDPRVVKDTVRMSSGAPSSDESAPSSTAGGSDGIEIAEGSEDEEEEAEIEQDGTL
                     ATGSLIDIILNGAEDLLTLEEAYNILTLRLRHRMPTDSEGTITPEIEEDIRSAAGPIH
                     DEAPAMVRAIQRDICRLLGKPPTSEPAMERLESSPFREITPLVIDRKDRFTPSPSPPP
                     AGDGVSPSKAERQGYTAAEIRYRREASGVGAAVLRFLAFIFHNPQLYCCFSEADLQLL
                     LDQVLGITRVPRLPTPNPKRTYFLCVILLTQLKLPLSCVSPLKDKIVRAAVKAVMEDF
                     RLRNSGTASDKPGPNGFKKEGLSAVANLLNTYPTLFFPYYAELLPPCLSAYNNSSVQI
                     RFRAGAAVAAFAKAKMIFMAHVQSGPQETWQAVKTVIQKSEFFVVSHLKGAYILPTTS
                     SPVYRKDGGKQTAWAVLESRFKATVGENKEVHVACASWAAIVTLIGSAYMLSGLSFKR
                     IDYIMEGSLKATTNAIRPILARAAWNHAIHAYLSYGSTTCYLEDGRIIKSYKPFMASR
                     EQEKSFENAVEMPIWLALKEALAESNFTTGRNGPVGRRPAHYVWKRNEKSKKLQWLTT
                     TAMTTTAVMYAYIGVAFHSQDLPGGDMTALSGLPSSDISDEPITLTLDQKRRSRLDQT
                     WDKIVYPILHSFFSIRGIDALLTYSWDILDALTTSSEKQTLWDFDKLVTTGYHSIDVF
                     DVEKESELPSLLDHFQAVSLTPADIPSFGKSWVAFRLGKWGHLFMEALSSVHGLNHPD
                     STQWVKDNSGAPLIPVSLSKVWCNLLHALASFSNSVGEEHSVYLLGIMTVTEVLIQVW
                     RRHPKEIIPISQIGDDGKCFFDEERVRIGLTSHLFNLSTEILGEDALGNIKFPKEKNA
                     SLASYAACAFGIEEASSTCAGFLLGQVVRTNFVVPNDQEIRSLFMKFVKEVLHVGLQG
                     DSWKRFLGSITIAVPFLFELNEELNMDIWRMIASEWSERIVYDKQPSPNNYTGNILIS
                     LLSDPFRGRQLNSYWHQQATLDDLSQWRKLLETTAQRFKAKRAVIHSGLLETLAAHLT
                     DFLEPKDKTLCSPTTLYCLGAATSLISFQPEIHRNQYSPWQADANHVPVDFLTLLNSS
                     LTHAYSAAQFPNAKIHHGLKILLESINVVLGKVPVGYREDVLCPLMEGLRVWMKDDSG
                     VVSQDMAQLLDDLNATILSLQTNSASSSCDLTISPQRIQLILDLYSSRAIRSALVGQN
                     LMTLISCILERSYNYPTPEVIGAVEKLFGFLMLFFNEMSPENAKQLFNTVPLGLVTWL
                     KDTNKLVEQSPLEEKLNDLYRLILTLFAEIIPSHIPADSTTVNALSPIYSSRASYMPL
                     AFLEFWSITFQGIHNLAFDDDTKAFLRDMMEVQEGKFEVPGLSLETQMAHESFSSPQP
                     RHLSQSQLNQTPLQVSGMDMESGQSYDADESQIDSYAKTEVVSVDDGKAQTNSGLVRE
                     QGIRQPADGPITGSVVTREDVFGPAPATVKRVKRRVKAKNIEGKGKTKKTAAKGVRQK
                     SGSAKTFKPSVPVQTELESQTGCEVESPLGEASEDECIVVQPEYEYYIRKGLTPPPDH
                     PASVSSPTQGSQTEVETKDVAENAEPKTGSPSSEQHQTSISQRASLLSSAGRWLAKVP
                     SLSFFSPSNTSKSHVPMEMPADNSLSEPASVGKKQAGRKPRKRKASGQHQNPPKRARS
                     NVSVSSLHSEGSQRQIPVVEINSRSRSSSSPQAMKDDVRKVAVEVPSGDKGKNNVPVP
                     TEGPEDEDELLLSPESAKKQRQEEEAHLRLAMGSLGSQSWNESISGRFDDAPTDRSPD
                     QVTPLRPRRASILKVPSGPSPTRRTAQQVHILSMMEEVVRTKEAIDTLDFEGTKMLLK
                     QLKEIHEVAEERMLARMDEMRGK"
     gene            complement(1152616..1154922)
                     /locus_tag="CND04140"
                     /db_xref="GeneID:3257216"
     mRNA            complement(join(1152616..1153249,1153312..1153955,
                     1154003..1154269,1154323..1154922))
                     /locus_tag="CND04140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570137.2"
                     /db_xref="GeneID:3257216"
     CDS             complement(join(1153434..1153955,1154003..1154269,
                     1154323..1154778))
                     /locus_tag="CND04140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570137.1"
                     /db_xref="GeneID:3257216"
                     /translation="MNDGNHYRPAISPNPSADTQPSDWAYIAEGGAHIVFSYQGRSKT
                     YATRALRVRKPSATTEPLAQAEENDLFGQWRRNILPKLLPRQLLTTSREVILEDRWYK
                     ELLAMVDVVRPDQRKSGIDFAAKGDRRGVLLEDLTSSEDDGAIAVAIEIKPKWGFLPC
                     TEHLHPPESVSIKSHVSRFRLHQHFRGCSDDPPYDPLDLFSGDKMRMRTALDGLWTMW
                     EISRGKVNNWKVFVGGKEISPDDLQNGLLPIGGDDFVTKITQLTLDTLQTSFALPLLK
                     NLQQNLDPIDISSLAALFQAEYPNSPPFDPDLIPDVSAVELNGFVDIYISDPQAGQRM
                     DSWSLRERIIAYALSAIFKDCSLFIRGFLKHAEDGVWRLVSGSDSVKVIDLDLKPIKN
                     IQKWAETDEKVWKYWLETKGAR"
     gene            complement(1155532..1156627)
                     /locus_tag="CND04150"
                     /db_xref="GeneID:3256895"
     mRNA            complement(join(1155532..1155760,1155805..1155814,
                     1155892..1155911,1155964..1156102,1156166..1156422,
                     1156499..1156627))
                     /locus_tag="CND04150"
                     /product="acyl carrier, putative"
                     /transcript_id="XM_024657052.1"
                     /db_xref="GeneID:3256895"
     CDS             complement(join(1155726..1155760,1155805..1155814,
                     1155892..1155911,1155964..1156102,1156166..1156387))
                     /locus_tag="CND04150"
                     /codon_start=1
                     /product="acyl carrier, putative"
                     /protein_id="XP_024512771.1"
                     /db_xref="GeneID:3256895"
                     /translation="MYRSIPLFRSTFPHYIRHSMAISYRPKPVKLLHKTFSMRRFADG
                     PPEPLALTKDEITDMLLRVLNQFKQIDSSKLIGNASFTTDLGFDSLDHSELIMSVEET
                     FDIDVADNDICELDSMDKTVDYVAKTLEAQRLVEKIKQS"
     gene            1156886..1159834
                     /locus_tag="CND04160"
                     /db_xref="GeneID:3257166"
     mRNA            join(1156886..1157669,1157718..1157980,1158032..1159141,
                     1159199..1159834)
                     /locus_tag="CND04160"
                     /product="RNA polymerase I transcription factor, putative"
                     /transcript_id="XM_570585.1"
                     /db_xref="GeneID:3257166"
     CDS             join(1157030..1157669,1157718..1157980,1158032..1159141,
                     1159199..1159801)
                     /locus_tag="CND04160"
                     /codon_start=1
                     /product="RNA polymerase I transcription factor, putative"
                     /protein_id="XP_570585.1"
                     /db_xref="GeneID:3257166"
                     /translation="MPLSSITSASLLMTKVVKLPQPSNPVPKSRQKSKKFAGVMVTND
                     SPVSGSSRASSMAGRKRPRESDGDGKIRSRRTKSTGDAKDSRGSSSSAKDREAFQRSL
                     IAVFVPKALQESKEGNMTHYNDLLAHFLPTPTMPIVNLPPLLPLLRAVSAHVSLLSPD
                     IHGSLVSAIISLPWATGDEKFVRAFIGWAAVLVTAQPGWMKEIVGMGVKGLTWQPCFG
                     APSTVSRRVFHARHHLLLSHLISLVPTLPNVLQPLMIRHFPNKREPEVSQTTWIRNCC
                     ELVGYCPELGGRMWGEIVDRMLRIDVEITNSLDQDDDESSDDEYEPQMATPQSIMTTL
                     DPLDLLISQEIPRSRSVSHSPEIGVDDEDSEGDPDPDDLSSVDGAESDAEDIAVNELK
                     EAEERAKKNANTKAMREKLDGMLFHFFQHLEEYLAGRKEHPSALEMASERMETDVRSG
                     ASTPTVETPSIASTSLSRKQPPSPAQSLSYFQTLLNLFSRQILPTASTQHIPFLLFLT
                     SSFSPAHTELFLGLLVSQALYATTSTVPSINSQPVSMNQRIAATVYIGSVVCRARFVT
                     DDQARTVLTYLLAYMDGKLHQSRVNKRHSTDELPLFYAVCQAAMLIFCFRWRAFLAGA
                     DKEGDGVLGDMEMDGESVDDEGKAEGKWMADLDVLQNAITSDLNPLLGCNPTVVSTFA
                     KVAHHTNFAYCFSIIEANQQSSHPRSSSSHALSKTAVPASRSSSGAGSNRQDPTFGSQ
                     TLPRQARQLNVDAGLDSYFPFDPYDLPKSKRFIETLYRTWDEVAIDGGLDSDSDGSSE
                     SESDSQAGDKSDGESSFEDHLAPKGLPLPKLKVGSYGDRRRSLWDSKQDAGLSSSLEG
                     MSISPGRIGMGVFTS"
     gene            complement(1159853..1161672)
                     /locus_tag="CND04170"
                     /db_xref="GeneID:3256937"
     mRNA            complement(join(1159853..1160165,1160236..1160479,
                     1160538..1160617,1160672..1160741,1160796..1160948,
                     1161023..1161120,1161181..1161292,1161349..1161444,
                     1161557..1161672))
                     /locus_tag="CND04170"
                     /product="expressed protein"
                     /transcript_id="XM_024657053.1"
                     /db_xref="GeneID:3256937"
     CDS             complement(join(1160015..1160165,1160236..1160479,
                     1160538..1160617,1160672..1160741,1160796..1160948,
                     1161023..1161120,1161181..1161292,1161349..1161444,
                     1161557..1161632))
                     /locus_tag="CND04170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512770.1"
                     /db_xref="GeneID:3256937"
                     /translation="MPSNSPTVWKFELEKTLQACTHDYRDLALEQAQALAEPPSALTA
                     LRMIHHSHPYLINGFSPLEKETANLYDWSRAEVYKEISGSRRVTVAVTDDGLADSVRE
                     RHDGRKTFVKALETKMTMSQLTEKLGRSADQDSFIYYLQSQDGNIYRDQPSSSGPPEL
                     EAFQKYFKRDVSWMKEAIGKQAEAVNLWIGDSRSTTSLHHDPYENIYHVLAGSKTFTL
                     LSPLETIHLDQRFYPPSTLKRSPSGQLYPEYDYPNPSCGPRIPWVENLCLPRSARSIS
                     VTLHEGDTLFLPAGWWHRVEQEGGEEGIAVAVNYWYPSEIHPERYAYERFFRRIAIMS
                     GMEGLIPPMGDEESINSEENDDPDR"
     gene            1161836..1168320
                     /locus_tag="CND04180"
                     /db_xref="GeneID:3257068"
     mRNA            join(1161836..1162091,1162144..1162561,1162616..1163381,
                     1163429..1164609,1164668..1164859,1164919..1164980,
                     1165045..1165166,1165220..1165275,1165334..1165376,
                     1165433..1165735,1165788..1165944,1166003..1166039,
                     1166091..1166220,1166268..1166368,1166428..1166926,
                     1166991..1167002,1167053..1167082,1167369..1167512,
                     1167571..1167727,1167778..1167840,1167890..1168320)
                     /locus_tag="CND04180"
                     /product="hydrolase, putative"
                     /transcript_id="XM_024657054.1"
                     /db_xref="GeneID:3257068"
     CDS             join(1161955..1162091,1162144..1162561,1162616..1163381,
                     1163429..1164609,1164668..1164859,1164919..1164980,
                     1165045..1165166,1165220..1165275,1165334..1165376,
                     1165433..1165735,1165788..1165944,1166003..1166039,
                     1166091..1166220,1166268..1166368,1166428..1166926,
                     1166991..1167002,1167053..1167082,1167369..1167512,
                     1167571..1167727,1167778..1167840,1167890..1168145)
                     /locus_tag="CND04180"
                     /codon_start=1
                     /product="hydrolase, putative"
                     /protein_id="XP_024512631.1"
                     /db_xref="GeneID:3257068"
                     /translation="MSSIPTPPDANGNPLIALAVAVIYAILYVLQGVKYGVSLLTIGI
                     PSCIVRMLQYSLTISLGFPHLLALFAGALLALFFLIRYRYLTRYAQLKESALPPPSPP
                     ALASRLLPLDGDGLGLPDSRSQTSSFHNYLDDFLSAIRIFGYLEKPVFHELSRHLQTR
                     RLAAGDTLEIGGGEFWCVVEGKVQVFAPDASSQGTPTPSSDTNSPTRPSFNGYHLLNE
                     VSTGGTLSSLFSILSLFTEDIKLSWKSSADDEGEEEQIFEGAPEQSSAKLRVRRANSD
                     VSQLGPDSIGVRAMDPTPLPESIDSHGDSSVPQRRRERSSSIDAAGETVREREGIFAS
                     ASLPISSTEPPSPRRSQSLRSSPRLNSATNLLSSQSEHLRSSVPRKAGIEIGSKALKG
                     TIARATEDTTLAVIPAAAFRKLTRKFPKASGTIVQVVLERFSRVTFMTAHKYLGLTRE
                     ILQTESSLNLLVTHPLPRSFYTGGGMQALRARFQPEALAKESVHYDSLKSSPNARVSS
                     KDYFNYVPASPTVKAPSLPAMTPKPLSPIIHKSSLGQTATTTVKNEPLNGGSSPLDET
                     RDKVPSFGLSTAAATNPDASFRHASPFIRRTSAMRQQVAAGDLAMSVHNLPDESGQAY
                     YRPTAITPGLSKMDTWQRRYSSSWNLNDSPHTDGQPVDPQRDDESLLNESFDLKEAVL
                     NSIAKSIGLYQEAESNSDMIARSSMAPSVSALSTPNSPMFPPNAGTPLQGSTRSRPPH
                     FGNVLDLINASSQNEGVIGGMLREAAFNSRPDDEASSISMSLHDSQGGASGVDRKIMK
                     DLERHVEILFFKKGSVLVKEGERSPGMYYVIDGFLETSLPFRSTSSNQENPNSTPGSK
                     HRQSSFGSSNERPFKTALGLDTSKGKELDDGSKKDEALFTVKPGGIAGYLSSLCCTDS
                     YVDITAKTDCFVGFLPHHTLERIIERRPIVLLTLAKRLLSLLSPLVLHIDAALDWQQL
                     NAGQVLYEKGDKSTDFYIVINGRLRAFTEKNDNMHVLREYGQNDSIGELDVITAVDRS
                     ETVHAIRDSELVRIPAALFDAISIKHPETTVQFMRLIAGRVRRALGDEMNGRVPGLPT
                     TDMNLKTVCVLGSTRNVPVTQFAGKLKNALEEIGASTSYLDQGIVMRHLGRHAFARIG
                     KLKVAGWLADQEQHYRTVLYVADSPPASQWTLTCIRQADLVLVVSMGDDPSLGEYEKL
                     LLATKTTARKELILLHDERTVAPGSTRQWLSNRPWIQTHYHVELPGVVTPARPIPPVH
                     DAAAIAAFKHLREQVETRIKKYRGLRPFTRPRRPPHMNDFARIARRLCGQQIGLVLGG
                     GGARGISHIGMLQALEEFGIPIDAIGGCSIGSFVGGLYARETDLLETAGRTKQFSGRM
                     GSMWRILSDVTYPFVSYTTGHEFNRGIYKAFYNTHIEDFWIPFFANSTNITHSRMEVH
                     RTGYAWRYVRASMTLAGLLPPLSDNGNLLVDGGYMDNTPIQPLRENGIRDIIVVDVGS
                     VDDTSPRDYGDSVSGWWIFFNRFNPFYERRVLSMTEISSRLTYVSSVKTLEGVKATPG
                     CHYIAMPVQQFDTLGGFKRFSEVMEIGLKAGRETLKKWKEEGKLPTGLVDEAKGSKAV
                     QRGNRLRRMSI"
     gene            1168599..1171160
                     /locus_tag="CND04190"
                     /db_xref="GeneID:3257209"
     mRNA            join(1168599..1168743,1168882..1168959,1169030..1169229,
                     1169300..1169559,1169617..1170115,1170170..1170239,
                     1170308..1170372,1170436..1170624,1170691..1170747,
                     1170813..1171160)
                     /locus_tag="CND04190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570586.2"
                     /db_xref="GeneID:3257209"
     CDS             join(1168663..1168743,1168882..1168959,1169030..1169229,
                     1169300..1169559,1169617..1170115,1170170..1170239,
                     1170308..1170372,1170436..1170624,1170691..1170747,
                     1170813..1170930)
                     /locus_tag="CND04190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570586.1"
                     /db_xref="GeneID:3257209"
                     /translation="MPSPNSSPKGTSSTKKKHAPTSAISTLGSTIALPLNTLTSLLTL
                     QNAEDSKPRLSKLSWLPDIVVYKSSILPIVLGPVLTVTLFSAGVAAASLWWDKEVGLT
                     NNVVPLLSVVVGLLLVFRNSSAYERYAEGRKDFTCLISTARNLSRNIWVAVSLPSPSN
                     GAAEIQISRNNLTEEKKKVIRLVVAFVIATKHHLRGEDGVQHNDLKGLLPTTMMNSKN
                     WRSSFTPPSFVSTQHLSSSPNAYDDHEIDEETSLGLVSSSPIVAPGQSGSSNRWRTAN
                     NSSSHGRVSAALKEGPCVGTGLKRRPTAIRIIVADHDANGKRSGLFSGNREENGKVDE
                     RTPMIKTRVKSGPLISLGEPGGAEIGLGKMVQLGLPLIIAHEISRSIFKFRRMGCLET
                     GGPAGLNSLQAAVSSMIDQLGSMERIVQTPLPYVFCVHLKQVVSLYLFILPFTLVDAM
                     GWKMVFIMFCISMTFMGVEGIAAMIEQPFGTDPSDLNLDLYCTELLCECEGLIECLSE
                     GDEGDMPIYSRPIIVDQATVDLSADDREDD"
     gene            complement(1171202..1171876)
                     /locus_tag="CND04200"
                     /db_xref="GeneID:3257053"
     mRNA            complement(join(1171202..1171285,1171342..1171512,
                     1171577..1171633,1171819..1171876))
                     /locus_tag="CND04200"
                     /product="ribosomal protein s21, putative"
                     /transcript_id="XM_570133.1"
                     /db_xref="GeneID:3257053"
     CDS             complement(join(1171254..1171285,1171342..1171512,
                     1171577..1171633,1171819..1171822))
                     /locus_tag="CND04200"
                     /codon_start=1
                     /product="ribosomal protein s21, putative"
                     /protein_id="XP_570133.1"
                     /db_xref="GeneID:3257053"
                     /translation="MENDKGVLVDLYIPRHCSATNRLITAQDHASIQLQIADVDADGK
                     AIRGSATTIAICGRIRAQGDSDDSINRIATKEGLLKNVWSYTR"
     gene            complement(1172639..1173960)
                     /locus_tag="CND04210"
                     /db_xref="GeneID:3256880"
     mRNA            complement(join(1172639..1172829,1172893..1173659,
                     1173708..1173779,1173848..1173960))
                     /locus_tag="CND04210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657055.1"
                     /db_xref="GeneID:3256880"
     CDS             complement(join(1172710..1172829,1172893..1173659,
                     1173708..1173779,1173848..1173929))
                     /locus_tag="CND04210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512801.1"
                     /db_xref="GeneID:3256880"
                     /translation="MALPSSLHVHPHFNAEEAAHVVTGFVSSLENLPGEVTFLLEEIR
                     EKDVRISQYVQRINSRHMSLTKTAKTLASLPPSNATFPLPIPPGALLPSSHLSQKEAQ
                     SLAKIQNEWAQVLTLQDEKVKLAERLERIVLRAKERAKHQWVKVGGMEIEEVEKWSGT
                     GELGNGEVVLPPGGLGSGIDGRPAKKRKPNIPSLSVNHTKQAIHPSISMPPPPPPSRP
                     SLSARSSHSNVPSTSHTHTSSLGQHGSRSRRVSVASDEDADGEPDEGDTDMVDAADAE
                     GETDETLYCICRQKSYGEMIGCDCDKCPYEWFHVKCVNISGPLPDTWYCPDCVARYGF
                     SNDKGNKKARKK"
     gene            1174081..1174975
                     /locus_tag="CND04220"
                     /db_xref="GeneID:3256854"
     mRNA            join(1174081..1174157,1174237..1174555,1174604..1174975)
                     /locus_tag="CND04220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570587.2"
                     /db_xref="GeneID:3256854"
     CDS             join(1174118..1174157,1174237..1174555,1174604..1174625)
                     /locus_tag="CND04220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570587.1"
                     /db_xref="GeneID:3256854"
                     /translation="MTAPVIFRSGALLTAIGISSGAFGSHGLRNLSPPVTERQISSFS
                     TASSYLIYNGLALLAISFHPGFAVGSATRRYKFAAGMIVGGAVAFSGSIFALVLGRDR
                     FKQLGPVTPLGGVAMIAGYIALAL"
     gene            complement(1174593..1177358)
                     /locus_tag="CND04230"
                     /db_xref="GeneID:36392837"
     mRNA            complement(join(1174593..1177155,1177204..1177358))
                     /locus_tag="CND04230"
                     /product="expressed protein"
                     /transcript_id="XM_024657056.1"
                     /db_xref="GeneID:36392837"
     CDS             complement(join(1174680..1177155,1177204..1177223))
                     /locus_tag="CND04230"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512629.1"
                     /db_xref="GeneID:36392837"
                     /translation="MMAGLLRCPNFRGTVLRNVSPTIPRKSGSIYRLSTRQNQTCAPS
                     DHRLLSTKKPPEGSRFENEATHLIYARPLASSSTPPIPISQVIQILQQTSCDLITLVQ
                     LVSDLEKGDLAYVQEALRYLLPCLGRRRMAVLLPRVLDIWMEKVDVELEEGRVEQAQL
                     QTWYHQIVKMLSHFIITPGETTHQSHQDPLPGYIKKQVVRLISHLIDILPFFPSSSTQ
                     RPCINFSLLERLFTRRYLSTELRVVLAKHCVENGIELSARMWHECVMVSLSENDTKMV
                     RKLEKRKQAALDKEAEAQETFRGKRRSQTKSKRRRRLRKIADLISRLQITNTDSSHEK
                     LFHVLEPYLDPPSLESLPSLPANPSSPSDGKGLSHIPSSHLVQHAWSILLTRLSKDKT
                     VSADMLLELSDSMPMKYTTGRTLTPIMHGLLRRGEGPRAWSIWRELVSKESKLEKRSE
                     KGLFVDRVSLSVGAQICHGVAGLDNAIEMVDLWAHRPWQPPPVQGQMENSIFLDTQCV
                     NILLTLCQIDGATSTAFRLWKAALPRWGVYVDHISLKILIDIARYHNVHDKSVQPDAD
                     VFKERLRQMVDGFSFWREGRGEEGAAVAYDAYEDAGFAKGSTSVLLAPSGNFNAHEKE
                     DWRFEKPWQMARVIFRQVVLGNWPHLRETQSPLDEVDQSAFDKFTSLFDGDLHIPRHA
                     SGDKPRKLNQDSLPDPNARYTHIIPTASTFHSYISLLGYYNHPHEIPVALAWMKALSI
                     VPTWFTMRLALMHICEAEGPRRWVRKWGKEGKGRLVRDEEIMRRWLEEWLLQEDSGGN
                     GGLGDNRADIVPSEEEVAAFRRMFAERNQRVTA"
     gene            complement(1177754..1180479)
                     /locus_tag="CND04240"
                     /db_xref="GeneID:3256885"
     mRNA            complement(join(1177754..1178923,1178976..1179258,
                     1179311..1179658,1179708..1179858,1179909..1180479))
                     /locus_tag="CND04240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657057.1"
                     /db_xref="GeneID:3256885"
     CDS             complement(join(1177839..1178923,1178976..1179258,
                     1179311..1179658,1179708..1179858,1179909..1180327))
                     /locus_tag="CND04240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512769.1"
                     /db_xref="GeneID:3256885"
                     /translation="MSALAARRATAAAASPKPEQPESSIEEVSVSGALTLPSPKRRKT
                     RQTSPKPRSKARYSDDVPTSRQFFQATESLAEQRTGRFSPSAPDSDGGTSSSSVGDSD
                     EDMAQEDEFEDRREVDGERDQRKVSVAANMSSSGPFKSLDLMPVDITSQFNPKDNVNF
                     CRITEGQLASAEMNDGHPGPGVIVSLARNESLTIAGLFLLTPLQNTLSIYSTALSPSM
                     SSFPVYAPTSHPLPVISPASTQAPGKGTLSILNNIKLPLSFQKESDKTLLLIRENRCG
                     IDGLRNGAVPGFSNIWLEDNGPWGLRGVHPVVGSFPVPVYPYCTPPSWSHAISSLSSS
                     DVNLQTPFVGLVKGPKRSGKSTFARALLNNLLRRFRKVAWLECDLGQGEFGSGAVVGL
                     WILDKPALGPPFTHPLLPSRSHYLGTYTPLTCPDEYLVAIRHLIEHYKYELQYTSEYS
                     ALHTTVHDKISTHVPLVINTQGWMKGLGEELLNVIESMAQPTRVFSFESQSEEVYSGQ
                     GWTSTPPWQATQLPYDPAYPTTEPVETEVTQTYSLETAPVSALQARYTPADLRVLSAI
                     TYFHASLHPTQSVPVTWDISSPLVCTIPWEVELGIGKALEKVYLIGEGSEGVLEEDLP
                     IALNGAIVALAEMLGSYEDEPTVYEQGRSPPPTDLVNILGLAVIRSLSSGNSVNPGLK
                     LQLLTPLPPSYLSRARILIKSGALELPLPGMIDWRRGGINEEGMLGKGWEEIPFLDVG
                     GLDVIGGERRRFRKNIMRKGM"
     gene            1180647..1183493
                     /locus_tag="CND04250"
                     /db_xref="GeneID:3256886"
     mRNA            join(1180647..1180793,1180852..1180901,1180971..1181007,
                     1181062..1181125,1181179..1181220,1181267..1181337,
                     1181389..1181587,1181642..1181999,1182046..1182165,
                     1182213..1182514,1182567..1183493)
                     /locus_tag="CND04250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570588.2"
                     /db_xref="GeneID:3256886"
     CDS             join(1180723..1180793,1180852..1180901,1180971..1181007,
                     1181062..1181125,1181179..1181220,1181267..1181337,
                     1181389..1181587,1181642..1181999,1182046..1182165,
                     1182213..1182514,1182567..1183427)
                     /locus_tag="CND04250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570588.1"
                     /db_xref="GeneID:3256886"
                     /translation="MSVRNIREAEGLLMEVHDPSKGPVLPKDGQRNVLITSALPYVNN
                     VPHLGNIIGSTLSADVFARYNRTLNVPTLYICGTDEYGTATETKALEEGVTPYELCTK
                     FHKLHTEIYEWFQISFDKWGRTSSPEHTEITQGIYRRLHDNGLFRLETTDQTYCVDDK
                     LFLADRFVEGICPNCGYDDARGDQCDKCSLTFSSPTQLLNPRCKRNKAHTLSVRPSTH
                     ACYRLDLLQPRLVEWMQKARVKGKWGTNAVITEKGEIVEPRMLGEGLRPSAVTRDLKW
                     GVEVPKVGDEEEDKAMEGKVIYVWFDAPIGYPSITATYTEEWEKWWKNPDNVELYQFM
                     GKDNVYFHTVLFPAMLLGTEERWTMLHNISSTQYLNYEDTKFSKSRNVGVFGNNARET
                     GQPPEIWRYYLISQRPENSDSSFLWSKFIAANNNELLANLGNFVNRVVKFINAKLDSK
                     VPGPEDFAGGEVAPPADSLDVDFVTDVNTRLKEYREQMDDTKLRGGLATAMALSARGN
                     QYLQENSLDNALLASNPKRCAEVLLNAVNLIYVLSVVFHPFMPNTSEGILRQLNAPAR
                     SLPTKFSIDILPGHVLGKAEYLFKKIDNVNGEQEKKWQRQYGGDAVVADHVAPPGPGG
                     HPEGGKVPKVKDTDAESKKAAHEARRAQLAKEKKAAQAAADAKKTPEEKELEAKVEAQ
                     GKRLAAIKKGLEEGDAEKEMSVAKSLKTELADLRKRLKGTTI"
     gene            1183805..1188981
                     /locus_tag="CND04260"
                     /db_xref="GeneID:3257330"
     mRNA            join(1183805..1183950,1184020..1184193,1184245..1184266,
                     1184324..1184544,1184600..1184678,1184749..1187138,
                     1187212..1187441,1187507..1187792,1187844..1188981)
                     /locus_tag="CND04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657058.1"
                     /db_xref="GeneID:3257330"
     CDS             join(1183903..1183950,1184020..1184193,1184245..1184266,
                     1184324..1184544,1184600..1184678,1184749..1187138,
                     1187212..1187441,1187507..1187792,1187844..1187873)
                     /locus_tag="CND04260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512628.1"
                     /db_xref="GeneID:3257330"
                     /translation="MASTARAKSVRNILMELRKVCQHPYLSAPELEIFDLPLEEQHRQ
                     LLNASGKLQFLKLLLPKLIARGHRILLFSQFKMALDRIQDFLYGENVKHLRLDGDTQQ
                     AQRQKYMDQFNAPNSDYHIFLLTTRAGGVGINLASADTVILHDPDFNPHQDQQAIARA
                     YRYGQEKRVLVFKLMIKGSVEETIINKGKRKMVLDHLVVQQMGKETEENDFEDLFLKG
                     VEGMYSGQGGINIPDINYNSKNVDELIDRVEADAEAEAKAMAERERQDKNGVVKQMKS
                     KQGVPFQFSRIWEADKNELIHDEVQDTVKDEEEEEDVDWEQLMVAVQAERQLRLQKEM
                     EESRIRRKLKSKEGVYKIDDDFEVDEKKRRKNKGKGKGVELSSSDAEYMDGGLSDNGS
                     ATDIPDIDLETLKDDLSIDPIVAKSSGGVKRKRSKKILDNVFNQSTAPHVCPRSSLSH
                     VSTSETPPGSLTTYPAQPGLSLIEPRQNNTAQYSSLSKTGLSGSMLSANAPEEANDTF
                     SSSKKRNPVDFAQARQTHPPIHSVRPPIEIIAAQNIVQWLFLIIRELAWGHHIGHWAT
                     LGVREIPAEKRKRLYCIIAADVDGYLRRFRQTPYFLEREQREAVERLLDSGWPIIPDI
                     SALIAVPEKAAVLIDPPFPVSGSGHRESTYASMPPAPPKYVSETSEILRGATAPEISE
                     NDGNTGDAAKTSSNSVTSQGTVSMPPAPPKYVPEAQAILPDATPPETPENNENTGGAA
                     KSLLSYETSRDTVSLPDIRGPGAAVLPSSFKEKEDIQNRSDTTSAGGHSIPLAPQILE
                     QTLHSPVQMPTLVASTPSLSTEIAPVEISQSAHISNGSPSVSRQPGHVTPTHSTGSSL
                     PELNLQTNGVNDIHKSSEAASASEPAPLAHTSEPALIQSSLKIPSGLPIQLSSSQAVK
                     GTLPSSSRQSSEIIVADSSGEPGRCEYCLEDGHRLQDCQRMYSVEILEKAFLAIKQSN
                     LSEGQKRRDLETLDRLKSFMIKAGKLQKDYHFPESSFVAVMSNRSPSSNACHSSVPEP
                     GAQGQLTIDKDTRNEGKRDISASESAVHIISTQSLLSTPPQMASVAPQVCPFCETNCG
                     RPLRACIQATGDRKSLKRKIRKLKEKIDGLTKAPGEPQTDKQQMERIMLRKMQSSLFD
                     CYKKWPKERPSDL"
     gene            complement(1189374..1190791)
                     /locus_tag="CND04270"
                     /db_xref="GeneID:3257255"
     mRNA            complement(join(1189374..1189576,1189652..1189722,
                     1189794..1189988,1190037..1190068,1190118..1190172,
                     1190232..1190290,1190341..1190357,1190425..1190445,
                     1190512..1190542,1190590..1190668,1190714..1190726,
                     1190771..1190791))
                     /locus_tag="CND04270"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_570127.1"
                     /db_xref="GeneID:3257255"
     CDS             complement(join(1189544..1189576,1189652..1189722,
                     1189794..1189988,1190037..1190068,1190118..1190172,
                     1190232..1190290,1190341..1190357,1190425..1190445,
                     1190512..1190542,1190590..1190668,1190714..1190726,
                     1190771..1190776))
                     /locus_tag="CND04270"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_570127.1"
                     /db_xref="GeneID:3257255"
                     /translation="MTLYYSICFVLLMAELSLFCTIVCPMPFAIRKKMFHFLSENPVV
                     AKIQYGLKITFIFVAVLFVDALQRMVRIAQEGATAKMKQDMTDARTETNYAARRFYAQ
                     RNLYLTGATLFLSLLLARVFYIILDFIQVQESYTALQAKTAKASGAAGENEELRNRIA
                     ELEAKERDFETLKKQASQQNAEYGRLADEHNRAAGAVSDKKAD"
     gene            1190959..1194082
                     /locus_tag="CND04280"
                     /db_xref="GeneID:3257114"
     mRNA            join(1190959..1191334,1191405..1191594,1192398..1192617,
                     1192690..1194082)
                     /locus_tag="CND04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_570125.2"
                     /db_xref="GeneID:3257114"
     CDS             join(1191293..1191334,1191405..1191594,1192398..1192617,
                     1192690..1193977)
                     /locus_tag="CND04280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570125.2"
                     /db_xref="GeneID:3257114"
                     /translation="MIDDGKRGVWVEGREKTRKIVDIWQKGATFPQPCLDELKVKLNN
                     AVASAGPSNSADSAAVKKERKPLSLADGEPKGSGPYNRSTTPPYPPPAYILAKYARRS
                     SKSSRKVAESKPEQPGQAQPGELPPEVAKLLGIEKQESAKDEKSHTPLSGIPANVAAL
                     LPSTFDPSSHSSSPHTVPSAAAAVASQESTAPPPLAINHEQLAALAKFASNSQTTSGG
                     QHELHELPPFPPPHPVPSGVITPQPYIPPPKPKPISPPGARYHTSSSSRSDRGLGERG
                     SPRHIDKERGERDYQHRQDDHWRAGRQRDNRSRSRSPDRRTNGHQRMNIPRRRPAASL
                     PNPLPPPPPAARLGQGRGIGEGDGEEDMALDVSDGEERAKQAGAAQAAAYPPPIVAPP
                     YVSVPPDVVAPPFPPPSSALQHQPPPISMPMSSGQPMKRRNDLVTLHTFPLQTFDPSS
                     ADSWAKLGEAWQNSTGRKPEQMELMHWLATGQVMDFKMMLMGTGHENGDSSSQSHVSP
                     GDMNGLSSATANPAIGLLPPSQMRMDVGAGSIGQPPHLSIGGGDQWRNVQGQAQWGND
                     DSQRLWGAQGQGY"
     gene            complement(1194087..1195125)
                     /locus_tag="CND04290"
                     /db_xref="GeneID:3257447"
     mRNA            complement(join(1194087..1194269,1194344..1194603,
                     1194668..1194783,1194886..1194913,1194961..1195125))
                     /locus_tag="CND04290"
                     /product="small monomeric GTPase, putative"
                     /transcript_id="XM_570123.2"
                     /db_xref="GeneID:3257447"
     CDS             complement(join(1194245..1194269,1194344..1194603,
                     1194668..1194783,1194886..1194913,1194961..1195092))
                     /locus_tag="CND04290"
                     /codon_start=1
                     /product="small monomeric GTPase, putative"
                     /protein_id="XP_570123.1"
                     /db_xref="GeneID:3257447"
                     /translation="MGLSLSRIYSSLSSLAFWGKDKEVRILMVGLDSAGKTTILYRLQ
                     IGEVVSTIPTIGFNVETVSYKNINFQVWDLGGQSSIRPYWRCYYANTQAIIYVIDSSD
                     TSRLATSRSELLTMLSEDELKSVPVLVFANKQDVEGALSPGEISDKLGLAGQEKGREW
                     SVRGSCAIKGDGLEEGLDWLVNTIQK"
     gene            1195202..1197932
                     /locus_tag="CND04300"
                     /db_xref="GeneID:3256938"
     mRNA            join(1195202..1196050,1196117..1196241,1196318..1196383,
                     1196451..1197932)
                     /locus_tag="CND04300"
                     /product="nucleolar protein, putative"
                     /transcript_id="XM_570589.2"
                     /db_xref="GeneID:3256938"
     CDS             join(1195291..1196050,1196117..1196241,1196318..1196383,
                     1196451..1196750)
                     /locus_tag="CND04300"
                     /codon_start=1
                     /product="nucleolar protein, putative"
                     /protein_id="XP_570589.1"
                     /db_xref="GeneID:3256938"
                     /translation="MASSLQETLPAQPTSLPVSPENNKKEKKARKRAKKDQPPSEAVS
                     TEPKPNAESERPPRKPRARKSKGGENQLDPLPKNNASAPESKVEGEVEAKDKKKRRKR
                     ESRAGTEAETKECLKEVATGDGAAIVDHEKDVKKVQDQEKGEDNGADKVEEREKTSDE
                     ASKEGKKRKRQTEQAHVESQTATVEASPAAITAEENEEPKEKKPKREKRPKIKSVKGA
                     IDTPKQPEVDVQAAPEGSEGTTIFTDSSLSDQAKKNIFYAHLFALSQSPSPAPNTPSW
                     KFSKAKQNWLMRNIFSNIEVPETYFEMVLGYLKTTQGHSRNTLIEQAKKILEPPLVPP
                     VESVDPAVEEITDAAMPETASPKEESEVENSTQNRLDNVDPDIPIPEASESNSEQLEK
                     EKEKEKQIKETRARQLLEAMGVAQ"
     gene            complement(1196948..1199961)
                     /locus_tag="CND04310"
                     /db_xref="GeneID:3257003"
     mRNA            complement(join(1196948..1197727,1197778..1198008,
                     1198057..1198138,1198186..1198736,1198786..1198856,
                     1199543..1199670,1199908..1199961))
                     /locus_tag="CND04310"
                     /product="protein kinase, putative"
                     /transcript_id="XM_570121.1"
                     /db_xref="GeneID:3257003"
     CDS             complement(join(1197666..1197727,1197778..1198008,
                     1198057..1198138,1198186..1198736,1198786..1198855))
                     /locus_tag="CND04310"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_570121.1"
                     /db_xref="GeneID:3257003"
                     /translation="MTSMDLRVGGKYRIGKKIGSGSFGDIYLGVNIVSGEEVAIKLES
                     VKAKHPQLEYESKVYKTLAGGVGIPFVRWYGTECDYNAMVLDLLGPSLEDLFNFCNRK
                     LSLKTVLLLADQLISRVEYIHSRNFIHRDIKPDNFLMGVGKRGNQVNVIDFGLAKKYR
                     DPKTHLHIPYRENKNLTGTARYTSINTHLGVEQSRRDDLESLGYVLMYFLRGQLPWQG
                     LKAATKKQKYDRIMEKKMTTPTEVLCRGFPHEFAIYLNYCRSLRFDDKPDYSYLRKLF
                     RDLFIREGFQYDYVFDWSLQPGVKSSGATGEDGLQAQDNQRQLRSQTKARDTGGW"
     gene            1200150..1200915
                     /locus_tag="CND04320"
                     /db_xref="GeneID:3257175"
     mRNA            join(1200150..1200197,1200242..1200304,1200357..1200470,
                     1200523..1200624,1200678..1200915)
                     /locus_tag="CND04320"
                     /product="chaperone, putative"
                     /transcript_id="XM_570119.1"
                     /db_xref="GeneID:3257175"
     CDS             join(1200195..1200197,1200242..1200304,1200357..1200470,
                     1200523..1200624,1200678..1200869)
                     /locus_tag="CND04320"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_570119.1"
                     /db_xref="GeneID:3257175"
                     /translation="MSFRVVPPTAQTSTDPHVVSTQATVHPISGTHDTFRHGLKSAAQ
                     SVAAGTTSPLQARLEKWSQTQTQLQQNIQRSTFGLAVPLKQAMEVKLVSESLHNPLLE
                     QSTLSGLPIGGSHNLSLEILQGRDESLDADEFMGGSQSMAEVLDVNGALERKRGI"
     gene            complement(1200748..1201780)
                     /locus_tag="CND04330"
                     /db_xref="GeneID:3256904"
     mRNA            complement(join(1200748..1201156,1201211..1201427,
                     1201504..1201557,1201636..1201780))
                     /locus_tag="CND04330"
                     /product="expressed protein"
                     /transcript_id="XM_024657059.1"
                     /db_xref="GeneID:3256904"
     CDS             complement(join(1200981..1201156,1201211..1201427,
                     1201504..1201557,1201636..1201755))
                     /locus_tag="CND04330"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512768.1"
                     /db_xref="GeneID:3256904"
                     /translation="MSLQDRFASQDPLSLLSGATTLSLITAASQASLAYNLPVVLFGV
                     LSYEMKNSNAPFRQFLILIPLTFILDLYAILFRSLSILPWIVTLLLALLKAPLFFSCL
                     AQLRERGGELSLEGWTGIGGFNRLGGQNSWGMPASMPGDFGDNQPSAAPAQQTFPSSG
                     GFRLGGDEEQGQGHPTGAPGRNGYQTIG"
     gene            1201938..1204974
                     /locus_tag="CND04340"
                     /db_xref="GeneID:3256875"
     mRNA            join(1201938..1202066,1202117..1202139,1202203..1202220,
                     1202289..1202377,1202442..1202612,1202675..1202779,
                     1202832..1202869,1202920..1202935,1202987..1203067,
                     1203133..1203236,1203305..1203356,1203405..1203446,
                     1203491..1203568,1203614..1203656,1203711..1203959,
                     1204010..1204056,1204107..1204417,1204480..1204587,
                     1204653..1204974)
                     /locus_tag="CND04340"
                     /product="vacuolar protein, putative"
                     /transcript_id="XM_024657060.1"
                     /db_xref="GeneID:3256875"
     CDS             join(1201961..1202066,1202117..1202139,1202203..1202220,
                     1202289..1202377,1202442..1202612,1202675..1202779,
                     1202832..1202869,1202920..1202935,1202987..1203067,
                     1203133..1203236,1203305..1203356,1203405..1203446,
                     1203491..1203568,1203614..1203656,1203711..1203959,
                     1204010..1204056,1204107..1204417,1204480..1204587,
                     1204653..1204789)
                     /locus_tag="CND04340"
                     /codon_start=1
                     /product="vacuolar protein, putative"
                     /protein_id="XP_024512767.1"
                     /db_xref="GeneID:3256875"
                     /translation="MRFPLLLPFAALELPVPTAPLEWKQANFLSISDSHGWLLGHQHS
                     TWPEPNYSGNYGSFASFVIHMRKIADEKGVDLLLIDAGDHHDGSGLVSSSPDSASLAE
                     DIFSMISYDVITIGNHELYHYADALDIYENHERWGGRYVTSNVNITVKREGEWQSVPI
                     GQTHLKFTTKQGYNVTAFGVIFDFKAHDKGITVQKPSKLVHEPWFQEAIRDAPDYFIL
                     AGHMPVRGETAEFAPVFDAIRDIHPQVPIFLFGGHTHVRDCVQYDERSIGVVPGKYLE
                     TVAFTSSSLPSSSGDDRPLDVARRYLDANPTSYQWHTNQTSYTFDTEQGLHISLTLQH
                     LASSLNITDPLGVSPHDYYLARHPWGHPRSVLTLFSDKVLPKTVVDHERGKGEQGKER
                     IIIGNAGSLRFDLFQGVFDRNDELTVSPFTSSFLYTRLPASLARNITDQMNRAGASKL
                     MSKSPVTPYEEEQRVKRIHDRWLYEQWQAYELENAYEGDTQKVMVDKGKDKPRTLGHV
                     TKDKCPGTGDDIAHIPVPFYSDQPDFISSPFPSVAEDEEIDVVCMDFALDDFLTAVNT
                     LDPTLNLNESEMKPYAKGLRINSVFGKYAQRYWGAGTQE"
     gene            complement(1204643..1207729)
                     /locus_tag="CND04350"
                     /db_xref="GeneID:3257121"
     mRNA            complement(join(1204643..1205129,1205185..1206800,
                     1206858..1207729))
                     /locus_tag="CND04350"
                     /product="protein transporter, putative"
                     /transcript_id="XM_570117.2"
                     /db_xref="GeneID:3257121"
     CDS             complement(join(1204887..1205129,1205185..1206800,
                     1206858..1207695))
                     /locus_tag="CND04350"
                     /codon_start=1
                     /product="protein transporter, putative"
                     /protein_id="XP_570117.1"
                     /db_xref="GeneID:3257121"
                     /translation="MDEEESFANLISSTALPARPSWDAPSTSPSHDADPWANPFSADT
                     TTLPTSFSSSALLSSSPKRTTVSPYVAQLEREATARPFPDPPSVIAAREQELVQKAED
                     LAKHRSVYASSAFASPFESPAVNSGPAADDPFGNPFAQPSAGQERDPATVLFPPGAID
                     ASLPPATSGQTEEQGLEILKDLIDDGLTEDGDSGRSLKRAFKKSAQVPREKHELGSER
                     SKAYVFSPKKKGSNEEAKQRLLNDDMEADKVVKGAEELPLSRENALDKDREKEGLDQH
                     QLQAYTETSTNAPSPTTPKANTPTPRSPASVPLPISTVTTPTATRQSTPVPSTENSPD
                     HAKEQIKAGKEKDNASTVTLSTPRSNGMSVSPLDASSIEEPYKNLSIGGSAPEQIHSS
                     RDTWNTPQPGESQPSVSTTTTRFGGRGWGALDEDDNDGLFGKSTLGMASGSVTGAMTS
                     WGEGEESGWGEPGLASLDENTTFPFDDGSDEPASSQPKLEPKPPYASSVSSDSVPFAT
                     PPTKRSTLPYFQISVSDPTRVGDAVRGYTVYTIRTRTSSPHYQQSTFSCLRRFSDFLW
                     LFEQLSHNNPGVIVPPMPDKHSWGRFEDQFVETRRLALEKCLKKITSNPILQLDPDLR
                     LFLESDNFAYESKERKHQIAAQTSSTEKGGLLAGWTSTKFVEQDDWFNSRRAFLEALE
                     SQLKSLAKAIEISSKHRVEVAISLADYAESLTALAESDLGASLSAALSQMSGLVAREG
                     DYAEWHAKSEVGELLNLADEYIRFIGSVRSAFAARVDSWKVWQEKDKEVARMKTAREK
                     ARISGKLGDRVQSSLKEIMEAERRVHEASLEFDRLTKLVKSEFVRFERERVLEFKETL
                     ERYLNGLIEKEKEMIEGWEGLHSVVARMMEKSQAGQSVGQQM"
     gene            complement(1207878..1209196)
                     /locus_tag="CND04360"
                     /db_xref="GeneID:3257089"
     mRNA            complement(join(1207878..1207959,1208007..1208064,
                     1208120..1208322,1208376..1208541,1208596..1208738,
                     1208797..1208907,1208958..1209049,1209101..1209196))
                     /locus_tag="CND04360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657061.1"
                     /db_xref="GeneID:3257089"
     CDS             complement(join(1207942..1207959,1208007..1208064,
                     1208120..1208322,1208376..1208541,1208596..1208738,
                     1208797..1208907,1208958..1209049,1209101..1209110))
                     /locus_tag="CND04360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512802.1"
                     /db_xref="GeneID:3257089"
                     /translation="MNNYDGQNPYYGGAGGGYVAGGSPYGSQDSPSRKARGGNQTIRP
                     VTVKQILDAQQVHPDADFTIDGVDVAQVLLIGSVRNMSTTATNISYEIGDGTGYIDAR
                     VWLDSADDESGKTTGIEQDHYVGLMGTIKVFGGKRHVSATHIRPITDGNEVQHHLLKA
                     LYVSLILRGGTPGNAPKAAGTHDDYNAGATTGATDQSAWSHLEPLQRRILEVLSSEGQ
                     GNDDGVHVTHIIKFLNGADENDFTVALDWLTDNGYVYSTLDESHYQVL"
     gene            1209341..1210496
                     /locus_tag="CND04370"
                     /db_xref="GeneID:3256994"
     mRNA            join(1209341..1209878,1209931..1210134,1210182..1210496)
                     /locus_tag="CND04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657062.1"
                     /db_xref="GeneID:3256994"
     CDS             join(1209381..1209878,1209931..1210134,1210182..1210391)
                     /locus_tag="CND04370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512624.1"
                     /db_xref="GeneID:3256994"
                     /translation="MPDPELSPIDPALQQPTLNSIQEAHDSSGVNPLNEFAQQVLGRE
                     ADAENLLDFGRAHSILGEEQTFGDLLQAERRKDGEDEDDVDADRHMEHHEHGHEHVHE
                     GHLQGQEEDVHYMAENVEQVMDPLPGRARGIRQAKKRRVGDDVIDGDGQIIDPLEYAK
                     SRKDNHREVESRRRQAIADGIAEIAQLLPSPPAPKEGKGQLLKRAVTYIHELLGKIAR
                     GVEEIAQVEQEKQKLRMDIAHLEARLADERSRSIRFESSWRQAEDLAASSNFELERLK
                     AELEKLKAEAEPAEDQLLPAEAAREEE"
     gene            1210633..1213423
                     /locus_tag="CND04380"
                     /db_xref="GeneID:3256972"
     mRNA            join(1210633..1210844,1210901..1211072,1211137..1211211,
                     1211272..1211348,1211396..1211602,1211661..1211893,
                     1211948..1212150,1212199..1213178,1213242..1213423)
                     /locus_tag="CND04380"
                     /product="monovalent inorganic cation transporter,
                     putative"
                     /transcript_id="XM_570596.1"
                     /db_xref="GeneID:3256972"
     CDS             join(1210783..1210844,1210901..1211072,1211137..1211211,
                     1211272..1211348,1211396..1211602,1211661..1211893,
                     1211948..1212150,1212199..1213178,1213242..1213329)
                     /locus_tag="CND04380"
                     /codon_start=1
                     /product="monovalent inorganic cation transporter,
                     putative"
                     /protein_id="XP_570596.1"
                     /db_xref="GeneID:3256972"
                     /translation="MSTAPPDTEILNPEDEEFYASWGLCILCVLLIGALISSYYLQVK
                     RIRAVHETVISIFAGMVVGLIIRLAPGHMIRDMMSFKHTFFFNALLPPIILNSGYELK
                     QENFFRNFAVILTFAFLGTFITAVGVGVLVYIWSFLGLEGLKFTLLECLIFGSTLSAT
                     DPVTILAIFNTAKVDPKLYSIIFGESILNDAVSIVMYETLSHFHGEDIYVSSLFHGVG
                     IFLFSFLISMALGVSFGLACSLGLKHSHLASYPHIESCIITLVAYTSYFFSNGLAMSG
                     IVSLLFCGITLKHYAYHTMSRRTQRTTKYMFGVLAQLSENFIFIYLGLNLFTQDVQVF
                     KPLFILVSAIAVMASRYAAVFPLSELINWIFHTRGQRTEEIPHSYQMMLFWAGLRGAV
                     GVALAAGITGDNADALRTTILVVVVLTVIVFGGTTSRMLEVLGIRVGVEDEDASSDDE
                     EPWTAQPGHLALQSGAGFRRYPYSSQNSRGWEDPSELDLQSPEGSPYNQTLKLSHSRQ
                     ARSSSYGQGRYGYGVRSGFSTNSDESDEEVLPSAGPSGSYGDGYDPEANVPGTSSDNR
                     AGEGKGPSMIFRDGQWFTALDERYLLPLFSNSVTARRHHAKKAVRKGALAASGAGGRD
                     TPGTGSKSGSTSGTPRRASLELGDDGYGGDGESENGKNKGLPRTFSGSVSDFFFSKSE
                     PSPLPSTSLPLDERGK"
     gene            1213439..1215513
                     /locus_tag="CND04390"
                     /db_xref="GeneID:3256892"
     mRNA            join(1213439..1214235,1214295..1214609,1214667..1215160,
                     1215215..1215513)
                     /locus_tag="CND04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_570113.2"
                     /db_xref="GeneID:3256892"
     CDS             join(1213583..1214235,1214295..1214609,1214667..1215160,
                     1215215..1215483)
                     /locus_tag="CND04390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570113.1"
                     /db_xref="GeneID:3256892"
                     /translation="MDKPSLPEYLVGGRYFHAKTRRPVTLRYIGHLPPSSSSRDPSSQ
                     VWLGIEYDDPLFGKHSGVYQGIQVFHTREEGSGAFLKFAGRPLQEGKNLVQSIEERYG
                     PIIPNDEGQPPQIAGNVHANSKGLILGSSKGSIIVETPNNWADAQKRVGNLEKLRIMG
                     FEDEGITELGGDKNLRDIMRARLRGVEWLNLSRNLLKGWGEVAQIVECFKGLQTLTLS
                     HSRFDGLSSDLPDDTRQRLGAFSKIRELHLSDCSTTMKEVVLIISFLPNLRVLHLEAN
                     RTISTLLLDEQEYQILDRCKTLKELRLGGCPISRWDEIAVILEHLSGLESLDLSFTPL
                     SHVPRPSITTYANIRSLSLFGSCLLRWEYIDHISQYFPALTSLRFSLSSGAISSIAAK
                     GTQNSSAFISASSDLQRSLIIPKLPNLIAFNSTTITPSERRDAELFYINHVKSRLSEH
                     PDERESWGRYVELCKVYGRDETSTEKKPEAGLKRKMITLRVYKHPTDPSPGTLALLPS
                     SSIKLLLHRVSRLVGATSTASPRLWTVIDKGGELEKVIDISRKREGNDWTVGWWFEDG
                     DCVLVDEDES"
     gene            complement(1215530..1216778)
                     /locus_tag="CND04400"
                     /db_xref="GeneID:3257014"
     mRNA            complement(join(1215530..1215846,1215909..1216364,
                     1216418..1216480,1216536..1216620,1216676..1216778))
                     /locus_tag="CND04400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570616.2"
                     /db_xref="GeneID:3257014"
     CDS             complement(join(1215547..1215846,1215909..1216364,
                     1216418..1216480,1216536..1216620,1216676..1216740))
                     /locus_tag="CND04400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570616.1"
                     /db_xref="GeneID:3257014"
                     /translation="MKHGIHQRKLGRMPAHRIALLRNLVSALLHHESIKTTLPKAKEA
                     AKMAEKIITLGKKGTNQARSKATAYLMPAHHAPSSSYAPSPSNPTPTLPPLAHPQSLD
                     PETFTPPTSLLPKLFTTLATRYAARPGGYTRIHKFGRRPGDNAPHAILTLVDGPRDLK
                     FEMTARTAGKESLDAMEGWEQIESSVDEWEGLSEKTKRDVAKVLRYRSEDDKKLFKAK
                     ATSFSDTVTVEESAYGGVRKPALELQKPTFRAPSLNLPRSGKHIHAGERLSGMSVAHT
                     GLGLARGALARSKSGKSGLDRTPLLWGQSNRLDRVKGEVVTSSADA"
     gene            1216921..1218033
                     /locus_tag="CND04410"
                     /db_xref="GeneID:3257425"
     mRNA            join(1216921..1217151,1217330..1217468,1217529..1217548,
                     1217618..1217627,1217684..1218033)
                     /locus_tag="CND04410"
                     /product="acyl carrier protein (acp), putative"
                     /transcript_id="XM_570111.2"
                     /db_xref="GeneID:3257425"
     CDS             join(1216945..1217151,1217330..1217468,1217529..1217548,
                     1217618..1217627,1217684..1217691)
                     /locus_tag="CND04410"
                     /codon_start=1
                     /product="acyl carrier protein (acp), putative"
                     /protein_id="XP_570111.1"
                     /db_xref="GeneID:3257425"
                     /translation="MFRTLPLLRTARTALRQTAPVALRPQPLALSLRPLAARGYAAAA
                     GLSKDDITVRILDVLKSFEKVDSSKLTNNASFTSDLGLDSLDAVEVVMAIEEEFAIEI
                     PDAEADEITTVQDAINYVANTSEAH"
     gene            complement(1218015..1220084)
                     /locus_tag="CND04420"
                     /db_xref="GeneID:3257108"
     mRNA            complement(join(1218015..1218635,1218688..1218813,
                     1218869..1219119,1219172..1219342,1219398..1219690,
                     1219740..1219847,1219893..1219973,1220010..1220084))
                     /locus_tag="CND04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_570615.2"
                     /db_xref="GeneID:3257108"
     CDS             complement(join(1218099..1218635,1218688..1218813,
                     1218869..1219119,1219172..1219342,1219398..1219690,
                     1219740..1219847,1219893..1219973,1220010..1220074))
                     /locus_tag="CND04420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570615.2"
                     /db_xref="GeneID:3257108"
                     /translation="MLRVITAQPAMSQPPADAPQDDWQVAYVWAFITAFNLRHRIPRL
                     ESQQDLELSLRQPVATRPDDLLESTLICFLSNLRPALRNLNAENVQSYLSNYISDQLA
                     TTSEWTVWDPSWPINEENRGSCCTDDPDRAELGRLRYQGEPPADRARRNPLKRMEEKG
                     GGLFELDWAERARLLRQLVDWQLTHSEHIRTIINNAKKGPEAKSKKGTASKKPLQDEA
                     PSISIEPLGQNRNRQRIWALDDSWRLYRSGNPFKRPCPMESFTHTRDDYFAYIAEVEE
                     YGGQSQEGTKKEKATSQHRRFIKGVQDEKKLAEILKDRIERIEKEEARVQRAKRKIAQ
                     AVQLQQAAEMRSTRTRRPVRKVDYIYGNEDEDEEPLPTRRSSRPSRQSGRDDESYSAL
                     DSRGRPVIPGERRSTRVSGAAREVVEDDDDDDDDDRDDETPRQPPPLPQPEAVSGPAN
                     GRKAPKGYAWVQENVGGEDSSPGVAAVDDQQRRVEPTSAKQQDVQSEDQVATPLESTD
                     TSRVEFEQSEQGVRLGMLEQGENDEQTEITMEVEV"
     gene            1220198..1221274
                     /locus_tag="CND04430"
                     /db_xref="GeneID:3256941"
     mRNA            join(1220198..1220304,1220360..1220504,1220839..1220958,
                     1221013..1221274)
                     /locus_tag="CND04430"
                     /product="ubiquinol-cytochrome-c reductase, putative"
                     /transcript_id="XM_570597.2"
                     /db_xref="GeneID:3256941"
     CDS             join(1220204..1220304,1220360..1220504,1220839..1220958,
                     1221013..1221147)
                     /locus_tag="CND04430"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase, putative"
                     /protein_id="XP_570597.2"
                     /db_xref="GeneID:3256941"
                     /translation="MLLGQHYSQPPPIAPSTMPSIAKMVFGNGPLGPSFAPWIRQYPG
                     VQKYWARWSELYRHAAGYRQKGYLLDDLVIEENKAVQKALSRLPERVAYDRVWRHRQG
                     IMMSMHHTDLPRNKWTPPEKDEQYLTPYINQVLAEEQERADWDHSVVERIKKRQAGRQ
                     NPFERV"
     gene            complement(1221222..1222815)
                     /locus_tag="CND04440"
                     /db_xref="GeneID:3256856"
     mRNA            complement(join(1221222..1221400,1221465..1221541,
                     1221600..1221705,1221784..1221809,1221867..1222239,
                     1222297..1222368,1222442..1222464,1222549..1222571,
                     1222626..1222650,1222719..1222815))
                     /locus_tag="CND04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657063.1"
                     /db_xref="GeneID:3256856"
     CDS             complement(join(1221264..1221400,1221465..1221541,
                     1221600..1221705,1221784..1221809,1221867..1222239,
                     1222297..1222368,1222442..1222464,1222549..1222571,
                     1222626..1222650,1222719..1222762))
                     /locus_tag="CND04440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512780.1"
                     /db_xref="GeneID:3256856"
                     /translation="MAIISTLAAIGMAVGPPLIYVDQAISIIKKKDSSGFSQDVCGVI
                     IIANIIRIFFWLGEHFEIPLLVQSILLIVSQLLLLAICLHYSRGSPEETYFSLPRQPT
                     EPPSADPAHTADYEYSGPSSSQPPDVPVRRGFFKSVIQGLKEGRRPFDFWQWAGYGSY
                     LEFLAGLIVVLGIAQVGLGRWPWYIDALGFIALTIESTLPIPQFIANYRHKSCYGFRA
                     STLAGWFFGDAFKTVYFFMRGSPIQFKVTAIMLVCWDSAVFAQRIIYGANPPVNQTGV
                     EFDAHDENNDESRALHDAHNDREER"
     gene            complement(1223069..1224016)
                     /locus_tag="CND04450"
                     /db_xref="GeneID:3257087"
     mRNA            complement(join(1223069..1223372,1223434..1223580,
                     1223642..1224016))
                     /locus_tag="CND04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_570613.2"
                     /db_xref="GeneID:3257087"
     CDS             complement(join(1223148..1223372,1223434..1223580,
                     1223642..1223842))
                     /locus_tag="CND04450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570613.1"
                     /db_xref="GeneID:3257087"
                     /translation="MAFASTSRHLPRESVYPTPPSSDYLNALEDCVQATEACSRSLQT
                     GLDRFEPGVRDLPRLTKIFKHKHHFLVLPEPTIAAHKAALSQSLAPQIDHLIAKTDSM
                     VDSEKTKVGNLEERLRILESARLSASASTMRTVSSGRSTKAVSNTSDDTSSKISDLNM
                     KDLSILQRKKVMQLKAKRDRLEREMARLGR"
     gene            complement(1224236..1227205)
                     /locus_tag="CND04460"
                     /db_xref="GeneID:3257127"
     mRNA            complement(join(1224236..1224465,1224522..1225215,
                     1225266..1225522,1225572..1226424,1226475..1226600,
                     1226649..1226806,1226866..1227205))
                     /locus_tag="CND04460"
                     /product="expressed protein"
                     /transcript_id="XM_570681.1"
                     /db_xref="GeneID:3257127"
     CDS             complement(join(1224268..1224465,1224522..1225215,
                     1225266..1225522,1225572..1226424,1226475..1226600,
                     1226649..1226806,1226866..1227132))
                     /locus_tag="CND04460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570681.1"
                     /db_xref="GeneID:3257127"
                     /translation="MSHTIPLSLATLRSHSIFNPPISTSSPPEDEWELLDRPSADEPM
                     SQKQGRMVLRDKDLIVAMGSEVRMMSLNASDGSWKVEDGLVGSYRTLKSAHLTFAIHH
                     IVVNPTGRLLAVVGHHQIVVLVLPKPTHSGKLEEGQAEVESIPIDDFLFSRSSNDAIT
                     QVQWHPWGENGNSLWVLTAGGKLREYDVLQPHDCVQTFDFIPERTRSVPKFTAVDPLS
                     RYASSFAFGSSMIGFSPLMVYCLLASGDIHVLGPILPLRTEMPAQYLRQLKTFADIRL
                     ATVQNQARDVFGAGTSGLGKAVLQAEWVDHLVKQVRQTEEMQSKKQVEEGGGTTQNMP
                     MRASILGKSTKIHSSPVENRSSSLGLPRNGFVRVHPPHLTESGGPAPGAHRTLLRQGP
                     VVFSPGPQDVGNVDEDLDEEQMATDLLIVQVDANEMDAGGSKGTEGQTVIAIAWSGGR
                     VDIGLELDAPEARWISSRDPTPPAPVIHITDSILLSFPNNDPFIISSNAPVLARDPLY
                     NDVFYVSHAFGVDAINVRAVVDGLDGDGNEGELPVPQVSRLVESNSVPNTPIVGMFGF
                     CNITFGYGIVVLASTGQVAYMELDIRFGDRLALLPSSARAASGFRTELKDTQSLLDNA
                     FEVDSLVSSVKTGTKASRRQIPDYNMPLTVINSDHLSALQDVSSHVHAQAQRIRTASQ
                     AVENRLDLQVEELQRHARLMAECRQEVASLQKSETLGRIESLIRRQEGIQKRVEKMLG
                     DMALEYKPHVGDGERKWFKELQEMEMKLNGDSGEAKEALTDKVQSLRNQLASLLPVVS
                     KAHQKESAAASTLAPKQIKPLKAALGARSEELKRLLNKVEALDIRLDTAPVE"
     gene            complement(1227474..1228794)
                     /locus_tag="CND04470"
                     /db_xref="GeneID:3257236"
     mRNA            complement(join(1227474..1227809,1227862..1228037,
                     1228098..1228268,1228323..1228345,1228400..1228480,
                     1228569..1228794))
                     /locus_tag="CND04470"
                     /product="expressed protein"
                     /transcript_id="XM_570612.1"
                     /db_xref="GeneID:3257236"
     CDS             complement(join(1227659..1227809,1227862..1228037,
                     1228098..1228268,1228323..1228345,1228400..1228480,
                     1228569..1228755))
                     /locus_tag="CND04470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570612.1"
                     /db_xref="GeneID:3257236"
                     /translation="MPPSVILDCYQHSYFDFPHYLAKNNYRLYMMLLGTLAHLALTIT
                     CGYSLTVPQAHRETLEEAAVNTKKLIEDVTVGTMSSVFPNGTDNGGRPFAMMEYHAPC
                     HPPPSLTFLLLPISLSTHNIMASSSHYASYSVAMPHKDEWSPMSLSRVAFIGNMTFLP
                     DISKEEKAELEKCYLSYHPDAKYWLPGASNSPHSSVWAKLDADDIYYVGGFGDTHYIG
                     HIPIDLYTKVGEADEGNGQGQSEQVLSGYSVFRNGVSLLLKNIF"
     gene            1229198..1230269
                     /locus_tag="CND04480"
                     /db_xref="GeneID:3256860"
     mRNA            join(1229198..1229284,1229513..1229794,1229886..1229957,
                     1230005..1230269)
                     /locus_tag="CND04480"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_570598.2"
                     /db_xref="GeneID:3256860"
     CDS             join(1229282..1229284,1229513..1229794,1229886..1229957,
                     1230005..1230055)
                     /locus_tag="CND04480"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_570598.2"
                     /db_xref="GeneID:3256860"
                     /translation="MDPEGPVTLRTSKFITNRLLNRRQFVLTVFHPTRPNVSRSELSE
                     KLGALYKTDKERVVVFGLKTKFGGGSSTGFGLIYDDEDSQKKFEPKHRLVRSNLAEKV
                     VKPSRKLRKERKNRSKKLRGKARSKAGEPAKKK"
     gene            complement(1230270..1232542)
                     /locus_tag="CND04490"
                     /db_xref="GeneID:3257011"
     mRNA            complement(join(1230270..1230604,1230667..1230942,
                     1230999..1231165,1231212..1231303,1231360..1232294,
                     1232353..1232379,1232440..1232448,1232520..1232542))
                     /locus_tag="CND04490"
                     /product="expressed protein"
                     /transcript_id="XM_570611.1"
                     /db_xref="GeneID:3257011"
     CDS             complement(join(1230311..1230604,1230667..1230942,
                     1230999..1231165,1231212..1231303,1231360..1232294,
                     1232353..1232379,1232440..1232448,1232520..1232540))
                     /locus_tag="CND04490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570611.1"
                     /db_xref="GeneID:3257011"
                     /translation="MPTAGVKTKKVTTYGRKNTQIISIHSDFVEPVDLTSPPVLPTRQ
                     RQPLTAKPSNDNCNLPAATCQALNSLKSDRLSKAPYKEETLPKVAKGVSPDGTLSKVT
                     VPPLSKSPRIVSTKQRRVSRKTSKAIVPRSPAAAHTTLPSAPKIPMESSSMQSTKQQR
                     SPGSAIRAKKRLVFEGVILPLRSPISDIRIEELSERLSDVTIKDSSAQKTGNGADKGK
                     SSSQFALEALIQACSSASVQEFNAFIKSFPLFPASKDVFMTKVGEASYSEVFGFSQSA
                     EDADLVLKVIPLFSGTVEADGSFPDCSSPEDVLREIEITKKMNQVPGGGFVEFRGAYV
                     VEGKYPKELLEKWDIYKSTQGSASVRPSAFGPTQKYCLVALCNSGIDLEALQFDSSRG
                     WVQAAGIFWQVAAALASAEDWTKFEHRDLHEGQILISSLSESPSSTEPENYLSPTYTS
                     LQTTIIDFGLSRLNMPTPVWSQIPEEVYEGKGAQWDLYRAMRSRIGDDWGGFHAITNL
                     MWLRYILQYMLVSKSLRKPRALRSTQVPRLARGVKPKPDTVRSEKAWGILQKVEEMME
                     YSLNFDMSARSNRNHKNDALKPLTSARDLVNWGKDEGWIG"
     gene            1232915..1237245
                     /locus_tag="CND04500"
                     /db_xref="GeneID:3256874"
     mRNA            join(1232915..1233063,1233186..1233330,1233376..1235637,
                     1235689..1235874,1235950..1236210,1236264..1236745,
                     1236800..1237245)
                     /locus_tag="CND04500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657064.1"
                     /db_xref="GeneID:3256874"
     CDS             join(1233035..1233063,1233186..1233330,1233376..1235637,
                     1235689..1235874,1235950..1236210,1236264..1236745,
                     1236800..1237115)
                     /locus_tag="CND04500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512623.1"
                     /db_xref="GeneID:3256874"
                     /translation="MSQIMAHVPKAPIGELIKTPSKTQTVKRTRAATAAAKEKTEKIK
                     GLNAQLLSPSSRQTSRPALSPLQFGSRNVNTSDAPSPSPIKSKSIKASSPSKSKAKRG
                     RSRKAEPAMISNENASPRFENKNICSSSAAEPQHPFSPSRQSKLGDRMEQASSTKVEK
                     TLKSKPVMAETVENITEALIDGQNMASDRDETSLQSAVNHSPAGEIQSLPTVDEIVDM
                     DIDNIQGAGETQLKEMVEVMPELDNVKPEETVLPSSAEEDAHDVTVKEKGTGDHKLGQ
                     PKEGFGEGIRKEAVIEDVQSAQPTINEGGEIFGSNIGSNELKEGLVPHTEFPVQLSSR
                     TSATESKGIVTAAISSTQSAAVPQSPLAPAKASFMESSASSSTTAFSSGAVPIPVRQV
                     RSSWLSKALGTGTVPISNASGPAESNSVIGKPFTAPSQQRPSAAMDFSGLRKSLLPIG
                     GLKRKSGEGMEGEEEEEEGRRPDKFKKVSSEPYDFQVSTTPGPVGRPKLPSKTPSFGT
                     GSINSNPASQGRSALSSNLIDDSHRPEISKVTKALDELREKTAKDVAKQKASSAGRPE
                     SGNGRAPKAKSTGAGFLRGLLNFGGTSEEEEAIRRARELEEEKIAEAELEKLMWNATK
                     PFIDIESALNDPSADVSPLPEGNDDAGRSTTPILSPPSKLTPLPLPQLQSQPVTTAVK
                     DEDQEMVDEESVLDEIIPAETAEPVDTKDRRQQLSSPAPAFSAVNDVTPVQERPSASH
                     DRREKDQNKVSDINIKKMEEAKERGKEHNYGDQRDTGVEKLDDRRKAIDKSPGTHEAQ
                     VDYPYDNNVNDDIEINGELPPSTTAPTDILNFSTSSQATNSSTLNHASTMAAKALGVR
                     PATGPVKSLQLAAAAAKKEQNAASRKAAMRDQADKRKELLAQKKAEEERQRADEERKA
                     KIAELEEKRRLRAEHEKRKKEREARVAAIAKERVAKEEREMQAAKVKAEEEAARKRKL
                     TVALNKSQSSGVPATKRLAGHNQSLAKGKEPFRPTKTTSTHPLSQSTTTEQQAPKAFR
                     TAETTHTQSSTITLVKQTQRESHVERKPLGQPSRLSAMENQAMRQPQHQQNQIPQQSS
                     SAAPQSWAQVQSSLDEKAMAQQSEDIVLPDIASEYSDPDEDSTRDFDRPAWAESPELR
                     KALEAQAHINPDDLFGPIKPLNMEELFKVRAGKFRARTSSANWSRGDGLTRAEEVDYA
                     RRMGFTSLSYYDEAGGNGPHRG"
     gene            1237287..1240246
                     /locus_tag="CND04510"
                     /db_xref="GeneID:3257222"
     mRNA            join(1237287..1238029,1238121..1240246)
                     /locus_tag="CND04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657065.1"
                     /db_xref="GeneID:3257222"
     CDS             join(1237882..1238029,1238121..1239820)
                     /locus_tag="CND04510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512772.1"
                     /db_xref="GeneID:3257222"
                     /translation="MPTDGAGAGAMYASELVTHNHGYQSSSPTSGNWCFCGGPVEEGG
                     IYCSVACARYDAINSLCYKSHQSPLLAQNIDFQQAGSLTQAPSQPLLLGSSSTASSTA
                     AIAGDDDHWHAPHYRLSHADMRKQERRDERRRRRAEGSSSGSMSSNRSTVQSTSSSIA
                     SRAVPDLVGGGGHSRNPSVASSVTSLASSAFSLSRNPSVASNHSKRGLGGGFNVDSII
                     METEGEQEWLRSESSKPYGSISLARQTHHKPLNSRSTSGRQRKNTPDLPLGMGQDMRD
                     VLEEIIQMEQSYLVDDTNSPTSPDDPPPPRLFSSQFGPPRTPSPSSNRKRAPPAPGAP
                     DTSVRGHRSTLSQNALAPPHTPACQPQRGPRPSSLFGMHQSSLSESHTALYLATASPA
                     AAETRSASPKLETRRSLVFTADNAGPSINVDTEHLSTGVPSLTLPRRNSEANSPMVTP
                     MNRRFVQNRTPKAIHPSMDGWRFPSPMNATTPTRSARQSIPDTPLMGESRGIHGIAQN
                     RCCSPERITPALLWPPQSRPRGDSPPINLEPSLFPGSPVAIPYSVNPLSHVERGNMTQ
                     GDREDDIMDVEMRGSPGYHDSSTEVPGNGGRYLLVPLETESSRGTSHRW"
     gene            complement(1239959..1242139)
                     /locus_tag="CND04515"
                     /db_xref="GeneID:36392838"
     mRNA            complement(join(1239959..1240479,1240535..1240591,
                     1240638..1240667,1240718..1240730,1240797..1240817,
                     1240879..1240905,1240963..1240985,1241034..1241065,
                     1241120..1241220,1241353..1241367,1241420..1241456,
                     1241607..1241726,1241819..1241837,1241888..1241915,
                     1241989..1242139))
                     /locus_tag="CND04515"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658496.1"
                     /db_xref="GeneID:36392838"
     CDS             complement(join(1240386..1240479,1240535..1240591,
                     1240638..1240667,1240718..1240730,1240797..1240817,
                     1240879..1240905,1240963..1240985,1241034..1241065,
                     1241120..1241220,1241353..1241367,1241420..1241456,
                     1241607..1241726,1241819..1241837,1241888..1241915,
                     1241989..1242025))
                     /locus_tag="CND04515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514349.1"
                     /db_xref="GeneID:36392838"
                     /translation="MALVPTGAPRDAAITIGPFKPSRPGYGPVLSYLQAAQLPTPLKI
                     HPLLQLRTWDPKPYAKYLTWNTIEHPMFAAIWVDYDDTETVWIKERGQPATSPIVEEL
                     NLGHVETGWSIRVRNRMGITCEDVLFAIYDFFASPLYVDELGEMHPRAVRIMEQQYFE
                     KRRMGFFDLMEGYRKSDALLGATYFDGIHNDPESVERLKVKYNYHSSNLLLLRLGNC"
     gene            1242314..1245011
                     /locus_tag="CND04520"
                     /db_xref="GeneID:3256998"
     mRNA            join(1242314..1243171,1243224..1243385,1243438..1243828,
                     1243892..1243976,1244030..1244072,1244121..1244333,
                     1244390..1244587,1244648..1244799,1244855..1245011)
                     /locus_tag="CND04520"
                     /product="WD-repeat protein, putative"
                     /transcript_id="XM_024657066.1"
                     /db_xref="GeneID:3256998"
     CDS             join(1242356..1243171,1243224..1243385,1243438..1243828,
                     1243892..1243976,1244030..1244072,1244121..1244333,
                     1244390..1244587,1244648..1244773)
                     /locus_tag="CND04520"
                     /codon_start=1
                     /product="WD-repeat protein, putative"
                     /protein_id="XP_024512622.1"
                     /db_xref="GeneID:3256998"
                     /translation="MELYMYTPPVYMAPLRPLVKPAPSVPIVKEAPIPELFQAPEGQY
                     SLAEPGSMFPLLGNTSPNVASELRLACQPGPFLGGPGFGIPPTPQQTSPSAASASSTC
                     FGATQINGKWEPIYPTRMSWVTVQFPSKTGDRGFGGLLGKSGKGDTAAFLPPAAADGR
                     YPTKSSYSSSSSSSSPISSEPQSVPFAMSPPTIQSKWPFTKTINAIPRPKTNMRNSTS
                     DFVQRVIGLDSASKYLAEKGKTVSEVVKWGCWHMGRQWAWGDFGKQANEAEKKKEALV
                     KVLFSTPLTCTAIINQTASADRLDVIIGFETGDLLWLDPILGKYTRLNKNGVLNSSRV
                     VGIYPDPRQPTHFLVLFADNTILRFNISLEDPINAANITSHPWDVFFDRVLLATTNGH
                     DPSLSSDSGTGLSLDREQDVELLKWKNEDWVAGVESEKPKDKNAIVFTGRNPVAALKI
                     GDARINALAYSPDGGKLASVSSDGLLRVIDTSEERITDTFSSYYGGLKCVVWSPDSRL
                     IAAGGEDDFVTLFSIGRDARIIARCQGHSSYITSIAFDPQSNNPSSRAYRFVSTGEDG
                     KLLFWDYSPATVHKPRQHHVNGSVQRDAAASSMTVNILDHSRSHTPAERTSGRFHSAP
                     SRKSIPTLQPVMSKTVDVTILTNVYCLPDAIATVSRQGVARFWMRPSSRPPPA"
     gene            complement(1244986..1248657)
                     /locus_tag="CND04530"
                     /db_xref="GeneID:3257118"
     mRNA            complement(join(1244986..1245973,1246026..1246081,
                     1246135..1246216,1246267..1246573,1246623..1246714,
                     1246763..1246905,1246958..1247125,1247177..1247975,
                     1248019..1248392,1248450..1248657))
                     /locus_tag="CND04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_570104.2"
                     /db_xref="GeneID:3257118"
     CDS             complement(join(1245155..1245973,1246026..1246081,
                     1246135..1246216,1246267..1246573,1246623..1246714,
                     1246763..1246905,1246958..1247125,1247177..1247975,
                     1248019..1248392,1248450..1248600))
                     /locus_tag="CND04530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570104.1"
                     /db_xref="GeneID:3257118"
                     /translation="MSASRPKSSRVIQKPRGISALAARIPTSESTKQQSNVGGKRKAP
                     TPATRKGTRPASPISVASTVLSVSDNDEDDEDELEEVPIPIVSNEVQGGDEDEDEQDG
                     EDEESEDDDGVIHLEIGGETAEEKAKRMVLAKRKKPLTARDRALRLEVHKVHVIALLA
                     SASVRNKWCNNSLLKARLLSLLPHPLQAAFNIPPSRFPDRAQRSRLFFEALQSLVTWW
                     SQTFFDVSDYALGLRTRPWDEVQGIIESISKVHTPFSRSPSGHGDGEKINKAASKGKG
                     KAAASEELSEQLAFGSGAERLRSVNSLMKKALQQEGSRDVSAQLFVALARACGLGVRL
                     VTSLQAVPWRAEKGATKKKAVGAGRGGRTLASRQGLGDEDEDDDEDEMEEVRIPDDVG
                     RSVGGAKNNSREAGSRRLKDPADLYRLRKYKPPARKIGSPTKSKPKASQSLADQPPVF
                     WAEVFNRSDQRWIPVDPVRGIIRKKRDYEPPTDSGPVRMLYVVAFEEDGYARDVTLRY
                     TKNFYAKTSKLRVPAKPNEPQWWSDIVMGFLRRPYHLNRDDMEDAELEMSQMTEGMPM
                     HMSGFKDHPIYVLERHLKRDQVLNTANPVGRFKGEAVFRRSSVQNCKTAENWMRSGRK
                     IKEGQEPLKWVKQRAVTLQKRRAQELAKQEGEEVTQGLYAEWQTEIYRPPPIRDGIIP
                     RNSFGNIDLYAPTMLPLGAVHLPYKGIAKVAKGLGVSYAEACTGFEFKKQRAVPIIKG
                     IVVAAEKKQEVLDAYEESTIAAEERERMKREDRALKRWSKLVNGLRLRLRLQQEYGSK
                     DKVNETPSNLFEGAGDEGEMRINLRGKSARELLAAAQHQSTKDWEERVRREDISMEEE
                     DGMMPAMAVERESNQILLGDFRAPSSAISEVTNVTPSAETPRIMLRFKNTSSPQSAAH
                     AASESRSGLTSSQKRKAMISGTIEAVDDEQFEDPRTTKGDKTMALPEPVASTTNMRTL
                     RSTRARTREQMKANQAREDKIRQA"
     gene            1248877..1252969
                     /locus_tag="CND04540"
                     /db_xref="GeneID:3257169"
     mRNA            join(1248877..1249102,1249155..1249185,1249248..1249284,
                     1249338..1249649,1249702..1249793,1249840..1249877,
                     1249930..1250871,1250924..1251070,1251123..1251184,
                     1251241..1251339,1251389..1251765,1251821..1251993,
                     1252045..1252272,1252322..1252387,1252446..1252610,
                     1252675..1252969)
                     /locus_tag="CND04540"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570102.1"
                     /db_xref="GeneID:3257169"
     CDS             join(1248956..1249102,1249155..1249185,1249248..1249284,
                     1249338..1249649,1249702..1249793,1249840..1249877,
                     1249930..1250871,1250924..1251070,1251123..1251184,
                     1251241..1251339,1251389..1251765,1251821..1251993,
                     1252045..1252272,1252322..1252387,1252446..1252610,
                     1252675..1252923)
                     /locus_tag="CND04540"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570102.1"
                     /db_xref="GeneID:3257169"
                     /translation="MVSSAAAQDQGNFKLLKSFPIGYAPITVSKWRSEKTGLTVVLGS
                     HQAPITNGYFAIASEIFDDTGRPHTLEHLVFLGSKQYPYKGVLDQLANRAGSNGTNAW
                     TANDHTAYTISTAGSEGFLKMLPVYVDHILHPTITDAGFVTEVYHINGAGEDAGVVYS
                     EMQARENTAGDLMALEGQRSLYPPGSAYRSETGGLMHKLRVLTAQQIRDYHAEYYQPY
                     NLCLVIDGAVPIPELFDVLNNQIDPMILANKSGSGPIIPADWKRPFVQTTTAKPLSIS
                     KPITKTVEFMEEDESVGEVLITYLGPPPTDYRTNLAISVLDSYLTQSATSPLSKEFIE
                     IPKPLCTAFSFYSSDRVNKNEISVYISDVPAKHLEDIAGLLQEKLRKIVREEGIDMER
                     MKRILRKDQRKLLEYMESRATEVLSDAIIGDFLYGKVDGKELPLAFNDMEDYSSLHSY
                     TAEEWLALLDKYFVSAPSITIVGKPSAALSVKIEKEEKERVARRKEELGDEKLKALEA
                     MLEAAKKESEIPPPKEMITSFPITDPSRLTWVPVETAINNAINDNVKSDGGEVQRFVD
                     ADGHRLPYQTHFSHVKSNFVVVVALFDTIDVPIHLKPYLTIFQNALFSLGVKRADGTV
                     LSHEQTVNELEDLTVSQSAHFEFKGNFAEVMAVTLKVEKAQYEQAVAWLRDLLSGAVF
                     DSKRLSVIVAKLAQELPTEKRDGNTIATAWANNLTYDASKSSSQACELLNRLHFIPHV
                     AEMLEKEPNAVIEKMEELRKHLLDPRKMRVAIQGDILGLQKPLSVLARSFLQVGEALP
                     LEPLSTSQQTLTTLGKNPSKKCVIIPMPAIEGSYATFFATGPSGHSHPDLPALRLASS
                     LLNALESYLWKSIRGSGLAYGAHVMVYPEAGLVGFSVYRSPNAMLAYQAAGKIMDGLV
                     DGSVELDQDLVDGARSSMTYDYARRSETVLGAAGTAYLNEVLKGLGKNADQDLLKSLP
                     GVTLEQVRDVISRYFSPLFKAETSIGAVTVSTSKTDEVEAGLRKLGFETERKELPVLQ
                     GDDESEHGSDVDMNGSESGSEVER"
     gene            1253214..1258563
                     /locus_tag="CND04550"
                     /db_xref="GeneID:3257186"
     mRNA            join(1253214..1255046,1255111..1255246,1255305..1255376,
                     1255427..1255600,1255648..1255869,1255918..1256274,
                     1256326..1256532,1256580..1256734,1256790..1257323,
                     1257376..1258563)
                     /locus_tag="CND04550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657067.1"
                     /db_xref="GeneID:3257186"
     CDS             join(1253274..1255046,1255111..1255246,1255305..1255376,
                     1255427..1255600,1255648..1255869,1255918..1256274,
                     1256326..1256532,1256580..1256734,1256790..1257323,
                     1257376..1258470)
                     /locus_tag="CND04550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512773.1"
                     /db_xref="GeneID:3257186"
                     /translation="MSPSASNPGYPPFLSPPTVDTRPSHPAQYQPQPQYHQRYFDHPP
                     QHTRYSPATYEYSPLGIEGAPEHVRPVTFAGGGQQPFAANQHYSLHQQVPQKQPQLGT
                     PEQLSVPSQYPYQSTHDQFPRLVASSHLPYGSPISTLHYPQVSQASVPESPSLRPESR
                     GNSLAPGFQQNTQAETSTSWPLPPIHPLPFSETPPRASLPTTTIVPSQNGFNLANTST
                     KIRFRPPLSPVAISGMVSSRSTRRSSQVHQEEQTVGASGRPQRGATRLAATKSIYKED
                     DDEELDDAYNSVVDEDVDEGADSTIKVAPAVTTRSGRTQKAPQRFEDDFEDAVTSASP
                     EMRSGRRIARGKAKRRLIVDPDEDEEGNAVPPPRNAFPPRSARNSLASANIDSALQQP
                     DVGTSYPNGKRSLRSDARAATRTRHSSADADEFEPTEGESTEGRASSDPLGNYDEEPE
                     EEDFVVSDDDDSGYGKRRSSRRRTTRATARNTRSTALPTRRSTRSSAKARALDSDEDS
                     SPHKRPNLRERTSRPNYHIPTLEELSKEISTQEALAAVAGGSGRAAGGFRGAGGVRYG
                     GVGLPFAMRAKDLTQAMGDPDTSDSDDMDFASPFKSGAAGPSMSGGTAVAARGAAGPS
                     DVPNFGRINPKSTTADADPLGVDMNVTFDNVGGLDNHINQLKEMVALPLLYPELFQQF
                     GITPPRGVLFHGPPGTGKTLLARALAASCSSGNTKISFFMRKGADVLSKWVGEAERQL
                     RMLFEEARASQPSIIFFDEIDGLAPVRSSKQDQIHASLVSTLLALMDGMDGRGQVIVI
                     GATNRPDAVDPALRRPGRFDREFYFALPNREARKKIISINTRSWEPKLSDEMLDKLAS
                     LTKGYGGADLRALCTEAALNAIQRRYPQIYKTVDRLQLETKSIHVKAKDFMLSIKKIV
                     PSSARSTSSPAIQLPSHLLPLLSVPLERINSAVDHVLPPKTQSTALEEAEYEDEAYES
                     FEKHIVLQSLDKLRTFRPRILVHGQPGMGQIFLGPAVLHHLEGFHIQSLDLGTLLGDS
                     TRSVEATIVQLFVEAKRHQPSVIFIPSLSQWASAVPELARSTFSALLDGIPPSDPILL
                     LAIADSPWADLPADVKAWFGFARENKIALDFPNTSERSAYFTDLLASVRKPPTDFPDG
                     VPRRKRVLENLPLASPLPPRQPTEAERARDEEKDQAARNMMVVSFTNLVKEFMKRYRK
                     VVASVKDDAMELSRCLVEQAAASAALSQSATALKGAEVVSNIIEDANNNAESQVNEVD
                     GGMNMLPTTENLSESSTGDIANISAAPVSAVNHLALPSASASTSAALIPTPTWQAHNV
                     DIDTIQRRLIRHKYYTPEDFLADIRKIEENAVKVGDPERQAKVVEMGANARLHISGFD
                     PKWTPEFERYAERMRAKKAARQRKKEQAKEIGEENGQNLTASESTHHPNPIAEISGMP
                     DAADTSSKRPREEDDGAEIEYQGREKRLRDDQPDTAEKASVDAPEALTSQSFPPDIAC
                     DSPQLDYPPFILPEQDLQNLQAELETATADLTVDQLEQLRATLFDKLWDDRKEWNRTM
                     TVIKMRQRLQEYIKEVNSWKND"
     gene            complement(1258529..1259544)
                     /locus_tag="CND04560"
                     /db_xref="GeneID:3257106"
     mRNA            complement(join(1258529..1258786,1258841..1258999,
                     1259061..1259544))
                     /locus_tag="CND04560"
                     /product="expressed protein"
                     /transcript_id="XM_024657068.1"
                     /db_xref="GeneID:3257106"
     CDS             complement(join(1258635..1258786,1258841..1258999,
                     1259061..1259283))
                     /locus_tag="CND04560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512779.1"
                     /db_xref="GeneID:3257106"
                     /translation="MSLTSVTRVVSKSILGASFTSTTRRLTTTVPRFGRMPPPAHKMA
                     HFPRITSSLPSEHSEFRTVMWTGESSQLVLMTIPVGGEIGEEIHHVDQHLVFTSGTAK
                     AIVGGEEKEIKAGDLVIVPQGTKHNFVNTGPTPLCLFTVYAPAEHAETTVNKTKEEGD
                     KLEDEGKDEPPKWAVRK"
     gene            complement(1260055..1262103)
                     /locus_tag="CND04570"
                     /db_xref="GeneID:3257291"
     mRNA            complement(join(1260055..1261641,1261688..1261856,
                     1261916..1262005,1262046..1262103))
                     /locus_tag="CND04570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570100.2"
                     /db_xref="GeneID:3257291"
     CDS             complement(join(1260235..1261641,1261688..1261856,
                     1261916..1262005,1262046..1262083))
                     /locus_tag="CND04570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570100.1"
                     /db_xref="GeneID:3257291"
                     /translation="MASAQVCRNYLNGNCRYGNSCKFYHPPKTAQSNQALKLPFQFTE
                     DTIRNDLTIELPQWILSVYGAAKYEPNLIYEGELSPEELRWRSVLSLKEGKVQEYVRE
                     EETLVSNAKAKITSLVADLSATNKLAQKLHQMRFTNGQQPGAPRPRDFSETAVVPSMQ
                     PLSGSAPFGARSNVSAFGGGNNSSFGSGGSAFGAMNRANPFSTAAAGGGTSSGSAFGQ
                     SAFGAGKPQAFGSSAFGGGSQTGSAFGSADKPTVSGGGAFGQAAFGQKSAGAPAFGTS
                     TFGLTNSSTKSAFGSSAFGQSAKPSVNAFGSSAPQSAFNQDNKPVKSAFGSSQAPSAF
                     ASTPQTTATPMPGTAFGQSAFGNPSTRTAANPAAASAFGQSAFGQEAKQNPFGMQPRE
                     TVASGSGFGLNQPAAPATGGFGSFSNTAHTSANPFGQSSVIPVTAPANVFNESANATQ
                     PTSLNSFAAPSTSAFGSTSAFGAAHSSKPAFGFANTSDSRSAANGYSALNSALKQPQL
                     SGPVPPGWSYDDPWTWCLYGNAGTDNGDSLEDEFLDAFKQATFTLGNIPTMPPPLDLR
                     T"
     gene            1262248..1264720
                     /locus_tag="CND04580"
                     /db_xref="GeneID:3257248"
     mRNA            join(1262248..1262307,1262364..1262428,1262482..1262795,
                     1262847..1263105,1263152..1263220,1263285..1263319,
                     1263369..1263441,1263493..1263878,1263929..1264032,
                     1264084..1264458,1264515..1264720)
                     /locus_tag="CND04580"
                     /product="chaperone, putative"
                     /transcript_id="XM_024657069.1"
                     /db_xref="GeneID:3257248"
     CDS             join(1262269..1262307,1262364..1262428,1262482..1262795,
                     1262847..1263105,1263152..1263220,1263285..1263319,
                     1263369..1263441,1263493..1263878,1263929..1264032,
                     1264084..1264458,1264515..1264634)
                     /locus_tag="CND04580"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_024512619.1"
                     /db_xref="GeneID:3257248"
                     /translation="MPPPHLTIPSPKHLYAHLSKYVVGQERAKRILSVAVHNHYQRIA
                     SLLPPVTEQEPSPPKPPRPQPPPIILESPIPYPPTSSISYFSGSHASNFKKKERASYK
                     PSDPASSHWDPSTAGMSPQDPTITHDLLTLRSREGQWARNGYFEPLQPSTPLPTLSGQ
                     VTKRQRVTSEHDKSLSNEKTAKSYKGKTYATHNESIGNGSETPEHDDTRVVEGESVII
                     EKSNVLMIGPTGTGKTLMARTLAQMLNVPFVTCDATTYTQAGYVGEDVENCVLRLLQA
                     ANYDVGKAEIGVIHIDEIDKIAKRGGSDVGGGGRDVGGEGVQQALLRLLEGTSLTLSA
                     KAPAISSSTHNSSVSPFPPPLGGGMGSGSPSNTPKATNRAVFGDPPGWDFNNSSNKGL
                     GGKRSVREGLPGYNSNGGGTPAKGDTFVVDTSNILFVLSGAFVGLEQIINRRIGKGSI
                     GFGAPLPQLTTDFSNQSSPLKGLSTVDLTNYGLIPEFLGRLPILSTLHPLSIDDMVRI
                     LAEPNNALLKQYIKLFENYGSELCFTDKAVREIAREGLDRGGGARGLRGVLEEVLLDA
                     MFEVPGSSVRYCLITEAVVRKDCAAHYFSRGQNVAFLEAIERERLP"
     gene            complement(1264690..1267005)
                     /locus_tag="CND04590"
                     /db_xref="GeneID:3257069"
     mRNA            complement(join(1264690..1265555,1265602..1265892,
                     1265961..1266007,1266061..1266258,1266321..1266574,
                     1266672..1267005))
                     /locus_tag="CND04590"
                     /product="actin filament organization-related protein,
                     putative"
                     /transcript_id="XM_024657070.1"
                     /db_xref="GeneID:3257069"
     CDS             complement(join(1264806..1265555,1265602..1265892,
                     1265961..1266007,1266061..1266258,1266321..1266471))
                     /locus_tag="CND04590"
                     /codon_start=1
                     /product="actin filament organization-related protein,
                     putative"
                     /protein_id="XP_024512778.1"
                     /db_xref="GeneID:3257069"
                     /translation="MDKSVKVSDNLGGKVNGLAERRFGTEAFWPVTGDFPKEMDKCAR
                     ILRAFTVDGVITEEKKDEDASGSKKKKVIRKIPPAVIAKAKGLAIFTSMRSGIAPFGG
                     AGGAGVVVAKLPDGTWSAPASISPNNLSTGFLLGVDIYDCVLVINTQKALDSFKTHKA
                     TIGAELGVAAGPYGAGAAVEAGLEKAPLFSYVRSRGIYAGVEIVGQVFVERYDENGAM
                     YHWPDVKAGDILSGKVKVPVEAARLHKALKDAESGKAQKEKGSALDIVIPEGATELEL
                     NDGEVLKLPPTPDQTTGDEQESDPETERILYPSRPGSHNPSFTSIDKISRDYSPTCGE
                     PTGDAHSPNPRLTVPPPLPSRHPKRPSLEKKQSSASDYSEAANNAPSTSALEADVPPS
                     YAEAYVKVATGTEYPEERWESSLDDTNRDQMSAAEKKEWEQYLADQKSQGGHLPSSLQ
                     DGTVEGELSDRLQNQVLGSDDKNTDSLT"
     gene            1267974..1269263
                     /locus_tag="CND04600"
                     /db_xref="GeneID:3257475"
     mRNA            join(1267974..1268114,1268167..1268322,1268377..1268767,
                     1268821..1269001,1269055..1269263)
                     /locus_tag="CND04600"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_570601.2"
                     /db_xref="GeneID:3257475"
     CDS             join(1268054..1268114,1268167..1268322,1268377..1268767,
                     1268821..1269001,1269055..1269189)
                     /locus_tag="CND04600"
                     /codon_start=1
                     /product="ribosomal protein, putative"
                     /protein_id="XP_570601.1"
                     /db_xref="GeneID:3257475"
                     /translation="MSIPIGTPLRSLRPSSAARSVRSFASSVSVAHTAEPSLRPRNGS
                     VLQGESPEDAWKRNLQEARQWRQRKEYQRSTLSVYIPEGSTAIPKGRSARSPHEATLS
                     TLLASGAALGHAANITSHAYTPYIYGKRAGLSIIDLDQTLPILRRTAALVKDIVKADG
                     VVLIVGTRPGHQKMIQKAKERLEDNGFAVGQWIPGLLTNAETFFGMKPLLDKSYKPDL
                     VIFLNASENTPAIRECTSRHIPTVGIVDTDTDPRLVTYPIPANMESMRTAELIISTLS
                     IAGQEGRRLRLKEAERKASQVRASKGRRERR"
     gene            1270348..1272061
                     /locus_tag="CND04610"
                     /db_xref="GeneID:3257459"
     mRNA            join(1270348..1270508,1270564..1270705,1270773..1270915,
                     1270975..1271438,1271511..1272061)
                     /locus_tag="CND04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_570602.2"
                     /db_xref="GeneID:3257459"
     CDS             join(1270471..1270508,1270564..1270705,1270773..1270915,
                     1270975..1271407)
                     /locus_tag="CND04610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570602.1"
                     /db_xref="GeneID:3257459"
                     /translation="MRLFFVRHGQTDDNVRGIIQGHKDTPLNNYGRFESTRLAKRLSK
                     YSITEAWSSPLSRAKETTRIVLQYHDKVPLMTPDELKERGLGSMEGRRRKKGERAPAD
                     AEDYESLSRRTKSWFDKLLASHEPESSSSRHDHSSHTRYLPTPLHSNNHTRHARYSAH
                     NLPVTIDLVLVVTHGAWLSNFVRLLMSPVYHFNVREGVNLGLPCANTSIMVVNCEWKD
                     GRWNGVIEDWGNVNHLADVLDKEVQEVADDVRQ"
     gene            complement(1271496..1274171)
                     /locus_tag="CND04620"
                     /db_xref="GeneID:3257078"
     mRNA            complement(join(1271496..1271777,1271851..1272062,
                     1272118..1272212,1272262..1272377,1272434..1273007,
                     1273059..1273252,1273313..1273423,1273538..1273662,
                     1273715..1274171))
                     /locus_tag="CND04620"
                     /product="co-chaperone, putative"
                     /transcript_id="XM_024657071.1"
                     /db_xref="GeneID:3257078"
     CDS             complement(join(1271878..1272062,1272118..1272212,
                     1272262..1272377,1272434..1273007,1273059..1273252,
                     1273313..1273423,1273538..1273662,1273715..1273883))
                     /locus_tag="CND04620"
                     /codon_start=1
                     /product="co-chaperone, putative"
                     /protein_id="XP_024512777.1"
                     /db_xref="GeneID:3257078"
                     /translation="MKGSFLVALPVLFLSLSAQVFGESSIPSAAQIVHNANRLLAEGS
                     YSAAARAYGEAIELDPTGYANYYKRATAYLSMGRHNAALDDFEQILRINPGFVQAHYQ
                     RAKILAKEGDFAKAQYELKAYVQTKSDSEAEELLHLVTVGEAAEKSALQAFEKRKWQV
                     CVDHSTKALEVGPNSERLRRLRVNCATELGDINMVYGDLSRLASLDPSTTYLPLQLSN
                     IAYFIRASSQAAVHIKQCLHFDPDSKPCKTVHKTIRSLEKDAARVQNFIESGTYRQAI
                     KILDGDDGLLVRFEKALDDATKPKDGLPPYLAPQFHPKENSQMRLDLYALACKASVMA
                     NDFGEKGAHWCEETMGMNEENVDSWISRGERLLKVEKWEEAMRAIEKAFELSGRRQDI
                     LPRVQKAQRLLKQSKQKDYYKVLGVPRDADERAIKKAFRKAAKVAHPDVGGSEEKMAA
                     LNEAYEVLSNTELRQRYDNGDDPNDPTGGHQHNPFAHHGGGMPFQFFQQGGGFQGFHQ
                     GFPGGGQKMHFQWN"
     gene            1274445..1276292
                     /locus_tag="CND04630"
                     /db_xref="GeneID:3257450"
     mRNA            join(1274445..1274897,1274976..1275050,1275104..1275131,
                     1275182..1275252,1275307..1276086,1276142..1276292)
                     /locus_tag="CND04630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657072.1"
                     /db_xref="GeneID:3257450"
     CDS             join(1274562..1274897,1274976..1275050,1275104..1275131,
                     1275182..1275252,1275307..1275348)
                     /locus_tag="CND04630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512774.1"
                     /db_xref="GeneID:3257450"
                     /translation="MFNLPYHCKALLTAKQERGLTFDDVAKAINKPEVWTTALFYGQA
                     STDKSTAEAILKALGGEQFWTDYNDRLEAGQEKIDIRRVLNGLSGNGEENMGVKGMVT
                     RGATFEVPPKDPVLYRLYEVLVVYGYSYKALIYEKFGDGIMSAIDFRTSLERKKDPKG
                     DRVVITMDGKFLPYSDPSAWGTQ"
     gene            complement(1275259..1276688)
                     /locus_tag="CND04640"
                     /db_xref="GeneID:3256979"
     mRNA            complement(join(1275259..1275743,1275855..1275924,
                     1275977..1276022,1276078..1276144,1276197..1276288,
                     1276361..1276451,1276520..1276688))
                     /locus_tag="CND04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657073.1"
                     /db_xref="GeneID:3256979"
     CDS             complement(join(1275583..1275743,1275855..1275924,
                     1275977..1276022,1276078..1276144,1276197..1276288,
                     1276361..1276451,1276520..1276628))
                     /locus_tag="CND04640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512618.1"
                     /db_xref="GeneID:3256979"
                     /translation="MALIPFITTSLKAFACIWALITFAVGASFISAADDLFGNHFVTR
                     TDLTAGNAVIAGGVLTWSYFVAILVVTFIQPENVFISVMLDTIFLSIWFIFFLASVAS
                     MSTLASVFRDYDRFTWGRLGTATIGLSWVMTFLLLGILLFEVTYTLINFGRSYTTWPT
                     PAANTIVEESIDEQAVLQSVQTTPVGIAVSVLSGARPPMSVPMRGKGVDRV"
     gene            1277557..1277654
                     /locus_tag="CND04650"
                     /db_xref="GeneID:3256870"
     tRNA            1277557..1277654
                     /locus_tag="CND04650"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:3256870"
     gene            1279438..1281163
                     /locus_tag="CND04660"
                     /db_xref="GeneID:3256899"
     mRNA            join(1279438..1279936,1279993..1280142,1280202..1280762,
                     1280817..1280968,1281018..1281163)
                     /locus_tag="CND04660"
                     /product="negative regulation of gluconeogenesis-related
                     protein, putative"
                     /transcript_id="XM_570604.2"
                     /db_xref="GeneID:3256899"
     CDS             join(1279685..1279936,1279993..1280142,1280202..1280762,
                     1280817..1280968,1281018..1281090)
                     /locus_tag="CND04660"
                     /codon_start=1
                     /product="negative regulation of gluconeogenesis-related
                     protein, putative"
                     /protein_id="XP_570604.1"
                     /db_xref="GeneID:3256899"
                     /translation="MDVSPALSALEALSSSTSTSSSGPVNGLIDDHLVQAKRRIMAGE
                     DPRTVVQELQKAVVKSKKEVEKNLKAWYFALGNMGKAIDKTFPAQLSAISRAYEEPSL
                     FADKDASQALDKAVLESLGRRGLWDSVAALETETSLVFPSERRLLAEELQRITTCLLS
                     NDISPALKWCEENKSFIHSPPHPSSLPYFLHRAVFKSIEDPGHAIMYARQHMMAYLPL
                     YPVTKLITSRLYDGANKAEFKGQDTEMDETVINSFEQEDAVDLVALVAMFQSEFKRRH
                     QWPKEDPLEVAVDLGSKGGALNVIEKARRVMGEHLGHIRAWTDLPMEVPLPPSRRYHS
                     VFVCPVSKEQATESNPPKMLVCGHVIASESFERLLKGGRREVKCPYCPVETAQSAAQR
                     LYF"
     gene            complement(1281134..1282641)
                     /locus_tag="CND04670"
                     /db_xref="GeneID:3257345"
     mRNA            complement(join(1281134..1281417,1281464..1281512,
                     1281566..1281607,1281657..1281801,1281870..1281901,
                     1281950..1282040,1282096..1282112,1282165..1282197,
                     1282249..1282309,1282361..1282641))
                     /locus_tag="CND04670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657074.1"
                     /db_xref="GeneID:3257345"
     CDS             complement(join(1281257..1281417,1281464..1281512,
                     1281566..1281607,1281657..1281801,1281870..1281901,
                     1281950..1282040,1282096..1282112,1282165..1282197,
                     1282249..1282309,1282361..1282515))
                     /locus_tag="CND04670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512776.1"
                     /db_xref="GeneID:3257345"
                     /translation="MVMPTKISHADENTLSTVKEMALNTENAIALAGDAAPVVLGAGG
                     KPLPPPYKSTGNEALDTLAFLHMLEQLKIQKRSGWIREGVKQAESISDHMCRMALMAM
                     MLPNSSERPLDIPRCVMMALVHDLAEAYVGDITPVEGVPTHVKHQLEEQAMDTFLNEM
                     LGGKGNKDARERFRSLWDEYEARETPESRLVKDLDRIELALQAVEYERSQDIQTLDPF
                     FKGSIPNLEHPVTRQWAATLMEERRQLWTSRGRTHEGLGDWET"
     gene            1282810..1287514
                     /locus_tag="CND04680"
                     /db_xref="GeneID:3256954"
     mRNA            join(1282810..1283008,1283060..1286678,1286731..1286913,
                     1286969..1287160,1287214..1287514)
                     /locus_tag="CND04680"
                     /product="expressed protein"
                     /transcript_id="XM_570095.2"
                     /db_xref="GeneID:3256954"
     CDS             join(1282992..1283008,1283060..1286678,1286731..1286913,
                     1286969..1287160,1287214..1287339)
                     /locus_tag="CND04680"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570095.1"
                     /db_xref="GeneID:3256954"
                     /translation="MSRRIGLSRSSTRPGGRRSTPAMPESQESTQQLSPKVRPGIPIS
                     DQLDPLSCLTVDHEVPSLELPKFSVGRDVSPLNESVKEYADETQEGNIIWTDMESQSL
                     ADRISVKGNEEISSLLLEDSGKQLASSAAFQSLQAMDSGDRADSTKNSTITQFAAIES
                     QERPLSKIVPVGSSPQAIEQDQSREFVMVPDTQHDVATADGISPSFIPSNSLSKSFQL
                     RSNNLREPLGNEVNLQEEKRLFISVEKRPKIFTSEPSQSISPRKLEGASLFSANGPGG
                     RQTMSPISKHSSAKGLSGLENPSRSRSKSHVQASPSDEPVASRRKNETKEPNLSEESF
                     AVDSIPIKHPEPLDVIANLLRQHSEEMKGKAEKLKDGKKGPTSKFELSEKQGDELFHR
                     HEKTRIEMSEGKEFEVPQSAARISPNRLRTTIVDHDDSPGSSSSSQRTNVTFHSSHYT
                     APLEQSEPSVNVPRQINHTIDQQDGVASQSCHPLRSSPSCHGERFRSFAEQGYLFDEN
                     RLSTFDEDLFSSSQVVDGGLEVSEDAFSQRSNIFQATQVIRQPSGPLCEADLSSPAAI
                     ISPRGLAPTQRSSPDTPENSQTLRTTVTNSIPLHSSPISASVPTSKPPIPSIPPHRSL
                     AYNSRRFTAQVSTEDNGRFDIPRYRQLQRRAASRIQLNDQLMEPLASEITGSPVGLCE
                     GSIPAHSDTNTAPQPIQSPQMGHCSPNKFRRSQDIEVVNEHEPSATVESDVQTTGDDQ
                     SNLRPGRINRHSPFSPLPRSHLSSKAGLSPLSNNRISASNTSNHLLPSESDTHDDPSN
                     PFLSTYEIVPGPYERRVRKKREIFSPATCSVDRLEVTSIRSPFKVEGIDEESDSSSTP
                     DDPDDFSYRPAVKTARVSRGTGRRGRRASTSIASAFSESKQMRVPSTSPLSTFSDSDK
                     SLTPDDENDVTTRPLKKQKLHNAEAKGAKTRTTSATRTNLSSKKKARHLIGKSRAATP
                     PVVEDVNRVLASYGHYYYPARIIEPSGLRYKVIYDDNEHRECAPDKLRKLILKRGDKL
                     EAYGRHDLPTKMEVLLDWDGNERGVKCASNGTMLGFVKLRFIRIRQQIIKQQFNDRLF
                     APQIGAKSPTRSILRSPVKNFVPLVFEGMIFLILTGVEENSVEYESKSLSKLIEIRGG
                     IVAKDWTQIFEPDLHRGHFKRNLGRTPFVIPTGTRPLMTSTFMVALAKGIPVLSVKYV
                     DAAIEEGEAIDWHPYLISSGYSCFTGQMMSQIVDTSWGTKNWDAVKAGHLLKPFKGKK
                     VLFIQPRNSLSSLLTLCSTCLGAEEVRVVERVSGKELDVILDPKWDYLVIDKMGIPSA
                     LKGCKKVANVQWLKQCLVMGKALPPLLTSQDEPEKGASKIKKETSNKGNARKRVNQST
                     "
     gene            1287654..1288880
                     /locus_tag="CND04683"
                     /db_xref="GeneID:36392839"
     mRNA            join(1287654..1288435,1288493..1288880)
                     /locus_tag="CND04683"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658497.1"
                     /db_xref="GeneID:36392839"
     CDS             join(1287836..1288435,1288493..1288591)
                     /locus_tag="CND04683"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514350.1"
                     /db_xref="GeneID:36392839"
                     /translation="MLLRQSQHISRGLLSGTVQFRLASPLPHLPHLRATSTSTKPNSS
                     LPSTIASPKSTLLQRHFPALAQLSQSTNVSLPSLALSFLVLHEITAIVPAVAFYYFFA
                     YLGAGAGLVTWVTRLGHDESSKDSESEAGWKHWVRDWYQEGIKRVDRIGKKYGVLGYE
                     KQNAGEDGAAGPMQDLTARTTGAGAAEKVADAVAAYVLVKALLPVRIAVSIAGAPACA
                     RFVLLPLRKLSRQR"
     gene            complement(1288590..1290834)
                     /locus_tag="CND04685"
                     /db_xref="GeneID:36392840"
     mRNA            complement(join(1288590..1288877,1288937..1289822,
                     1289875..1290387,1290435..1290834))
                     /locus_tag="CND04685"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658498.1"
                     /db_xref="GeneID:36392840"
     CDS             complement(join(1288656..1288877,1288937..1289822,
                     1289875..1290387,1290435..1290661))
                     /locus_tag="CND04685"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514351.1"
                     /db_xref="GeneID:36392840"
                     /translation="MRIKLSLLPPFSPSRILFLVPSDVKTIAHLKKYLIKSLSSIAQH
                     ASSSRELLLEIEGFQLLSGSDLNIIEPTDVVCVRLAPGSSADSPDKFSDKKRKRNSAP
                     KLPKQTKKRRIAVSSTPLEKDGSASVEAVFGKESRKLSQPLALAIPSHVMGGRRASIS
                     SSSSSSSSSSSSSSSSTSSSSSSSSSSSSSPSSSSSSSSSSSSSPSSSSSGSNSSLDS
                     ENPPSLKDGFSSKSQQNHAQSLKVHTGNESAIRLLQLPVPPGHGKPQTRNRNARRRLA
                     RQYQKSVQDRGANVSTTGIDFNQEPSVQVSSSQFNEGTTTFTTPELPIPKDMSNKNKK
                     RGFLREMAGLRGKKTVFHADTDGASASLPDTTTEVDQSPSSAFSLGGSRNHLQSQQNL
                     SQRDWTLDGIFCGDAVDGDGHRHLSFSTSTPLRPLRNIPPSELTSLPDNIFITRTEFG
                     DSWYGKSNLGRSSNGHRNNEESPANQQWGVAEEEEEFAGEHGPESEAHDDGTETMAMD
                     KVFWESTEKKYDDLKFLDEDNLSQLRFGSILARKELVLDLHTHSPQLQLNLVKVISVT
                     TEGILIEKVDSPKEEKEEETEEHVSSQEECGFIKLDRDEIKAGSWKIVF"
     gene            1291181..1293685
                     /locus_tag="CND04690"
                     /db_xref="GeneID:3256866"
     mRNA            join(1291181..1291438,1291541..1291653,1291745..1291861,
                     1291927..1292115,1292175..1292227,1292283..1292480,
                     1292532..1292661,1292723..1292865,1292921..1293065,
                     1293120..1293685)
                     /locus_tag="CND04690"
                     /product="transporter, putative"
                     /transcript_id="XM_570093.2"
                     /db_xref="GeneID:3256866"
     CDS             join(1291251..1291438,1291541..1291653,1291745..1291861,
                     1291927..1292115,1292175..1292227,1292283..1292480,
                     1292532..1292661,1292723..1292865,1292921..1293065,
                     1293120..1293415)
                     /locus_tag="CND04690"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_570093.1"
                     /db_xref="GeneID:3256866"
                     /translation="MSAEKLEAANALSNASDSKTPSTIPDHRQVLAEEIAAMSPEEYE
                     AADKKLLAKLDRNLVPWMTLLFTMSFLDRINIGTAKLAGLTTDLNLTSLQYNTASMIF
                     FVSYVALEVPSNLVLKKFRPSRWIPLIMIVWSLFQIFMGFVTNYGQLLAMRFCLGMAE
                     SGLFPGISFFLSGWYRRKEASKRISLFFAGAVLAGAFGGIFGYALSRMDGAGGKAGWS
                     WIFIIEGLLSFVVGIASIWMVHDWPDKARFLTPLEREMVFLRLKDDTGILSEGRFSWK
                     VVRRALCDWKTPCFMLMYIGCAEPIYSQSLFSPTIIASLGSWTTAQSLLLSTPPYVLA
                     FITTMVTAFFSDRWGKRGFFLMFWSAMAAIGYLLFITIPVRFPGARYFAVFLTTCSIA
                     PCIATTIVWSGNTFGQHYKKATSMGFIFSLGNSGGIIASEVYRTQDSPRYIPGQSVTF
                     GFSCVCFIASIIMYFGLRRENRRREKLYGPPPGPGQLSEWDSEEGKKRWGLEGMTKEE
                     IADLGDDHPAHRFIL"
     gene            1294020..1295611
                     /locus_tag="CND04700"
                     /db_xref="GeneID:3257041"
     mRNA            join(1294020..1294116,1294185..1294235,1294299..1294309,
                     1294362..1294418,1294479..1294499,1294564..1294662,
                     1294722..1295292,1295343..1295611)
                     /locus_tag="CND04700"
                     /product="thiol-disulfide exchange intermediate, putative"
                     /transcript_id="XM_024657075.1"
                     /db_xref="GeneID:3257041"
     CDS             join(1294080..1294116,1294185..1294235,1294299..1294309,
                     1294362..1294418,1294479..1294499,1294564..1294662,
                     1294722..1295292,1295343..1295431)
                     /locus_tag="CND04700"
                     /codon_start=1
                     /product="thiol-disulfide exchange intermediate, putative"
                     /protein_id="XP_024512775.1"
                     /db_xref="GeneID:3257041"
                     /translation="MAGGIQNITSAAEFDGIVRSLPPSRLLVADFYAQWCGPCHAIAP
                     VLEQLAGAYKHVTFVKIDVDQQRELASRFRITAMPTFKLLKGGREVDQLRGASPPQLS
                     QLVSRHAGTAPPPTATASSGSKSQVATGEITESLLKQVISKGLNCLNEAKEHPLSSIL
                     GPEKGPRGNSYLESDVDPELLISIPFQDAVKLKAISIFSGISPSQAPKTVKLFINQPN
                     IGFDDAENEAPAQELILTPEQVKGDRIPLRYVRFQNVRSLHILVKDNQEDEETTRIDS
                     IDVYGAQGEKLDAGVTSQSSAGTGSMLEKLLASGK"
     gene            complement(1295591..1300414)
                     /locus_tag="CND04710"
                     /db_xref="GeneID:3257128"
     mRNA            complement(join(1295591..1297270,1297327..1298411,
                     1298467..1299443,1299497..1300414))
                     /locus_tag="CND04710"
                     /product="expressed protein"
                     /transcript_id="XM_024657076.1"
                     /db_xref="GeneID:3257128"
     CDS             complement(join(1295638..1297270,1297327..1298411,
                     1298467..1299111))
                     /locus_tag="CND04710"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512616.1"
                     /db_xref="GeneID:3257128"
                     /translation="MQVGPKTSDATTYTGTLTSTPGSAICSPDGSMLAAYSPDPFRPM
                     PRGFESLTSYPISTSQLAESRISLAPSKVTTPMDAIGNVPIEMASAKQSSTWRTQNYQ
                     SFNQPAASGTTLANSLDFKTPARSRISVTDHRAPPPPPIPSNMPLPPTPTFARSSTLW
                     EMSSSMHGKESMEMLLGGEEEVWVPVDEQVAGAERWGVSGRGVGIVAVVGNVACFTLG
                     LPFLLHHGRFTHIARVLYLVSLLLPSLFLLLTSYILRYRLSKSVYHRAIKGSTKSAST
                     GVTGHKSLALISESQLSLPVSISPKLTPPQAKLGSVSEIHNTKLNISRLAHRRPSLTT
                     YVAADKDGSLSHPGRITFADRSPKRRHTVYGNFTMRDLEAEEAMRKSLSRKSCDVWIQ
                     NGHAIEGGGFMSRAAEMFKPVPAMRVLVNQPLDARKRDTVKIFRGGVVSMIAKRTSGF
                     FEGRRHSILTHAEATGKTRGQYEEASTINGASSPCSPANSFRSLSATNFDTDRPISHT
                     SGHQSVNSTGEGSTLPAVQIYRATRGRMSNGPTLIFGKRMSNQRLNKAASVGEGAGLE
                     LDRLTDNVTPNLRPSVDIRSDASEEPSQCSPHTSQPDEQGNDIIEQKRPLSKQFGYSV
                     DAENSYPRAPSFDNLSFKDQSTPHQSRRPSNKHHICNQNSSVDFSRSPEYYAAESSSK
                     LLKGESAESKHSLVHKSSFGLPRLKEEDFTADVRKSFEELSRPILLYDVQSAGIDLPP
                     IPSSLTIAHLNLSPITENKEDSFSETSMILSRSCVEDMHLALQLAASSSNQNIAQEIT
                     EHVGTLQDSKGSSLASPMGTEVEDAVEEMERMMAMDTPTREDFVVSPSLSTSTAPNGR
                     LRSASDISVSTSASSAIADTKSVNCYLGGLTKDGPPIPTIPAAYRQPSDLPTVVSHPH
                     PPPLARTPSSTTFGLREQTDLRHFCISEPHPPVQRLLPKQSSDSTYSASSRIESELND
                     REQTLPLKIREYQPSKMEMKIAKQLDERNRWRSIDANNRERRAVVEKPAIRSTVQHSK
                     GSTLESTVRSSPLKPLQVIAEKQANRTSLTNPKPTSKAVKGFSVLLQDEQGGSKVSLG
                     GRSEKQKGKENAKGSKASSSSSATVCMKGLRA"
     gene            complement(1300421..1301707)
                     /locus_tag="CND04730"
                     /db_xref="GeneID:3256858"
     mRNA            complement(join(1300421..1300873,1300942..1301103,
                     1301156..1301707))
                     /locus_tag="CND04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_570087.2"
                     /db_xref="GeneID:3256858"
     CDS             complement(join(1300552..1300873,1300942..1301103,
                     1301156..1301646))
                     /locus_tag="CND04730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570087.2"
                     /db_xref="GeneID:3256858"
                     /translation="MPTAYPFRQTEPYHDGPIEVLPGVWLGAEESVGRWDIWAGNTAG
                     NTVRVVNVAQEVEDPFDAAGPGRVSGWPRPSALPAETAKRRMKLRTYPAVVGDGTRPH
                     VEYCHARWSHGELGLADLPADACLGDVLYPRAPENNEGLWRFWETIRWMEEGRQGGTP
                     ILIHCQCGVSRSATLAIAYTMALAAAGAMPQYLGHIRVMQDAYDFVKGKSCWIGPNHS
                     LVFQLVDFARNLTTLLSSHYATTPDAPIQTSFPTAAESELSEAEWARRRREFDEDEMG
                     GCTTDPSTGASDGETTGEGCMSAEEAGEEARRLDAAMLARRAATKEEV"
     gene            1301812..1303264
                     /locus_tag="CND04740"
                     /db_xref="GeneID:36392841"
     mRNA            join(1301812..1302938,1303086..1303264)
                     /locus_tag="CND04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657077.1"
                     /db_xref="GeneID:36392841"
     CDS             1302203..1302658
                     /locus_tag="CND04740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512615.1"
                     /db_xref="GeneID:36392841"
                     /translation="MPPDLFRDPLKPSNGLTLTPFHILALALCAVSLILTNLLGPNPL
                     SGPLTRLSILLVLLLLSHHFILYMLSYHSASLAKAHEEEKARMDPLVKSKIEQKKSDW
                     EYPDAHPSKFLTTREGKPRLFPFPLGLAGRGASKELWWEAGNSSHMQVF"
     gene            complement(1303302..1304619)
                     /locus_tag="CND04750"
                     /db_xref="GeneID:3256965"
     mRNA            complement(join(1303302..1303484,1303545..1303676,
                     1303903..1303953,1304007..1304160,1304209..1304324,
                     1304443..1304619))
                     /locus_tag="CND04750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570495.2"
                     /db_xref="GeneID:3256965"
     CDS             complement(join(1303431..1303484,1303545..1303676,
                     1303903..1303953,1304007..1304160,1304209..1304324,
                     1304443..1304454))
                     /locus_tag="CND04750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570495.1"
                     /db_xref="GeneID:3256965"
                     /translation="MFFLRELTHTILLHPSYFGAQLEDYLRQKLYEDVEGTCSGKHGY
                     IISVITITDIGEGKIIPSTGQAKFKTRYTAIVMKPFKGEVVDAKVVNVNKMGFFAMVG
                     PLQVFVSCHLTHSDMKFDPSVSPPCYRSNDEIIQKDTKVRIQIVGCRVEANDMFAIGT
                     IKKDYLGQIRDE"
     gene            1304852..1309562
                     /locus_tag="CND04760"
                     /db_xref="GeneID:3257382"
     mRNA            join(1304852..1304973,1305024..1305149,1305219..1306374,
                     1306428..1307331,1307384..1307556,1307610..1308008,
                     1308060..1308249,1308307..1308869,1308952..1309122,
                     1309176..1309562)
                     /locus_tag="CND04760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657078.1"
                     /db_xref="GeneID:3257382"
     CDS             join(1304858..1304973,1305024..1305149,1305219..1306374,
                     1306428..1307331,1307384..1307556,1307610..1308008,
                     1308060..1308249,1308307..1308869,1308952..1309122,
                     1309176..1309184)
                     /locus_tag="CND04760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512722.1"
                     /db_xref="GeneID:3257382"
                     /translation="MAQPPPTAPRSSLSPEKAPLRQREGRTPPPAPSAAYARRAREII
                     DDEMGVPTYKPVMDAEDDAAASASNSVATGYRRARAGTMPSNLQEAASRLTPEVDDVD
                     QPTSATTVTSETPTNPAYARTSALSPAYPQTASRPALRHTASSAANLETPAAHAPNRL
                     RSGSLTLPGAGLGDAFGHGPFSNAWLSNPGLTTAATTPARSPLGRRIQPAEEDFSFYT
                     SASESAASLGTDDLNFSTLDYLGLADVSDHLPPASMSELRSQTQRAIASSGPASRLRA
                     STVSNFARPFRPSVTSMHSFTQETNPYDNGQSEEEMLARAIENLGVYDTSSYMSNPQL
                     ANLYPPTNLFKDTHRQRASTIGALENPHRRGLNRSASYLASIPQSPMQAELAALGAYG
                     YAARSRDSSRAGRLSISSHTSRTGTPEDKGSSTPQVPTRSLWIGNLDVNATSNALFQV
                     FAPYGAIESVRMLPEKTCAFVNFMDKVDAIRARDDVLNRLGGHVSALSETAPVRIGFG
                     KIDSAPNGPTVSAVAPAPPGLVFTSGPPLSATPIVSMSSALTSIPGPGASVTVPPQTA
                     TNMISSPDQNDQTSALPTRALWIGSIPSTTSASTLLQIFTPFGPVESSRVLQNKCCGF
                     VNFERLDSAVSARNALNGRDILGSDVGPIRIGFARVPTRSPTISTAHLGLPASPSDSP
                     TKLGDALNSVLGATSVSTEQQMSVEGGGLENYRSPLVLDLVKQGVHEQVLEKGLAGEN
                     GNVSDQQMIMQVLSSQPDEDSDIKAAADARPPATYYTSIPPPADRSMRRFDTGKLKEV
                     RKKLDSGQCRQDEIDEITKDLMEDCAELSSDFIGNTIIQKLFERTSHALRIAMLERIA
                     PHLATIGVHKNGTWAAQKIIECSSTDEERAIVVNNLRPFAPPLMCDSLGNYVCAGTLR
                     FGEPFNHYVFDAMIDRMWDIAQNRFGARCMRTCLESPYTSLYQKKRISTSIILNSIPL
                     ATNPNGALLLTWLVDSSNLPGRYNLLANRFIPHIAHLCTHKLASLTVLRIITQTTEPQ
                     ASTNLVQAIFTSTNDQTLVEILSDANNGNQVIGKIIAVNTIAEDQKKQMVEAVRRVLP
                     NIKASTTPPYRMLLEAVGLPVPAGYASASPFGRNPTPQWQPNRQQQFGQTYYPYQPVN
                     GASYQAVNGLGNLSPLLIPQTMPLGQMRGNPQPGKSPRTPAARQGRLSSPGSMMSPAS
                     DPFNPFASPSIDLQYPSQGSMRMGSTLSQPPVTFDQQPAVGGLGMGGQGQGNGMMYYG
                     QQSSGW"
     gene            complement(1310014..1313100)
                     /locus_tag="CND04770"
                     /db_xref="GeneID:3257006"
     mRNA            complement(join(1310014..1310781,1310857..1310943,
                     1311001..1311377,1311438..1311656,1311709..1311872,
                     1311924..1312110,1312159..1312267,1312326..1312453,
                     1312510..1312691,1312832..1312879,1312953..1313100))
                     /locus_tag="CND04770"
                     /product="Importin alpha subunit, putative"
                     /transcript_id="XM_570493.1"
                     /db_xref="GeneID:3257006"
     CDS             complement(join(1310741..1310781,1310857..1310943,
                     1311001..1311377,1311438..1311656,1311709..1311872,
                     1311924..1312110,1312159..1312267,1312326..1312453,
                     1312510..1312691,1312832..1312879,1312953..1313021))
                     /locus_tag="CND04770"
                     /codon_start=1
                     /product="Importin alpha subunit, putative"
                     /protein_id="XP_570493.1"
                     /db_xref="GeneID:3257006"
                     /translation="MESRNLDHRRNNFKGKTQFSAQELRRRREEQQVEIRRQKREENL
                     AKRRNLQSVITDEGIESDDEASMDSTALGDVLPGMLQAVYSEDANAQLDATMKFRKLL
                     SKEKNPPIDKVIQCGVVPRFVEFLSSTNSMLQFEAAWALTNIASGTSEHTQVVIGAGA
                     VPHFIALLSSSVLDVREQAVWALGNIAGDSPKCRDYVLGEGALQPLLGLLNENHKLSM
                     IRNATWTLSNFCRGKNPQPEWELISPALTVLTKLIYSLDDEVLIDACWAISYLSDGSN
                     DKIQAVIESGVCRRLVDLLMHPSTAVQTPALRSVGNIVTGDDLQTQVVISSGALPALL
                     SLLSSPKEGIRKEACWTISNITAGSPMQIQAIIDANIVPPLINILANADFKTKKEACW
                     AISNATSGGLQEPNQIRYLVSQGCIKPMCDLLTSMDNKIIQVALDGLENILKVGEVDK
                     DAAGPGGVNKYAQYIEEAGGMVAIHNLQHHENLEIYKKCFYIMDKFFPDEEEEEADAA
                     APAVDASGQYAFQSDVAAPQGGFNFGGQ"
     gene            1313278..1316588
                     /locus_tag="CND04780"
                     /db_xref="GeneID:3257387"
     mRNA            join(1313278..1313880,1313934..1314009,1314062..1315309,
                     1315377..1315588,1315660..1316060,1316129..1316588)
                     /locus_tag="CND04780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570413.2"
                     /db_xref="GeneID:3257387"
     CDS             join(1313296..1313880,1313934..1314009,1314062..1315309,
                     1315377..1315588,1315660..1316060,1316129..1316285)
                     /locus_tag="CND04780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570413.1"
                     /db_xref="GeneID:3257387"
                     /translation="MGRDSTNTDRDTHRHGSRHDRHDRPHRHRTHRDRDKQDADQIEE
                     EQRRERKRLKKERRTDDDHTLQVLDDDPSMWVEKSLDPTNAVANIPTADSLPLTSNPS
                     GPKVSLPLSTATGSEGRQRDSWMLEPSVSSAIVPTPRDDVPHSAVKSAADTADRYGDG
                     QPDDRTSVSNVDLFSSMGIEHKRKDPRSDKPDPSQLVVDDRFELNTQLLEGKNVDEYE
                     VKEKKTTFGGPGYQWRMMKLKRLYEQAEEQSRPVEEVALERYGSLDEFNEALEERRYL
                     DDREARRKSRGVSRPVGPSSDSSRPTTPSGNSSGMRTPDAGRRFMFANRTTGEQTFGT
                     GGGSGNRPGSRTGFRRPGEDLEQGTTPVSSAGRLDTLRRDNGGLGTPKLESGVRSGSS
                     GVVPMKVGTPIPSVFTPTTLTRSFTGPSPPGPEHESGAVDPTSSKPPLSTEQLNKLQA
                     AVLRSKLMDDPNASALEDEYEIERERSERAHAGVGAGAGLWEGNNEGIQGQLGRMDEK
                     GNRIEVQVLPTLDGRGKLYDVGTGKEDESVVRPGNRKQKDAKFETRDKQGNLLRYNAD
                     DDIQSLGELVRQERFGAGSSDQKNLDAEMARAIATDGKFEDDLDYMDDNADKLARKKM
                     KSDALKRAFAINDYARTKKALDTCPLCYQDDRPPQTAIVALGTRTYMCCTQYEELVPG
                     HCLIVPLQHHLSMLEMEDDDWDEVRNFMKCLMRMHAQSNHGVIFFETITSFKSQRHSY
                     IEAIPVPFDIFQDLPAYFRESILSSEGEWTQHKKLIDFSSRPGGFRRMMVPNLPYFMV
                     QWDYKGEKGYGHVIEGIKDSGAGGGEDEEGDVGGAMSESEFPRYFAQEVIGNILGLEA
                     RKWRRPRKMDVALNKERARKLGTLFQPYNWTVGNGV"
     gene            1316811..1318837
                     /locus_tag="CND04790"
                     /db_xref="GeneID:3257385"
     mRNA            join(1316811..1317013,1317078..1317337,1317389..1317776,
                     1317827..1317909,1317957..1318364,1318417..1318837)
                     /locus_tag="CND04790"
                     /product="aerobic respiration-related protein, putative"
                     /transcript_id="XM_570415.2"
                     /db_xref="GeneID:3257385"
     CDS             join(1316906..1317013,1317078..1317337,1317389..1317776,
                     1317827..1317909,1317957..1318335)
                     /locus_tag="CND04790"
                     /codon_start=1
                     /product="aerobic respiration-related protein, putative"
                     /protein_id="XP_570415.1"
                     /db_xref="GeneID:3257385"
                     /translation="MSAPATSEAGPSSTNPPSVEGKKQPVVILCIGMAGSGKTTLMQR
                     LNSHLHSKNTPPYILNLDPAVTHMPYSANIDIRDTVDYKEVMKQYKLGPNGGILTALN
                     LFTTKFDQVLGYVEKRAETVDYILVDTPGQIEIFTWSASGAIITDAIASSLPTVVAYI
                     VDTPRTASPVTFMSNMLYACSILYKTKLPFIIVFNKIDVQPHEFALDWMTDFEKYQEA
                     LNDKSRDEHGEGSYVNSLMSSMNLVLEEFYNNLRAVGVSAMTGEGMKAFFSAVEEARK
                     EYETDYKPELDRLAAERAAQTEADKKAQLERLMRDMNISDSPRSGPGGNPFGPHARND
                     REDRYYDDEGEASDIDEQEQEAIRRQMEEEEEDAEAEELGKLDVEEPEIGSLAGGAAA
                     AAASRGVTWPAPR"
     gene            complement(1318339..1319343)
                     /locus_tag="CND04800"
                     /db_xref="GeneID:3257355"
     mRNA            complement(join(1318339..1318824,1318877..1319100,
                     1319155..1319343))
                     /locus_tag="CND04800"
                     /product="guanylate kinase, putative"
                     /transcript_id="XM_570490.2"
                     /db_xref="GeneID:3257355"
     CDS             complement(join(1318431..1318824,1318877..1319100,
                     1319155..1319190))
                     /locus_tag="CND04800"
                     /codon_start=1
                     /product="guanylate kinase, putative"
                     /protein_id="XP_570490.1"
                     /db_xref="GeneID:3257355"
                     /translation="MSRPINPDVVNRPLVICGPSGTGKSTLLKTLFESQPDTFGFSVS
                     HTTRKPRPGEENGREYHFVTKEEFMEGVGKGEFLEWAEFGGNCYGTTFAALTALHPRR
                     CILDIELQGVLQLKAKAPLQTPPLEPVFLFLSPPSISQLKSRLSGRGTETDASIRKRL
                     DAAKEELRYAKEGKYDVYVVNDDLKVAGEKLEKVAMGWEGWKTCGDVLPELNLAELD"
     gene            1319590..1322180
                     /locus_tag="CND04810"
                     /db_xref="GeneID:3256997"
     mRNA            join(1319590..1320100,1320155..1320441,1320492..1320803,
                     1320852..1322180)
                     /locus_tag="CND04810"
                     /product="expressed protein"
                     /transcript_id="XM_024657079.1"
                     /db_xref="GeneID:3256997"
     CDS             join(1319599..1320100,1320155..1320441,1320492..1320803,
                     1320852..1322102)
                     /locus_tag="CND04810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512614.1"
                     /db_xref="GeneID:3256997"
                     /translation="MTSHPFPSLHRQRPPAMDDNHFHLQDHEHTPNHDDTAEALIASL
                     KAVINDPNSHNQQPSDVHDHEADSESSQQPQHHEQAQNTLTAFTAEHHSNPLHVGLRK
                     SLAQLTHLTNAHQGLLDELNGAGAIQNLAQNLKALKEGNKRQIDVLKELTAQIKASEL
                     GVDLSVPFSEQLDPELSPVVLRSDYDALKAQYDALLVSGSPSSAVAGKRPGAPRKSRA
                     PKSVTTITTIEPETLRAVEDDKRASHSSTPTGGVEGRKKRSIRLEHLVHKMANRRLGV
                     EYTVSNFESKGSRDLPDPATHPLTAEESPNGVDEFRPHFGADINASTVKPFIDKVIED
                     VWEAWQSGQGDEDVEADKQKVFDAVKIYWTRLSKRYDEQQHRERGEIHRDELSRRKQN
                     TYRRQQSLLMRRTAHFDWSPLNACRLRALYRTLLTIDFAAQTQDQPDPKRAYTPEEWY
                     AYRRLACGPRFGEAHEVIDQFWLSPAVRTLLLILDEFAQDQQARAKKKGKPKQPNPIF
                     HLPAHLWDRSTLPTLRPKDNDGLPLSGSPGIILFKFHVDEQVQRENPDWAKGLYDNPP
                     IPPEDEALPKLSDLLSQPVYAGLRQIVHEAKDRANPKVLTNEQIEQINSGVDLSLLEG
                     LNVPPAGLEGEGEYMTFAALTQLASNSEVNSSRPSGLPEQLVVHDDAPSTPNHSHVHS
                     AFPSSSITAATPLATHIPGVGPSPIPLPYTGTDASSAARSGTSMRARKLGKRAASEFP
                     GGAATPVPKRQRIVGALENEGEEDRDAEVEVVLGGDAAFLEEI"
     gene            1322357..1322449
                     /locus_tag="CND04820"
                     /db_xref="GeneID:3257461"
     tRNA            1322357..1322449
                     /locus_tag="CND04820"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3257461"
     gene            1325097..1326940
                     /locus_tag="CND04840"
                     /db_xref="GeneID:3257391"
     mRNA            join(1325097..1325386,1325473..1325562,1325605..1326095,
                     1326147..1326420,1326471..1326940)
                     /locus_tag="CND04840"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_570417.2"
                     /db_xref="GeneID:3257391"
     CDS             join(1325228..1325386,1325473..1325562,1325605..1326095,
                     1326147..1326420,1326471..1326707)
                     /locus_tag="CND04840"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_570417.1"
                     /db_xref="GeneID:3257391"
                     /translation="MAENNEKITAETTTSKHEPRTSGTRYLKLSRLPTLQEVLDRRTR
                     PPLDLFCFYIFLQRELSEDALDFWLDVQQHENLCKAYFKDIRRSGRSIQDEWPEFAEY
                     ARANGTHFAPLLSLPSEPPSPSPASPDLGSYIASPVPGSTDFDFSRSPVLDTRARRDT
                     ESHGRPAQHSTLSPTRINSQAQRGERQRDRPSTAPSQEMSLKGKRKSKAPTVIARDRA
                     IEKNALLESAERIFYRYLFDGGEREIYLPPSLRVYNFPESISGDVSPLIPDLFHAQKV
                     YVFKALEQDAFPRFLRAKAFANLTPLGSIVRLVAGLFCLWGAFVLAFSLIFLDFKPRL
                     TRLWLILPFLFGFVLLLSSYYSLSPLLFACNVSETTPFHFIRVREPYVRKLIAIRAGI
                     IVGASVLLTVIFVVIFTVVPGHRL"
     gene            complement(1326924..1329883)
                     /locus_tag="CND04850"
                     /db_xref="GeneID:3257354"
     mRNA            complement(join(1326924..1327369,1327446..1327552,
                     1327607..1328661,1328729..1329061,1329110..1329481,
                     1329543..1329639,1329698..1329711,1329760..1329883))
                     /locus_tag="CND04850"
                     /product="expressed protein"
                     /transcript_id="XM_570488.2"
                     /db_xref="GeneID:3257354"
     CDS             complement(join(1327005..1327369,1327446..1327552,
                     1327607..1328661,1328729..1329061,1329110..1329481,
                     1329543..1329639,1329698..1329711,1329760..1329819))
                     /locus_tag="CND04850"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570488.1"
                     /db_xref="GeneID:3257354"
                     /translation="MAAPPPEVYLAEGFDPSTLRVPQLRSVLLAHGKGYPSRFTKAEL
                     VQEFITHITSQAPDLRSAAANVQPSNKGIISVSDNGDETPAVPIKRPRKSRRVAAEPV
                     SAQADEAEPGMVIEVEPDRPEPPIKKMRPKAKNVVVELEQSPAKRKSRMGKQPIIQVE
                     NADRETEAELKVGPTIELPTSSRRTTGGRASGTPGPSAFATEAPSSSLGTEKFRTPNA
                     ARTTSQPHSTRKSESTAKSMDHVQKESEKEDEMWQISKARASRRSDGEQSSFSDFNPF
                     QSGSEEAAERERRRRKSSIGLGSSNKLKTTKPRSSEPVPAYVTTPPGILRRVGPSRDN
                     IRTPLSDVKRAMHSGSDLDAAVAYNQEVQEKLNRISASHTRDGRDETEVTIHSSISSF
                     HGPKSLAKRVNDQINQTVPAPRATLPLSVLFLLLLTFISNFQKQSSSIGFCDTGLNTN
                     EIALHRQASRSEAEACLLDKAKLDMVDKDAATKIVCDTTNLPLIPFLPVPTGCTACPA
                     HAQCSHGEIVSCAPEYKLVTHPMSFLSPLANGFPGIGPRPFPPACRPDTAKKRLIGAL
                     AKAVEKSLAQHRGDIICQSLSLDQGEVERYGVDEEELRERFSGQKNSKLAREAFDELF
                     SAAIKDLVEHEDLVVFIDVENDKTSYAAARTELTLACRAKLEATDLLHRWKSQLGSTA
                     AVLLAIAYIRSEVNRRKQEKYRAEELVQVALKRLQDQEQLHYTDPVTNPQPFIPRDQL
                     RDLVMPHTGSTASRLRLWARVLDMVERNANVAVRDQELKGEIWKTWEWAGVGERHVTW
                     EQ"
     gene            1330130..1331759
                     /locus_tag="CND04860"
                     /db_xref="GeneID:3256939"
     mRNA            join(1330130..1330269,1330352..1330417,1330490..1330618,
                     1330685..1330788,1330854..1330979,1331035..1331142,
                     1331196..1331291,1331345..1331493,1331550..1331759)
                     /locus_tag="CND04860"
                     /product="septin ring protein, putative"
                     /transcript_id="XM_570079.2"
                     /db_xref="GeneID:3256939"
     CDS             join(1330206..1330269,1330352..1330417,1330490..1330618,
                     1330685..1330788,1330854..1330979,1331035..1331142,
                     1331196..1331291,1331345..1331493,1331550..1331676)
                     /locus_tag="CND04860"
                     /codon_start=1
                     /product="septin ring protein, putative"
                     /protein_id="XP_570079.1"
                     /db_xref="GeneID:3256939"
                     /translation="MTSLVSSPPEGIAAASYVGFDSITRQIEHKLLKRGFQFNVMVVG
                     QTGLGKSTLINTLFASHLIESKGRFEPDIVPRQTTEIAAQSHVIVENGVRLKLNIIDT
                     PGYGDNVNNEGCWDPIIKYIKDQHSAYLRKELTAMRDRFIPDTRIHCCLFFINPTGHT
                     LKPIDIVVLKKLTEVVNVVPVIAKSDSLTLEERTLFKQRILAEMHHNQIRMFPFDSDE
                     LDEEELQLNERVREMLPFAVVGSERSVIIDGKPVRGRKNRWGVINVEDERHCEFVYLR
                     NFLTRTHLQDLIETTAQVHYETFRSKQLLALKESSAKAQQASASTA"
     gene            complement(1331940..1333864)
                     /locus_tag="CND04870"
                     /db_xref="GeneID:3256963"
     mRNA            complement(join(1331940..1332266,1332321..1332415,
                     1332478..1332915,1332972..1333133,1333194..1333864))
                     /locus_tag="CND04870"
                     /product="delayed-type hypersensitivity antigen - related"
                     /transcript_id="XM_570486.1"
                     /db_xref="GeneID:3256963"
     CDS             complement(join(1332134..1332266,1332321..1332415,
                     1332478..1332915,1332972..1333133,1333194..1333349))
                     /locus_tag="CND04870"
                     /codon_start=1
                     /product="delayed-type hypersensitivity antigen - related"
                     /protein_id="XP_570486.1"
                     /db_xref="GeneID:3256963"
                     /translation="MFSSTIATLLFGTLFSLPVIFADTPYLGCVLTTAANGAASVSSR
                     QSDSATCVSSCGNSNYPYAFWVGAIVLGNNCYCVSEANYISAANYVVPTGSSTACVAI
                     VQAASYATSSTFSYENCYAPSGLVSGVINTVTGVLGTTVSSPRACFELCAGTSDAYFT
                     PYLLGGNTLSPRYGCSCGDETVVSGSPSYCGLGSFYAYSHPAAAAASSLPRRKRAIER
                     IQAQKRSEMIRERQWDCPTGMSACNVDGVTNSWECVDPTSDIESCGGCTYGEYSASGN
                     ASESTGVDCTALPGVLRGSVTCSGSRCEAFACKRGWTLRNGECTKSVTLQL"
     gene            1336601..1339458
                     /locus_tag="CND04880"
                     /db_xref="GeneID:3257259"
     mRNA            join(1336601..1336810,1336863..1336899,1336950..1337022,
                     1337085..1337155,1337207..1337368,1337416..1337908,
                     1337963..1338393,1338453..1338617,1338679..1338690,
                     1338750..1338807,1338859..1339105,1339155..1339276,
                     1339339..1339458)
                     /locus_tag="CND04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_570077.1"
                     /db_xref="GeneID:3257259"
     CDS             join(1336644..1336810,1336863..1336899,1336950..1337022,
                     1337085..1337155,1337207..1337368,1337416..1337908,
                     1337963..1338393,1338453..1338617,1338679..1338690,
                     1338750..1338807,1338859..1339105,1339155..1339276,
                     1339339..1339382)
                     /locus_tag="CND04880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570077.1"
                     /db_xref="GeneID:3257259"
                     /translation="MSVSFTDPDLKPTYEALIQGSAAYDWVLFNQPGNELKLQATGNG
                     LEDLEEEFMDGRIQYAFARIRDPTSKLDKFVLISWCGDGVPEFKKGLYFTQSAQVQNK
                     FLKDAHLVIQARSELDVAPSHIHKRIQESSGSKYSSSAAAAPGINAASSVKPAPSYRP
                     SQGLGGSQGKPTAVATPTSTFRAPSPQHAPAANAVAPSRLPATREDKPINSGLKSSPT
                     TAASGPAKTSASTISASEPAKPVAEDRITPVGTAYTPIKLQPGKLTGRWNPGGIQEER
                     SEESPVKIPSIKDRMAAFSGGHVSTPVLPQPSGNKLTWSARQAEAKKQREEEEKESAA
                     ASNDKVISPAPTGSRAMPPVPRPSMPVTSSDLSAAAPSPPSASATISPPSAPAAPVPD
                     ASAMPSVIRSSVPPRAASPDSDEEKSDDDDWGAPPPPPPPVPFKPEPVTEIEPDAPVA
                     AQPPPPPPPPPPPPPPAAPAQPANSSDPQVDELERLKQDLTLVETPITGPPPPIPEAS
                     RPRTIEPASEPSPAGKRAKVLYDYDAAEDNELSLREDDIITQIEQLDEGWWSGTNADG
                     QSGLFPANYCELIEDDSAPAANPQYQVEPEAELETEPTIIDASPPSPPPPPPPPPPPA
                     SSSYAKDTVMIAAYDYDASEDNELSFKEGDQITDIEKIDPDWWQGKCNGQEGLFPAAY
                     VVSPDEYPPQD"
     gene            complement(1339579..1344184)
                     /locus_tag="CND04890"
                     /db_xref="GeneID:3256921"
     mRNA            complement(join(1339579..1341473,1341535..1341756,
                     1341810..1341978,1342064..1343945,1344049..1344184))
                     /locus_tag="CND04890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657080.1"
                     /db_xref="GeneID:3256921"
     CDS             complement(join(1339679..1341473,1341535..1341756,
                     1341810..1341978,1342064..1343936))
                     /locus_tag="CND04890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512739.1"
                     /db_xref="GeneID:3256921"
                     /translation="MSSKSQQPPTGLSKSAAKKRAKKAAKQSQNPQPQSAPQTSSQTP
                     ASVPPLPPASVPDPLDPAFFNFPGPGSYPIDVQYDDTAYYDQVDVPLNQGDFPGSYSI
                     DYNLSLQNGSQLAGLSAPFNITHDDLISAANELYKRMADPEFGSDDAYWSSLPPHIRQ
                     FIRDAVPFTGSISQSTPGTTSSQRTMYQMAQQIVQAASQGMGLGHGMSANLMPGINAN
                     ARSFPSPQQTIGEEFGFHRHPDTREEEYDDEEEIEEDQGHPAANGDAPKKKNKKKKKK
                     GANAASLSAPVEPPAPLPPLPPPSTLSKIPRAPAPVPQPQLPTHQPQPLSQQPPSLNP
                     LPPPAPASAPTPTPPSSRAAGKQPMGTNPPANPPARSARAAGKAPASAAPPHNAHAGH
                     SHNHPSTAKPAPKGKSPATAPPAKIWTQSSAEDRENIRVFWLGLSEAERRDLLRIEKD
                     AVLKKMKEQHRHSCGCAVCGRKKVNIEMELDQLYEQYYDELRSYAAEQRVAANGLRPP
                     PSGAGPFPGSVEVDASGTVTQYDHRAPELHDHDPDDLDGEESEEYDDDDDYADDDELD
                     DDDIGTDEADVGDEIDEPPPPPPITHRQQPRRPPVKAPPRSEGGDDFLSFGSNLATIK
                     GILTIADDMLKNDGTKFLEMMEQLAIRRSVREEQNLRDMQEETDEEEEEEDDDESRDE
                     PMTEKERAEEGKRMFQIFAARMFEQRVLQAYRERVAKQREEQLLRELEEEEDSKRAKE
                     EKKAKEAQKKKDKKKAQKQKAEEERLAREAALEEEKRQAKLRKEEAERERMRRQDEER
                     VRREAVKRAAQEEAQRQALERKRRQQEEKEREEEAAKKKREREEKAKKEREARENELK
                     EKERKEREIKAAKEKAEKERIAKETLEKAERDRLAKEAKEKAEKIRQERLEASRMEKV
                     RKEEAARKEREAVEQAKIIAAQQAQRERAAKAEKNTADKAAAERISAARVIPVAATAP
                     VLATLGLKSPSKGSTPQSAPPVPQLSPVKGAARPITNATPGRSMQKTPTAYYPQPVPP
                     VGVASFSRMPLAQSFGPPGLRPAYPTGSPAYSPPRANGSSISPNPPSRGFTDPSPPGF
                     DHNLRTAPIGVGFPPVKPSGRIPSMADDAFSPTAPIGVPVTRSVSSAGEMGSLISGSV
                     TPDDYRPTPPAPIAPPNLGPIGRPSFSDGQTSGPNVLRSTSPPPPDRVLGSAALGADD
                     EIVQPQQRRPTTSWDMPTAAPGSGRWSASPSIWGSGDPTPAPSWGAPGSMPTVAERPG
                     PPPGLSLSPGAGVNVLGQRQPSFGGIGSSFGGVGAVGSVIGGGMGGTAGSGLVQGHVG
                     GGGYSQGLFSPQHQQQQQLQLQLQLQQQQQQQ"
     gene            complement(1344786..1348995)
                     /locus_tag="CND04900"
                     /db_xref="GeneID:3257027"
     mRNA            complement(join(1344786..1345265,1345331..1345390,
                     1345437..1345511,1345560..1345740,1345790..1345895,
                     1345948..1346161,1346209..1346272,1346318..1346638,
                     1346686..1347256,1347303..1348151,1348199..1348525,
                     1348580..1348995))
                     /locus_tag="CND04900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570481.2"
                     /db_xref="GeneID:3257027"
     CDS             complement(join(1344811..1345265,1345331..1345390,
                     1345437..1345511,1345560..1345740,1345790..1345895,
                     1345948..1346161,1346209..1346272,1346318..1346638,
                     1346686..1347256,1347303..1348151,1348199..1348525,
                     1348580..1348908))
                     /locus_tag="CND04900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570481.1"
                     /db_xref="GeneID:3257027"
                     /translation="MNYNPLHLLPLPPTALDPKPIPTSLTLDPFSDVLWVGASSGIVS
                     ALCSPLTLARNVHFPAHGCKIGGGGFSAQGVSAVREVRVTDRDVWTLTEGGIGGRKRG
                     GAPKWIVSDVTRSLRTMSPNPTNSHELITGGSGSLLLANTARGEVVRSIENSSPVVKL
                     APLHRTVLAAGLSGQVTVLDPRTGFKAAQNISPVQAHTGGLSGADVQGNIVATWGWTH
                     MQGHPLPDPLIRLYDVRALRPLPPISFSSGPAFVLLHPSSSSHIVVSSQQGMLQTIDM
                     SLGPSATVFQQLDVSSYITSMALSSRGDYLAFGDGDGQLHVWTTNETGENAAVDENGS
                     IVLPPFNGYDGVKPEWPDQVDPLPTIAWEESTPLNLVGMPYYNEALLSQFPSECYATS
                     TSPLFNPPATIPQPVLSSMKMVDFVGYAPNPKELRGKRYVLRAVPGAEGRARGKGRRD
                     SGPRFRSEKDKKGTYKDKEEIEEELNDGEVPKYYRKVEIKYSKFGIEDFDFEFYNRTN
                     YSGLETDILNSYTNSLLQALHYTLPLRAIATAHICVDCKKEHCLLCEAGFLFRMLEDA
                     KGRNCQASNFSRAFSATSQAYALGLMDENTNSKSTAPYGSLIQNFNRWLLSTFSTESI
                     VDGETFHLRPFPQKTSGLDGLSMNDGPSAIDQVLGVKIKTTNTCRHCGFVSSRDSTLH
                     VVDLVYPKKMNPRLSFSDILRSSLIRDSTTKAICSSCKAFAPLDSRRSLSPSSGHPLP
                     PVLSVNAMVTNSDVYGFWKDKKDVKEKDGVRRFLPKRVTIREVGKLENGQEEGVKYSI
                     RSMVVQIQESPDAVAHLVSFVKMPSKDGSSAWIMFNDFLVRPVSEDEVLSFPDQWKVP
                     AVIILERENAEELLNLEVLPKELDREILFKDVSIAWNRKQDMIKHKILQREEMPKRGT
                     LVAIDAEFVALQQEEMEFRSDGTKNILRPSHMSLARVSVLRGEGEMEGKPFIDDYIHT
                     SEAVVDYLTEFSGIKAGDLDPNNSPHTLVPLKVAYKKLRLLVDLGCIFVGHGLSKDFR
                     TINIFVPPEQVMDTVLIYTLPGSQRKLSLRFLAWYLLHQDIQTNSHDSIEDAHFALLL
                     CKLWMDYASESEEAFEIVMEDIFAEGKKLAFKPPSSAGNMMAEQQLSPVSFPPLSNGD
                     QTVARAVVKSRMATPPPPTKLGLPQWASQNSPSPLRR"
     gene            complement(1349094..1351202)
                     /locus_tag="CND04910"
                     /db_xref="GeneID:3257178"
     mRNA            complement(join(1349094..1349494,1349544..1349786,
                     1349840..1349866,1349920..1350011,1350069..1350210,
                     1350261..1350304,1350354..1350607,1350669..1350909,
                     1350968..1351202))
                     /locus_tag="CND04910"
                     /product="metalloendopeptidase, putative"
                     /transcript_id="XM_570075.2"
                     /db_xref="GeneID:3257178"
     CDS             complement(join(1349292..1349494,1349544..1349786,
                     1349840..1349866,1349920..1350011,1350069..1350210,
                     1350261..1350304,1350354..1350607,1350669..1350909,
                     1350968..1351104))
                     /locus_tag="CND04910"
                     /codon_start=1
                     /product="metalloendopeptidase, putative"
                     /protein_id="XP_570075.1"
                     /db_xref="GeneID:3257178"
                     /translation="MTRSPVALLDGVISHLAHLADNRAIDYRFIVVLSTWLQTAFEVY
                     ILRRQLPCYDRPAPPPALKAHLEGDTFRKAQTYSRDKTRFQLLQLVFNQILGWIMIKS
                     GAYSKLWDVAGRFTNLLGLGPNWIIVRSLVWITILTLSTAIPGLPWSYYQTFVLEEKH
                     GFNKSTRTLWVMDTLKSYLLFALLGLPVLAGFLKIIELSGKSFVPWLMLFLVCVQLTL
                     QIIYPTFIQPLFNKLAPLPAGELRTKVEALASQLGFPLKHLYVIDGSKRSSHSNAYFY
                     GLPWSKHIVIYDTLIKDSTTDEVVAVLGHELGHWYYSHPTKLLFGTQIHLFLTLLVFS
                     VFINNQSLYAAFGFNPELAIAAPQPFCIGFILFQLVLEPTDAFVKFLMHAQTRKYEYQ
                     ADEFAVNLGKKPDLASALIKLHVTNLSSPHSDWLYSMYHHSHPTLPERLSAMERFESN
                     KGEVEGKKDL"
     gene            1351352..1352432
                     /locus_tag="CND04920"
                     /db_xref="GeneID:3257044"
     mRNA            join(1351352..1351537,1351614..1351714,1351767..1351837,
                     1351889..1352432)
                     /locus_tag="CND04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657081.1"
                     /db_xref="GeneID:3257044"
     CDS             join(1351394..1351537,1351614..1351714,1351767..1351815)
                     /locus_tag="CND04920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512611.1"
                     /db_xref="GeneID:3257044"
                     /translation="MAQGAGKSIKAKGKSGGSQRKNTGKTKPGKREVAPKDRQRVLER
                     SQKKQLSSKINNSIEKQMVQAASVGKLSIMRNVGELESGEGKDGKAKGKGKSR"
     gene            complement(1351864..1353932)
                     /locus_tag="CND04930"
                     /db_xref="GeneID:3256992"
     mRNA            complement(join(1351864..1352187,1352252..1352353,
                     1352415..1352441,1352498..1352509,1352564..1352748,
                     1352813..1352952,1353001..1353116,1353175..1353232,
                     1353289..1353326,1353384..1353440,1353497..1353518,
                     1353586..1353680,1353736..1353932))
                     /locus_tag="CND04930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570479.1"
                     /db_xref="GeneID:3256992"
     CDS             complement(join(1351961..1352187,1352252..1352353,
                     1352415..1352441,1352498..1352509,1352564..1352748,
                     1352813..1352952,1353001..1353116,1353175..1353232,
                     1353289..1353326,1353384..1353440,1353497..1353518,
                     1353586..1353680,1353736..1353886))
                     /locus_tag="CND04930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570479.1"
                     /db_xref="GeneID:3256992"
                     /translation="MDPISDPSTQESPHPVQALPEELGKPLEDSLDHIVSNSKAVRGA
                     RKDQLAPSELRSDAVHSHGPEAKHWIAKFFPSEETLDHLFAMEHMGNYVIDRMTGKKF
                     FETMPIYVRVGMHLLFVSGNSYMSYASVEKLLREKSIKQGQTYDQTGPDVEEHIRSFI
                     RTYELPLDELLVKDLSQYPTFNSFFSRRLIASARPITSVGDPTIIVSAADCRLTVYQT
                     VDQAKKFWIKGQQFTLPNLLTGKDVADMTFKAVQDDREAALSIHRLAPQDYHRFHSPV
                     EGMIVAIKDIDGELYTVNPQAINEDLNVFTLNKRSIMLIHANLGSGRETVPIAFVAIG
                     AMLVGSIGWSKKPGDKVCKGEELGWFQYGGSTTITVFPKSAGVEFDKDLVENSKKQLE
                     TFVRVGMEIGKCSTEVK"
     gene            1354087..1355148
                     /locus_tag="CND04940"
                     /db_xref="GeneID:3257398"
     mRNA            join(1354087..1354226,1354281..1354960,1355021..1355148)
                     /locus_tag="CND04940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570419.2"
                     /db_xref="GeneID:3257398"
     CDS             join(1354109..1354226,1354281..1354960,1355021..1355122)
                     /locus_tag="CND04940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570419.2"
                     /db_xref="GeneID:3257398"
                     /translation="MATAGPSRRPDGRTPAQLRPLHLSIGELDRADGSARFAFGSNAV
                     LASCSGPIEVRLREELPDKATFEVNHRPLEGVGATPSRALVTTLETIFPPILSLEKHP
                     RSLVQLVVQSLVPSTGRVVYGSVFGAEGVGAEQNTWPATDKDDYAYIPESRKDAARIS
                     PAAGYTFTARAASINASTLALLSAGTISILALPVAVALVVTTKGRVMLDPEADEEKQA
                     KARLGFGWAWGAVFGTANEENNMGVAGQNDGGAELVWIESEGSFTRQEWSEALQMSKT
                     ASKAILEFIRIQLDAHLSSHQLS"
     gene            complement(1355113..1357012)
                     /locus_tag="CND04950"
                     /db_xref="GeneID:3257428"
     mRNA            complement(join(1355113..1355546,1355609..1356074,
                     1356123..1356205,1356259..1356351,1356413..1356550,
                     1356606..1356789,1356838..1357012))
                     /locus_tag="CND04950"
                     /product="hypothetical protein"
                     /transcript_id="XM_570069.2"
                     /db_xref="GeneID:3257428"
     CDS             complement(join(1355150..1355546,1355609..1356074,
                     1356123..1356205,1356259..1356351,1356413..1356550,
                     1356606..1356789,1356838..1356958))
                     /locus_tag="CND04950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570069.1"
                     /db_xref="GeneID:3257428"
                     /translation="MRATIRFNQAAVRHTAVPRTSATAPTPYSWMDPSPTVKADGPLS
                     GMTIALKENISYSYAPTTCSSVALKDYKPPFDATCVSSLVAAGAQIVGMTKMDEFGMG
                     SLTTNLPPYYSPVYNPASPSPEEPPRSAGGSSGGSAAAVAEGSCYAALGTDTGGSVRL
                     PASYCGVVGLRPSYGLISRRGVVAYGDSLDCVGVLAREVDAVERVFNVISHPDDNDMT
                     CASTRSRSQALSILKAHLAILPTTAGPLSGCRIGVPRQASLPPPYINTPRSLLSHLQS
                     LGATLHPVSLPSLPKTLPAYYVLASAEASSNLGRYGGSWFAGQAEKTVGKRTEESGIQ
                     RRIRIRSEGFGIEVKKRILAGTHVLSADEFNNTYLKALYIRRCLKKDFQAIFRIPHPL
                     SPSPALPSPDAVDFIIHPTAICTAPKINPTGEDSDQTEATYIQDLLNVPASLAGLPAM
                     SVPAGKGPDGWPIGVAITGQWGMENLVFKLGKVIEEWNKTQSL"
     gene            complement(1357615..1360595)
                     /locus_tag="CND04960"
                     /db_xref="GeneID:3257275"
     mRNA            complement(join(1357615..1358121,1358174..1358270,
                     1358322..1358379,1358431..1358515,1358564..1358637,
                     1358697..1358702,1358767..1358873,1358925..1359065,
                     1359115..1359167,1359225..1359319,1359381..1359474,
                     1359534..1359561,1359611..1359653,1359708..1359753,
                     1359802..1359855,1359912..1359957,1360010..1360022,
                     1360077..1360595))
                     /locus_tag="CND04960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657082.1"
                     /db_xref="GeneID:3257275"
     CDS             complement(join(1357778..1358121,1358174..1358270,
                     1358322..1358379,1358431..1358515,1358564..1358637,
                     1358697..1358702,1358767..1358873,1358925..1359065,
                     1359115..1359167,1359225..1359319,1359381..1359474,
                     1359534..1359561,1359611..1359653,1359708..1359753,
                     1359802..1359855,1359912..1359957,1360010..1360022,
                     1360077..1360300))
                     /locus_tag="CND04960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512727.1"
                     /db_xref="GeneID:3257275"
                     /translation="MSWSDPEKLLATTSRTSVDSNRFVANTSDADMPDTMPDHKHAAA
                     EQIAAMSREEFQAMEKQLLWKMDLKLIPWMTLLYLLSFIDRVNVGAAKLVGMTEQLNL
                     TSLQYSTASMIFFVPYVAFEVPSNLLLKKLRPSRWIPFTMVCWAIFQTTMGLVTNYGQ
                     LLALRFCLGLFEAGLFPGLNFYLTGWYKRDEINRRCAFFFGGAVMAGAFGGILGYGLS
                     KMDGVGGKQGWSWIFIIEGLLTLIVAVASFWMIYDWPDRARFLTPLEKEMVLMRLKAE
                     QGLASEGSYNKRIVKKAFTDWKTYCLMLMYIGAAEPLYSGSLFTPTIIAYLGEFTVSQ
                     SLLLSVPPYVLMFITTMTTAFLSDKFKRRGFFLMGWSLIGAIGYLLLLTIPIRYPGAL
                     YFAVYVSSAAAGPLIATTIAWTGNTWGNHYKKAICMGLVFSAGNSGGIVSSQAYRNKD
                     APRFQPGHATAMAFCLLNGSMALLLYIMNKRENRRRDEKYGPAPLPDEVQEYDDPAYQ
                     QKWGLEGMTRAEVVELGDDHPAFRYWL"
     gene            complement(1361578..1364939)
                     /locus_tag="CND04970"
                     /db_xref="GeneID:3257296"
     mRNA            complement(join(1361578..1362570,1362640..1362853,
                     1362920..1363234,1363290..1363749,1363803..1364939))
                     /locus_tag="CND04970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657083.1"
                     /db_xref="GeneID:3257296"
     CDS             complement(join(1361982..1362570,1362640..1362853,
                     1362920..1363234,1363290..1363749,1363803..1364819))
                     /locus_tag="CND04970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512726.1"
                     /db_xref="GeneID:3257296"
                     /translation="MPFHAASNAPATSPPLPPVRHALSIKLPERSFSHSTSTDAYTPL
                     TPTNENGHIGITRRRHSVSSPKSRAASLDHQPRLAPKNSTASDWRMNGWTKHGEPSSS
                     PAPDVSEHETTPVAHPIDLTPPLLPAASSLHPLPRDPNNILPLSVASSPFVTPSVSRA
                     PSPRPAPRVDSSAEQITVSTGIVPASSSAPGSSSSPRTSISTSSSRVWPAGRSASRSS
                     AEDDDTGPYGSAAGPSYHPRSWFSRAAGSISPKINAPTAPRIMRLSSGRLTGTRRWGW
                     IFEWLGVQSKPELPKRGGLSKRSDRERERLMGQGVRRRGDVKILGSKWLARVIAFIPT
                     EPWSISLFLIFFAVFAITLTFTIKHILNPDKEALPWRQYCTTTYPSLYSLQYPSDQPH
                     TKLTLSPLSPDHPAWPYKPHTSPLWTADMPQADLDAALEPVGVLLGVFTTDAGLERRH
                     MIRQSYASHWRSRRKGTEGVRIKFVMGRPRKRYEKAVQLEMEAFNDILLLDIDENMNN
                     GKTHAFFSWAAENASVPDWEYPSHPRSDSDYANSGTAIEAAQGGNLHAPVWRGEKKPQ
                     YVVKADEDSFIMLGELERRLRVVPRMKTYWGYLVKNKFMAGECYALSFDLVEYIAASP
                     ALKTLTKGKEDKLVAKWIGMHPQKEEIVWSTDRCWIYDHPKAGTVYSHGFLYPSTVEQ
                     VRVENQTGLSPLTLAQRGGPGAADAYSTVSKFGTAYRPLSTDMSAAEQVEALVEGSPL
                     SRLNEDELSSSSRKVQQAFSPTESLRQKIDRLYSSRPTRIERFLGDEEERGGTVVVHY
                     IKKAEWFVETMIAMLGTAEEQRVWHRGVGSGLGALERRKGRVPVSGNGQEGFDAGNRV
                     RLKKEDGL"
     gene            1365103..1365943
                     /locus_tag="CND04980"
                     /db_xref="GeneID:3257285"
     mRNA            join(1365103..1365419,1365482..1365609,1365649..1365943)
                     /locus_tag="CND04980"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657084.1"
                     /db_xref="GeneID:3257285"
     CDS             join(1365169..1365419,1365482..1365584)
                     /locus_tag="CND04980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512608.1"
                     /db_xref="GeneID:3257285"
                     /translation="MSRTPPSSPIRPLSPLSPISPWPSVPSADECANSASDTHGEVLP
                     NATDVYASIAILGTYLSFGLYLFWAVVPPNWEWTGWLPDREWTVIVPCWLMVVVLLVY
                     WTYAALIIYNAPPSE"
     gene            complement(1365831..1367420)
                     /locus_tag="CND04990"
                     /db_xref="GeneID:3257463"
     mRNA            complement(join(1365831..1366183,1366244..1366258,
                     1366313..1366398,1366460..1366658,1366738..1366843,
                     1366915..1366982,1367110..1367420))
                     /locus_tag="CND04990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570065.2"
                     /db_xref="GeneID:3257463"
     CDS             complement(join(1365939..1366183,1366244..1366258,
                     1366313..1366398,1366460..1366658,1366738..1366843,
                     1366915..1366982,1367110..1367326))
                     /locus_tag="CND04990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570065.1"
                     /db_xref="GeneID:3257463"
                     /translation="MIDSSPHLTWTNVFIGLLFVIFDSVLSIVLGLGIASSLLIAAVR
                     CIIQLSVMGLVLDKVFASNNIWGVVGIAVLLNVLAATEATYNKAKRRFSNMFPLILAA
                     MMSGTVPVSILGTNFAMAQHPFWKPDQYIPIIGMILGNAISAVGLAVNSVHKEFAENK
                     DRIETYLAMGASRFEACQPVAVEALKMALLPTVNQLSVIGLVSLPGMMTGAIVGGKSV
                     EQAARLQMIIMFMISASSALCTLLALFFCLATLVDSRARLRPDKLHSKAPLLYRWRDA
                     VGERIWDGLKKITFWGRKERGTEEERRGLLDGQSR"
     gene            complement(1367606..1370228)
                     /locus_tag="CND05000"
                     /db_xref="GeneID:3257358"
     mRNA            complement(join(1367606..1367971,1368055..1370228))
                     /locus_tag="CND05000"
                     /product="hypothetical protein"
                     /transcript_id="XM_570439.2"
                     /db_xref="GeneID:3257358"
     CDS             complement(join(1367808..1367971,1368055..1370224))
                     /locus_tag="CND05000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570439.1"
                     /db_xref="GeneID:3257358"
                     /translation="MPPADDLTPQSAHLLLASLRNLRTSLTHTLDRLDATILRVHARA
                     ALSTLPQQAALGTPGRAPATAPHAAGNGPGEQPVETRLQADPWVLRAQTVENRIMRLR
                     QTARELRERAEASDGRALPAVLGQEPADRIPESANNDNVSGGQAMLTFIDSIRQDQAQ
                     IENGMRRLDALSTHLVSQRPNLSSAAANNSSNVSSRQTSNIVRQSTPRPYNRPRGLAP
                     TNSRSAYPDPERVASNNVSPRRASSPASTIRASDQNHLGSGGAGRNTGSREHNPLSEI
                     VSDVQRESSAMDSPSSETFDPLGDGPSTRGVTALPRDSDNREFDFRSLFDSPLGSPIP
                     FVGGSSSSVRIRDVNNGGNAADDSLTRRGRTVHQRMNNSQPQRQPQLPRPGILPDMRE
                     LRRFNEITRQSNFRSAPERFTLFFDEIRPEHLERTHSPPDRRVEDQQGPLRAESHAAA
                     SSSVTDDVDSSRHDNARSALAERTGAQPPGLDATPSSLFNQYTLPPRNTRNQDDTAFE
                     ERMERIRNARASLRQVNQLRRDMRTVRGGAPPAPGMGTAESPVASVDTTVSSGIRAPL
                     TRDSDVDQDPRRRDGTASSPRTRLAPTVNNTLQLDPTDPTDPWNTDTSFQGAMETLHN
                     ALAGELERRHWVIQSETVDSNDRERRQHHDLGDDGIGLDVFVFEVGATERGSTPEREA
                     AVADVRRSGGDSMVGESERRDEELLEGNVDEEHEEDQDEEQDSRTRRDMGLSNRRVSM
                     KECYQVNLHLWPGTAGWGNSRGGGCPCREATIEPSQI"
     gene            1370370..1372823
                     /locus_tag="CND05010"
                     /db_xref="GeneID:3257397"
     mRNA            join(1370370..1370600,1370648..1371137,1371194..1371376,
                     1371441..1372281,1372380..1372823)
                     /locus_tag="CND05010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570421.2"
                     /db_xref="GeneID:3257397"
     CDS             join(1370379..1370600,1370648..1371137,1371194..1371376,
                     1371441..1372281,1372380..1372530)
                     /locus_tag="CND05010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570421.1"
                     /db_xref="GeneID:3257397"
                     /translation="MPSSVPDSSSRHQSMFIGTSPASTAGHHASAVTLGAGIFARRRD
                     SHSEAGDADFDPERSLGRLVDELGRVMGSDKLPSRPSSPFSPTRTPTPLGSNPLDLSF
                     TLARSTPLPSPPPSDGEPEINDTPKPRPRHPSGIPAHTSKNEKSARGNRPLGESRHGN
                     TATKPGATGAFQPTTASKDRLRSLRAEHSKPRSVSAPVRGDRTLGDITGLSDLLNTPA
                     KPGEFGSLGKDESVGGIPAADIPATLEKLNQRLKALDIENSTSRRRVRELEEELARAK
                     KELAETLNNGERNLAEIQKEKAALEELVTSTRKHLSRLTLDLESQKSLVAKLKATPAP
                     PPTHSSSTSAHLSSLRSEIDNLSKQISALHSIVEQGLEARKRARGEPTLQMEREEMER
                     IVRQVAREATLESDRHVEDGRKDGKSRQKETQQSPRPSRLSQGLHAAASSIDSLQPPT
                     QQTPFSFPKPYDPSDNLTYSPTPTAKAHSRQPSSVLSKPESDPSFRKKTDQKDRKHAQ
                     EKNVEQTPGKNGSHNIFEKDLGQDFFIFDEGNEYPKAEKEAKQQQEETKKGKNKLEKV
                     LNELEIDFTQLKLVYADLADRYKELDPASDVVQRHKVASRLKEVIKVLEKKADQIDDL
                     KSLL"
     gene            complement(1373195..1374016)
                     /locus_tag="CND05020"
                     /db_xref="GeneID:3257455"
     mRNA            complement(join(1373195..1373453,1373537..1373850,
                     1373912..1374016))
                     /locus_tag="CND05020"
                     /product="adenine phosphoribosyltransferase, putative"
                     /transcript_id="XM_570064.2"
                     /db_xref="GeneID:3257455"
     CDS             complement(join(1373291..1373453,1373537..1373850,
                     1373912..1373971))
                     /locus_tag="CND05020"
                     /codon_start=1
                     /product="adenine phosphoribosyltransferase, putative"
                     /protein_id="XP_570064.1"
                     /db_xref="GeneID:3257455"
                     /translation="MSDVAYIKSLLGVHPDFPKKGITFLDIFPILRDPIAFETLITHF
                     VSHIFNTHKVKPDVIVGLDARGFLLGPVIAMRLGAAFVPVRKAGKLPGSVEVVTYEKE
                     YGVDQFEMQSDAVTPGQKFIIIDDLIATGGSAAAAGELVKKSGGETLEYLFIVGLPFL
                     KGHEKLDAPVYSMIEAED"
     gene            1374186..1375995
                     /locus_tag="CND05030"
                     /db_xref="GeneID:3257400"
     mRNA            join(1374186..1374284,1374322..1374380,1374431..1375085,
                     1375133..1375437,1375492..1375995)
                     /locus_tag="CND05030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570423.1"
                     /db_xref="GeneID:3257400"
     CDS             join(1374249..1374284,1374322..1374380,1374431..1375085,
                     1375133..1375437,1375492..1375954)
                     /locus_tag="CND05030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570423.1"
                     /db_xref="GeneID:3257400"
                     /translation="MPLNYSKWDMLELSDDSDIEEHPNVDKKSMIRWKQRDIHEKREA
                     RKLLISKLKSELSLNSVLRPRIETIISGLSSSGLDHYRAVQRRMKEDPSPEKPETGAP
                     NQPTYDMMLSQLLSDVFREGAWLVEGGRIEGNGVLYNGKKVDDNTGLPDWATAEVPEG
                     KKELLAEKLEQRLRWHVSELNRRDEQVKKEIEKEEGELKKKITSDDIHEGWSSSKIAP
                     PKPSVWDETPRPKKDKKTEKVETIEVLNPKASSSAAPVAPATEDTDDEEDFGPLSPAG
                     RAFAQIPLGDFEKAYDFIKNDSSVLSSSTHDSLLAEAFDAERRGDKSLAMRCVHQSLL
                     VNYCRQLGKDGVGLFFQKMIQKNPKSITMFNEDFQRTYNRIATRTREILAEEAAAGPS
                     GEREQIQLVATDPNMTIAFNLPDGPPPEKILLEGEGVEELDMEQVRAWLQRKWEIFKS
                     FPPRFQEALQTENLDKVNQALGDMKVSEAEKIVELLQEGGMLSFSEKGVRDMTNQ"
     gene            complement(1375963..1377515)
                     /locus_tag="CND05040"
                     /db_xref="GeneID:3256871"
     mRNA            complement(join(1375963..1376871,1376930..1377325,
                     1377373..1377515))
                     /locus_tag="CND05040"
                     /product="expressed protein"
                     /transcript_id="XM_570438.2"
                     /db_xref="GeneID:3256871"
     CDS             complement(join(1376015..1376871,1376930..1377325,
                     1377373..1377451))
                     /locus_tag="CND05040"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570438.1"
                     /db_xref="GeneID:3256871"
                     /translation="MVHQDNPSNSILLLHPPALDPTHFVSRLISKDLSVVSDTEPVSW
                     IIDNKYYSAEVFFQLIPIPQNLDGDDVLNKYHDVGVVVYLFEGPIPKVLPPRLVKFMS
                     EPRDVAIAVRALSSGLPEEIQDGEGEEMTSVTELFDEIGMEFIDEVNPFTDEDDERPM
                     MPLDIIRQTLQTHLWPGMSRKPLHTSSQMPASAPSSTTSSRAPSPEHAQFDVTFNPPV
                     QDRKGDGEQGEGNSEKKRMGQFPDLQELVAQMYGADFAAVDSFDKFDQFSTGLESLSL
                     AERGTYVSLDDMELSQDNDDHQNLEEWLDEDEERMESKSIEIEEKNGRTSREAEDQLH
                     QDSDQFDPVFEPNLSNHEPQPPGFQDDFTDFQSAPPPPSSTGSATLALDPTPLLLHLQ
                     SVRAELAGVEDEDERRVRAGREVAHMLKTLGLEVGVDDDDLGLDDIGLDSI"
     gene            1377579..1378760
                     /locus_tag="CND05050"
                     /db_xref="GeneID:3257021"
     mRNA            join(1377579..1377806,1377881..1378027,1378110..1378336,
                     1378425..1378760)
                     /locus_tag="CND05050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657085.1"
                     /db_xref="GeneID:3257021"
     CDS             join(1377641..1377806,1377881..1378027,1378110..1378336,
                     1378425..1378688)
                     /locus_tag="CND05050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512808.1"
                     /db_xref="GeneID:3257021"
                     /translation="MSSTTSSLPPAPAAYIPPSAAPPFLRRLIVSALSSRGFDGAEAG
                     ALTEIERLVECHIEHVLGGAKDYANLCGRRDVHAGDVVMAQEETGWRVDAMRKESKRK
                     RRALNLQTRSSPPPSPTSTTFTLPDLLRQELSTESDQKPSIASLSTARGETGGSGEKL
                     SYAESWMPGLPEKWTYTTSNGDYSFNLQEHVQVTSSLLDFIKLTAAERGDIPPELGLV
                     NYRKDPGLAAGWGVNAGSTRVGFGNGAGEEETGGAGAKKRKWSVKGVEG"
     gene            complement(1378714..1380484)
                     /locus_tag="CND05053"
                     /db_xref="GeneID:36392842"
     mRNA            complement(join(1378714..1378752,1378817..1378963,
                     1379131..1379209,1379291..1379366,1379468..1379508,
                     1379594..1379630,1379725..1379820,1379904..1380008,
                     1380159..1380484))
                     /locus_tag="CND05053"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658500.1"
                     /db_xref="GeneID:36392842"
     CDS             complement(join(1378915..1378963,1379131..1379209,
                     1379291..1379366,1379468..1379508,1379594..1379630,
                     1379725..1379820,1379904..1380008,1380159..1380344))
                     /locus_tag="CND05053"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514352.1"
                     /db_xref="GeneID:36392842"
                     /translation="MSLLDSLAQQIHATLLSPPAKFLLTSGRALDDQWWRVRLFWNGD
                     RDGKTEVRVWTADINLDEVSATEEDLAAAIETGMLHVDCGRRSVDLSALDELSLHVLI
                     QPKPIITYLTLGKVEDYVGQLIEVNYKLLSRPVATKEDPSEVKKLRSQLVRKDEEIAT
                     IRSKMSNLSSQGASRGSDYKSSPSQSPQKPRTIIPKNASKIQPNQKRRRVMQEEFASD
                     SDSD"
     gene            complement(1380603..1382137)
                     /locus_tag="CND05055"
                     /db_xref="GeneID:36392843"
     mRNA            complement(join(1380603..1380872,1380926..1381450,
                     1381510..1382137))
                     /locus_tag="CND05055"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658501.1"
                     /db_xref="GeneID:36392843"
     CDS             complement(join(1380810..1380872,1380926..1381450,
                     1381510..1382016))
                     /locus_tag="CND05055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514353.1"
                     /db_xref="GeneID:36392843"
                     /translation="MGSICSEGQGSSSGRSEREKASERDREGDLRASAGSHRKRGSLG
                     SIAEFVSASISWGLTPFACANTSQHPSYCRETSPPVPATPTTSEEAVEALSRKFTSSK
                     QRVLEPFSVGPQTEDMVVREKEKVIKGMHKRRMMSECEVETMVAAIGHKVLEGKDDDE
                     SVVESLLDDAPPSKPQTFASNRRPKPALQVPIPTLPIWRYPMPSPPVTSLCPDIPLEA
                     FSIAVDNPCSPMTATSSEAASTFLTSDARTRLEDERRAKIEVEQVDCLAELQLTREPQ
                     SSISLTEHSSHRLFDPGQATPRKPQLPYLSCRVLGQEKYESHLLGETGELKRIKSGSS
                     ANSSDTIKPQVASSTGHHGPTSTMTTVIIS"
     gene            1382563..1384533
                     /locus_tag="CND05060"
                     /db_xref="GeneID:3257417"
     mRNA            join(1382563..1382781,1382837..1382977,1383037..1383233,
                     1383328..1383460,1383581..1383796,1383892..1383978,
                     1384082..1384533)
                     /locus_tag="CND05060"
                     /product="ribose-5-phosphate isomerase, putative"
                     /transcript_id="XM_570436.2"
                     /db_xref="GeneID:3257417"
     CDS             join(1382698..1382781,1382837..1382977,1383037..1383233,
                     1383328..1383460,1383581..1383796,1383892..1383978,
                     1384082..1384132)
                     /locus_tag="CND05060"
                     /codon_start=1
                     /product="ribose-5-phosphate isomerase, putative"
                     /protein_id="XP_570436.1"
                     /db_xref="GeneID:3257417"
                     /translation="MPSPAVDLLKQKTASLPNAPISVVAANTFVPPTQPVTAGNQLPT
                     SVPLPVLPAVEAAKRLAAYAAVDRHIAHEHKVIGIGSGSTVPYVVDRILAQGFEANKD
                     RVFLPTGFQSKELIVKAGLTLGDVDQYARIDVTIDGADEVDNELNSIKGGGACQLREK
                     VLAEAADTWIIVADYRKNSEVLGTSWTKGIPIEVVPFAYAKVLTNLAHMGSPHVLPNG
                     QPGLSLRMGKMKAGPVVSDNGNFIIDAPFAEELMRQPEELLHKIKMLTGVVEVGLFCG
                     MAKAAYFGNEDGSVTIRSDDGTISQL"
     gene            complement(1384493..1385652)
                     /locus_tag="CND05070"
                     /db_xref="GeneID:3256896"
     mRNA            complement(join(1384493..1384749,1384884..1384952,
                     1385180..1385250,1385460..1385652))
                     /locus_tag="CND05070"
                     /product="expressed protein"
                     /transcript_id="XM_570063.1"
                     /db_xref="GeneID:3256896"
     CDS             complement(join(1384670..1384749,1384884..1384952,
                     1385180..1385250,1385460..1385542))
                     /locus_tag="CND05070"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570063.1"
                     /db_xref="GeneID:3256896"
                     /translation="MSHVDVTVDEATINAIRQRMLETGDWERIQKLLRAHLEESGWVD
                     DLKDLAKEKARAQDVPNLENLVKQISESAAGMVSDNVKRDVMLEIESVLDREVDQA"
     gene            complement(1386055..1387133)
                     /locus_tag="CND05080"
                     /db_xref="GeneID:3257124"
     mRNA            complement(join(1386055..1386274,1386334..1386444,
                     1386500..1386646,1386708..1387133))
                     /locus_tag="CND05080"
                     /product="mitochondrial import inner membrane translocase
                     subunit tim23, putative"
                     /transcript_id="XM_570062.1"
                     /db_xref="GeneID:3257124"
     CDS             complement(join(1386192..1386274,1386334..1386444,
                     1386500..1386646,1386708..1387092))
                     /locus_tag="CND05080"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit tim23, putative"
                     /protein_id="XP_570062.1"
                     /db_xref="GeneID:3257124"
                     /translation="MAIFGLFGSSDPAPQESSASAELFSSTTFRSNVVPSQPEAQGSS
                     FIPDPPSQSAPAPAPTAPAPTALDAFGSAFDPARLHPLAGLSENLDFLQLDEEKLNDL
                     EGAASVLPSRGWTDDLCVGTGTTYLSGLAIGGTWGLKEGMSRPLGNNPSFKLRLNSIL
                     NGCTRRGSFMGNSLGVLAIFYNISNSSFDAIRGKHDVLNAMAAAGLSGAIYKSTAGLR
                     PALVGAGLGTAAAAGWSAFKNFV"
     gene            1387283..1390989
                     /locus_tag="CND05090"
                     /db_xref="GeneID:3257284"
     mRNA            join(1387283..1387640,1387696..1387950,1388006..1388210,
                     1388262..1389055,1389110..1389374,1389440..1390605,
                     1390667..1390836,1390895..1390989)
                     /locus_tag="CND05090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570437.2"
                     /db_xref="GeneID:3257284"
     CDS             join(1387302..1387640,1387696..1387950,1388006..1388210,
                     1388262..1389055,1389110..1389374,1389440..1390605,
                     1390667..1390836,1390895..1390907)
                     /locus_tag="CND05090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570437.1"
                     /db_xref="GeneID:3257284"
                     /translation="MSSSAPSDPPLSASSLTVKHKKRSSKDKSGTPSPRPSKTARLDQ
                     EDGADDPMDVLEEGKDGRSRDPMEALEDGAMPKVEDEYEVQAEREVDAAKDFADVTAP
                     GQEAKLKLVHQVRHQVAIPPDYPYIPINQHKRKDPPARTYKFELDPFQFVSTSCIERN
                     ESVLVSAHTSAGKTVVAEFAIATCLKEGRRVVYTSPIKALSNQKFREFTETFGDVGLM
                     TGDVTINPEASCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETI
                     ILLPHTVRYVFLSATIPNSMEFAEWICATHEQPCHVVYTDFRPTPLQHYLFPAGSEGI
                     YLVVDEKSNFRDDNFQKAMAALAQGQGEDPANPSGGKGKKGKTKKGGALKGETSDIYK
                     IVQLIMRRNLNPVIIFAFSKRECEDLAMQMQKFDFNTPDEAATVAQVFESAIGSLSED
                     DKKLSQIEGILPLLKRGIGIHHGGLLPILKEVIEILFQEGLIKALFATETFSIGLNMP
                     AKTVVFTSVRKFDGKDFRNLSGGEYIQMSGRAGRRGLDARGIVIMMCDEKIEPEAAKG
                     MVKGQADRLDSAFHLGYNMIINLMRVEGVSPEYMLEKCFFQFQNSMSVPVLEKQLKEA
                     EAERDAIVIEREDEIEEYYELRQQLKERGQDFQAVITHPAYCLRFLQAGRLVEIRDGD
                     KDFGWGVVVAFNKVVNQRGRPPIWTDQDPPQKQYIVDVLTRVETGASIPRDRSASEIS
                     PPSGADKGEVAIIACSLSTVQSISQYRVNLPKDLRGQQEKNTAFRAVNEIKKRMPDGP
                     PLLDPIKSMGISDKSFVDLVKKIALLENRLQTLEITKSPELPRLYDLYDRKQKSIQSV
                     KSLKRRINSVHDILQLEELKSRKRVLRRLGFTTADDVVEMKGRVACEISTGDELMLTE
                     MMFGGTFGTLAPEQCAALLSCFVFQEKSEAKVRLKEELAVPLRTLQETAKRIAKVSNE
                     SGIAIVEDEYVQSFKVEMMDVVLQWCKGAKFSQICEMTDVFEGSIIRCFRRLQELIRQ
                     MGQAAHAIGNTELEEKFAKSMELLERPNTVVFNPSLYL"
     gene            complement(1391481..1392760)
                     /locus_tag="CND05100"
                     /db_xref="GeneID:3257350"
     mRNA            complement(join(1391481..1391767,1391830..1392518,
                     1392569..1392760))
                     /locus_tag="CND05100"
                     /product="hypothetical protein"
                     /transcript_id="XM_570061.2"
                     /db_xref="GeneID:3257350"
     CDS             complement(join(1391573..1391767,1391830..1392518,
                     1392569..1392713))
                     /locus_tag="CND05100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570061.1"
                     /db_xref="GeneID:3257350"
                     /translation="MSEQPQQSEAARRAAARKAKILARGNSGLNKLAQSARGEEAQKL
                     YPDNPNPSSHASTPSAEQQPKQPQWAPPPSSSTPPSSQPQMSSDQAAMARQLEAMMSM
                     FGAPGTQSSGGGAEMPDMSRLLAQMMGDPSLASGPNAQGQGMIGDVDDPAGLGGMGPG
                     GIPSNLSDLFGGAGAGGPSFPGFGDAGVGQKQGKGKIEKYFPLAHFISVVLLAIFAVI
                     WWEPALRMTAAFRTENVWADRWAGCAGRVKGLGEVEVLPIFWAFVTVELILQTSRLMI
                     FKSPPAPHSLLQNFLPVLPPSISRPLLTGSRYLNLFSQTYKDGCLLVFAIGTTVVVAD
                     WLRGSLVV"
     gene            1393200..1396233
                     /locus_tag="CND05110"
                     /pseudo
                     /db_xref="GeneID:3257361"
     gene            complement(1396174..1398426)
                     /locus_tag="CND05115"
                     /pseudo
                     /db_xref="GeneID:36392844"
     gene            1398535..1400246
                     /locus_tag="CND05120"
                     /db_xref="GeneID:3257056"
     mRNA            join(1398535..1398681,1398737..1398993,1399089..1399250,
                     1399301..1399845,1399908..1400246)
                     /locus_tag="CND05120"
                     /product="3-deoxy-7-phosphoheptulonate synthase, putative"
                     /transcript_id="XM_570499.2"
                     /db_xref="GeneID:3257056"
     CDS             join(1398622..1398681,1398737..1398993,1399089..1399250,
                     1399301..1399845,1399908..1400062)
                     /locus_tag="CND05120"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase, putative"
                     /protein_id="XP_570499.1"
                     /db_xref="GeneID:3257056"
                     /translation="MSATPSPDRNRPLDDRKVTGYDPLIPPALLRHDLPVPPVASKTI
                     SASRRTTSSIVRGTDPLSRLVVVVGPCSIHDVDQAKEYASRLRKGVQEGKWPGLEVVM
                     RVYFEKPRTTVGWKGLINDPDIDGSFKINKGLRMARELLCDINAMGMPVGCELLDTIS
                     PQFIADLISWGAIGARTTESQLHRELASGASFPIGFKNGTDGSVGVAIDAMQSASHPH
                     CFMGINSQGMASIVRTSGNRDCHVILRGGTGGPNYSAEHVQKALSTMRSKNPDAFASI
                     MVDCSHGNSSKNHLNQPKVAADLAAQIAAGEVGITGIMFESNLKGGKQSSDKGRDNLE
                     YGVSITDACVDWEMTVDMLDNLNQASLARRALLESREANANGHLNGDTPAVKRLKTDE
                     "
     gene            complement(1400791..1402269)
                     /locus_tag="CND05130"
                     /db_xref="GeneID:3257294"
     mRNA            complement(join(1400791..1401609,1401669..1402269))
                     /locus_tag="CND05130"
                     /product="hypothetical protein"
                     /transcript_id="XM_570647.2"
                     /db_xref="GeneID:3257294"
     CDS             complement(join(1401070..1401609,1401669..1401758))
                     /locus_tag="CND05130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570647.1"
                     /db_xref="GeneID:3257294"
                     /translation="MNVCLWGCAAPFEEVPGKSGRSKTTVSLEPVPTIHLIPPSPSNQ
                     QTFDLSSSSTESSHRQTFAYMSVDITNSRPNSSWTQRISGFFDPSKIPFNSRTVPRSE
                     AVSVYLAPHPDLPEDPFASRIDMAAISTDVGPLRDVFKQDGPLAAGTGECGVATGNER
                     KHDAVQPSNQIPVGQSYKVADSIGHLSKEELSKGPRKRIINQQSTHSFP"
     gene            1406508..1408496
                     /locus_tag="CND05140"
                     /db_xref="GeneID:3256920"
     mRNA            join(1406508..1406638,1406703..1406909,1406960..1407086,
                     1407152..1407231,1407290..1407413,1407469..1407729,
                     1407782..1408063,1408114..1408197,1408255..1408496)
                     /locus_tag="CND05140"
                     /product="actin binding protein, putative"
                     /transcript_id="XM_570501.2"
                     /db_xref="GeneID:3256920"
     CDS             join(1406583..1406638,1406703..1406909,1406960..1407086,
                     1407152..1407231,1407290..1407413,1407469..1407729,
                     1407782..1408063,1408114..1408197,1408255..1408350)
                     /locus_tag="CND05140"
                     /codon_start=1
                     /product="actin binding protein, putative"
                     /protein_id="XP_570501.1"
                     /db_xref="GeneID:3256920"
                     /translation="MSRQPPLVIDNGTGYTKMGFAGNSEPSFVFPTVIATHQSGGSGA
                     SSSSTGGAGRAPPPIAGKPSHLASKRGIEDLDFFIGDEAVANSKTYSLHYPIRHGMIE
                     NWDHMERLWEQSIFKYLRAEPEDHYVLLTEPPLNPPENRENTAEIMFESFNVQGLYIA
                     VQAVLALAASWTSSKVTERTLTGVVIDSGDGVTHTIPLAEGYVIGSSIKHIPIAGRDI
                     TYFVQQLLRDRGESAHIPPEDQLRVAEKIKEDYTYVCQDIVKEFKKYDSDPYKYFARF
                     AGEHSVTGRKYDIDIGYERFLAPEIFFNPEIYSSDFLTPLPEVVDTVIQTSPIDVRRG
                     LYKNIVLSGGSTMFKDFGKRLQRDVKGIVDGRIAGSEEKSGSLMKSSGVEVNVISHKR
                     QRYAVWYGGSLMASTPEFFNVSHSREDYQEYGPSLVRRFSVFGSAT"
     gene            1408870..1410118
                     /locus_tag="CND05150"
                     /db_xref="GeneID:3257099"
     mRNA            join(1408870..1409013,1409126..1409201,1409284..1409366,
                     1409420..1409498,1409578..1409686,1409740..1409953,
                     1410023..1410118)
                     /locus_tag="CND05150"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_570060.2"
                     /db_xref="GeneID:3257099"
     CDS             join(1408957..1409013,1409126..1409201,1409284..1409366,
                     1409420..1409498,1409578..1409686,1409740..1409953,
                     1410023..1410052)
                     /locus_tag="CND05150"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_570060.1"
                     /db_xref="GeneID:3257099"
                     /translation="MKMRISQALFALPLLSVANALHFYFESNEKRCFLEELPSQTIVE
                     GHYKAFLWNENEKQWKKDEAMGIHVTVEELATSHIVVDTRGPPDGRFTFTSHEPGDHN
                     ICLHSNITGGWLSNEHIKMYLDLNVGSSRFDNAADQTHVTTLSSKIRELNSKVADIQR
                     EQRYMREVEANFRDASERTNTRAVWWSLLQIAVLIGAAVWQMKHLKVYFEDKKLR"
     gene            complement(1410094..1412155)
                     /locus_tag="CND05160"
                     /db_xref="GeneID:3257077"
     mRNA            complement(join(1410094..1411092,1411146..1411925,
                     1411980..1412046,1412092..1412155))
                     /locus_tag="CND05160"
                     /product="heat shock protein HSP60, putative"
                     /transcript_id="XM_570059.2"
                     /db_xref="GeneID:3257077"
     CDS             complement(join(1410136..1411092,1411146..1411925,
                     1411980..1412046,1412092..1412093))
                     /locus_tag="CND05160"
                     /codon_start=1
                     /product="heat shock protein HSP60, putative"
                     /protein_id="XP_570059.1"
                     /db_xref="GeneID:3257077"
                     /translation="MSKPSVLGINFGQSYASIAVIDKEGHPTCIANEEGERQIACAIS
                     YAGEQVYIGNGAMPHLVKNGKNTIMGFRNLLGHTYDEVDHTAILTAPLIPSSTTPAYT
                     VDILVPPPKAPSRSGVTSSAVSGAATPAVAEPVPSKKTISVPEVTSEFLSTLLTSATD
                     FLGVKPSACVVSAPTWFTPEQTEALRKAAEAADINVIQVLDEAAAVLVGYRVGLNEER
                     KARGLLGRPDEGNAGEEEARDKRVVVLDMGETSLAVSVIQVAEGEYTVLAKAREDKLG
                     GREFDNLLLKHFAKEFTKKTKVALDLPCGESASDADKRAEAKLRLAVDHTKRSLSASS
                     GAATCAVESLKEGMDLSSAINRLRFDGLAAPVYRQVGSVLSNTVKSAGLDLCQIDEVL
                     LAGASTLFPGLQSSLSYLFPGTTPITAAIDPSQVIAIGCALQALHLTSLEDNLKLEDV
                     LATAGPEGKADVTAAPIGIVIPSQEANTLAAVVVPSGAPLPVRRRVAIPAPAGKVALE
                     IWEGKDEVKVDLVERPPAEKFEDDEEEDEEEEEEEPEEVKTPITVKTKALGAVEVELQ
                     KEGQLVLEVIVQRGGGLEVRAWEEGREEAADKFEA"
     gene            complement(1412260..1415034)
                     /locus_tag="CND05170"
                     /db_xref="GeneID:3257115"
     mRNA            complement(join(1412260..1413202,1413252..1413589,
                     1413643..1414014,1414068..1415034))
                     /locus_tag="CND05170"
                     /product="hypothetical protein"
                     /transcript_id="XM_570579.2"
                     /db_xref="GeneID:3257115"
     CDS             complement(join(1412593..1413202,1413252..1413589,
                     1413643..1414014,1414068..1414856))
                     /locus_tag="CND05170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570579.1"
                     /db_xref="GeneID:3257115"
                     /translation="MIIPPDPEKDPNIFSPSSSTPSLVPAPSEHSYFGTASWDGESLP
                     PYEGRRRSRTSFVADHNSGTRHTREGDVFSDENAARLQEMRERNPRPGLGVVIPATVI
                     NPAYQQSPGSSLGSVTPTANGPNASLPSFHSTHPAHSHAESSIIPASDTAPVASTSKL
                     WESPSSQLSDPSSTRRILCLSPAASRALYKWWKKWRTWILVLLVVILVGVALMVGLLV
                     GMRSSKQDTGVAIPPWEDNSKSDDGKKTAIWQQGGSPNLTYVESRDGPSFTEGNLTNC
                     NQFTSYNYTSAFSTLFTPFTTTTISTTRFTFPLQANGSAPSNLFFNGRGLGSSGTITF
                     LGSEGDEELQQEAGEGVITVDVIIRYAGPQALDDMMRVCEMARDDGGVGVGIYSPRRT
                     DGKVSNPLFINAAHVPTSHILIRLPPSVYASVTPATYFPHLEYNFDRMSVRFGDLEGV
                     ADMGLLDISNNCGRLDAAYVSLKCGNVVSTGRDVKGRWNVSEELYMNISDGSISADVI
                     LYDPSHTSDNSTTLQDSDYVFHRRDISTPDKLITTRFFSSSGYLDIRYLHHPTTVSLS
                     SVIATLHGSISLRLHPNYVGPFSAKTMWGELRIPTPSSVSSYDPLHKNRSRSLALGII
                     NVPTNSSFAQYGLNQSMLQHSTDTVTGVAYWATVDQKGGKQWVNTLTVEKVQDSVAAT
                     GNEVIVMGAGGDVEVTIDGS"
     gene            complement(1415036..1416974)
                     /locus_tag="CND05190"
                     /db_xref="GeneID:3257157"
     mRNA            complement(join(1415036..1415724,1415785..1416485,
                     1416567..1416638,1416725..1416974))
                     /locus_tag="CND05190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657086.1"
                     /db_xref="GeneID:3257157"
     CDS             complement(join(1415148..1415724,1415785..1416485,
                     1416567..1416638,1416725..1416880))
                     /locus_tag="CND05190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512607.1"
                     /db_xref="GeneID:3257157"
                     /translation="MAHTVGSRKSEANIIFQDHLRTEAHLGRPRQCQKCYELWPWVTF
                     RPEKSGAHPLFCLRCSRPDLYLEHWQAAHDEMRTLIDAAAKIQKVYRGPNEAVRTISA
                     PPFLLPPQMSQSSSQTMPGAVAQRETMMRPPAFAQDRMNVSSVLNLTNVSGVPPALGN
                     APLVPAAYRPQPAVQNASISAETSSRPLRIDTPPQYPVERQRQTLNNPAYASLQFSRM
                     PVNSGASPRAAGQPFLPTRPANTGAINNTDSSHLPSHVSRWPANISLPGCSPYQLPLT
                     SFKIIKLSDLALRGLTGKPEELRALKEPYRSIFWLQLICTPSPSSVLLFSQIMHSYLS
                     FVFYNKAAAAPAHPPLLPADFINVMRNLWPEIRYAGGERGTEVACIGLVMKMDKGTRQ
                     ATSGMDAEVENTRSPVAGPSTSTQGDNVGTRPIAMSGAAVSTTTPQPVEPTTTTLRQQ
                     SGTSSKDVGVLPSQGYVPLGDQPQKTSEGAAGEPVVSSSGVGQGDWRDRTV"
     gene            complement(1417108..1422349)
                     /locus_tag="CND05200"
                     /db_xref="GeneID:3257449"
     mRNA            complement(join(1417108..1417565,1417630..1418175,
                     1418243..1419518,1419588..1419668,1419731..1421247,
                     1421300..1421359,1421403..1421761,1421817..1422349))
                     /locus_tag="CND05200"
                     /product="guanine nucleotide exchange factor, putative"
                     /transcript_id="XM_024657087.1"
                     /db_xref="GeneID:3257449"
     CDS             complement(join(1417194..1417565,1417630..1418175,
                     1418243..1419518,1419588..1419668,1419731..1421247,
                     1421300..1421359,1421403..1421761,1421817..1422318))
                     /locus_tag="CND05200"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor, putative"
                     /protein_id="XP_024512606.1"
                     /db_xref="GeneID:3257449"
                     /translation="MEAAPPRPSTSSSRSLRRTPADFEAALRNPQETLYLSAGPPPIG
                     EDLESEAASTATGHHHSSGTSTAAMDDPDAPLSVDKRSFEDDLRALSRTREREEGRIG
                     LGVGHVSEGSVVKRPPIPVPGVTPPTPKGHARKASCVTTTSTTSTGTGDTPTRAARRP
                     VKSIGLDAELGIEPKSKKAPPKRRSLFSKATTTSQPDLASMVRRSTHRSSKQKQDTAS
                     TPAPSMSTSASSRTLYKEQPSPSAPRNRSTTETSDKHGSMMGGNQMATIAEGSGTLSR
                     NKSNASDEGFKTMKYKARGMFGKMFGSTKEDQQLSSKHSGSASSSRVDINAETVYPPV
                     PPVPATYANQKQRPFTPSSTSTDVFSPSRSPQLSTYSASASPAMASHNRKSRTPTPST
                     MSGRRDSQASAMITDKPLPAVRDNVDDHDSTLVATITKRGSSPLHVREPASVSENETP
                     SRATSCSSRKLAPSPSPATAAVTSFSDDMAGMLANIGQSQPAMELGLPQESLRLRDGK
                     NGFPAALGRPLSDQELSVTPTSSTFLSATSSPQRSASVSAASASDQASSMPLKGSSAD
                     QLSSFLDPPIFQSSTFLNHELYSLHPQQPQNRHHTEPFINLHAPSPSLSSALAPSVDV
                     PQIAPIFEKASDDQGEKDWQSLSEGPSPLLPSSAKFDSSGGVENTDRPSPIAPSAWAR
                     QAQGSPSSPLPSPARLQSNLSDKIDRTCIPASSSAMSGFSSLSAQGTIKDTRDKVEVI
                     SSPPETPSKAQEQAVEVSDDKAESQKNSEPDREQDKMGEGSNEDKGKRLAREFYEGDG
                     TTVAGDKMAEFLGGPHAINDITLKYFMQYFHMEGQNLVDAFRQLCQKLYLKAESQELD
                     RIMGAFSARFFECNPNTVFGSPGILHTVSAAMLMLNTDLHIAELSRHMSKAEFVRNTL
                     QAIHESTTVDPNTILSAAADERSSTPDLVRDDDGSSMKPSLGSNSSMSTTLINTRAKT
                     PIQPMQARSTSAPVISAHIHQHAPPYASANSSLSVAGISTEGKSRNSSFSAGSWSYSK
                     GWETGAEAALKEIYSSVRADKILLPISGIPGNDRNASRSSNRQSMISLASNGPYDSRF
                     ARGRTPTDRMNVLRRGSIRSVQGLLNNGSNSPYGSQWYGSDGRLSPALSNATSINETG
                     ASGSGFSSFAPSLGFASNLSHTVIRENEDEVGSLHSKASVGTVEDMDDDELALLGAPW
                     AKEGILQRRTQGEGVAKRVKKADWKQFFVVVSKGDLYMFTFGDGKGGGGFMGGSVGGG
                     NWLENANANGTINLMHTTAVALPKQGHSSSKPYCFSVNQSSGEVCTFAAGTEDLVAEW
                     VATCNYWAARKTRQPLQGGVSNMEYGWNRVAVDQLEDESDRMSVFSQKSNGSRMGGTY
                     GRRALGSGGGSSTGQFDKIHINDWKPPPPAMIPSTMEEEGQLEALVEYVKSQEKELEK
                     HKAVEEPMMRLYSHGSKNLHKAKENWKAKSHYIHSEIFKYETYIDALRNAISLRAKKQ
                     GEKKLEKSLAMPNNNLQSSSGDKSGALDKTEKAVDASGAAQGVNAGGLSIDPEVTDGQ
                     FDDDGEEQPITPNATIRR"
     gene            1422327..1423845
                     /locus_tag="CND05210"
                     /db_xref="GeneID:3257246"
     mRNA            join(1422327..1422424,1422478..1422536,1422583..1422631,
                     1422683..1422773,1422842..1422918,1422991..1423091,
                     1423168..1423322,1423384..1423845)
                     /locus_tag="CND05210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657088.1"
                     /db_xref="GeneID:3257246"
     CDS             join(1422422..1422424,1422478..1422536,1422583..1422631,
                     1422683..1422773,1422842..1422918,1422991..1423091,
                     1423168..1423322,1423384..1423673)
                     /locus_tag="CND05210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512743.1"
                     /db_xref="GeneID:3257246"
                     /translation="MPLSTKDSLLVTQFRAITGTSSAEAAKYIKRYKHIEAAVDAFYN
                     NEPAPRADPAQERKLGEIWEKFKDPSDPKLIKIDGTMELCEELDIDPGTDAVLFCLAA
                     DLGSKATGEWEKAPFVAGIASYPGNIDSLPKLKAYLPTLRKKLVSDPEYFKKVYNHAF
                     QLARGGPQSLTRSLPLDTAIDLWTLFFPPAFNHSPSALSHLPDNSPPQFTQPEFDLWI
                     EFMQQKNKAVSKDTWALLVDFARGIDKDFKEYDEDGAWPSMIDDFVEYVREQKRGQ"
     gene            complement(1423343..1427386)
                     /locus_tag="CND05220"
                     /db_xref="GeneID:36392845"
     mRNA            complement(join(1423343..1426180,1426232..1426925,
                     1427216..1427386))
                     /locus_tag="CND05220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657089.1"
                     /db_xref="GeneID:36392845"
     CDS             complement(join(1424036..1426180,1426232..1426925,
                     1427216..1427367))
                     /locus_tag="CND05220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512605.1"
                     /db_xref="GeneID:36392845"
                     /translation="MPGQSTPPLNTAEKKLPSLGTFDLDLHGASYARNPRQATVNEEN
                     DSRRSKSNASYTGNVAQPSSPAVLSSSPSTILFSPLSRFPYTTTNHSSSKLTGSTTSI
                     LRNHSTATLTNLGCPSIPSLGTLSQSASPSEAQETPISKRRIMFRQPSSASSSPTCSE
                     HNQVPIQRSMPNTPSSDRETGTSFLPLSKKKSSGQLLMGIRKELNRVGSVMRRHNTAD
                     GGSGSASSRPVESVIKSAANAGTWRRKKGKIRDAHCKASEKNSPGTKMTEKEGDAGIG
                     RPFNVEHDLHVSPDLSDLPPAWVTALRSQGMSESDFLLITAARQRQRQNTHPLPRHHQ
                     DKNDDFFRAPFSAPAAMLEKPLGHGYATDSQSSKASSTGVLKKFSFEEMGPGLSSPSP
                     ITLITTTGLGKVRYTNHTLLKDHPFSSESESEGPASDLPSTAEPRSLSPNRTHARGGT
                     DSYPVSATESDTESSPLTHPPLPHSHSHHEPLLPTPSPPSKRLSAQLRRFKGLRIGID
                     QDEEDWGKSILFAVMDSEREIAGSETSSSGWEMCEPITPRGIPPVSHKTKTDLHPGNL
                     PTPMSDDGGRLKDENETLQSPPPHHTPILSSPSPSRQSLLGSTCPSSLPSSSKEHYGF
                     SHSPLPPFRPRHTPSGSSITKSSSLVDAELLEMKVNLLTPSPSLNKYRNEYGSVAEEK
                     YRMRGEDVHVSLDFDSEPDQHERERDGSLETKPTSSIAKPSHEGLPKHSTLQMQTPSL
                     PAIGMSPLEMNASRFGRSPVSPGIFGKSFGQVQGQKNKREYGNIDMKEDNKDEKEINV
                     LSNTIPLSPSPSYSPLPSSPPVSPFNQHPPPRTSSLSLSQSHHFRPHDSLPVSAHTDS
                     HSSLLFNSPSQENVLGDMGRTSLALSMQSDITWRTSRTSYTAHSLRSWEPVGEATVRV
                     VAYKGLVPRPGSRLWSDQDHRQGGGERSRTPNSPMEQLTDPDIHPSPLPPSPSPYRPQ
                     KRPESGGHIESLPAHSVLVHVDVG"
     gene            complement(1427634..1431912)
                     /locus_tag="CND05230"
                     /db_xref="GeneID:3257026"
     mRNA            complement(join(1427634..1428424,1428500..1428740,
                     1428797..1429036,1429112..1429260,1429380..1429994,
                     1430062..1431303,1431352..1431653,1431702..1431912))
                     /locus_tag="CND05230"
                     /product="Nuclear elongation and deformation protein 1,
                     putative"
                     /transcript_id="XM_570158.2"
                     /db_xref="GeneID:3257026"
     CDS             complement(join(1427795..1428424,1428500..1428740,
                     1428797..1429036,1429112..1429260,1429380..1429994,
                     1430062..1431303,1431352..1431653,1431702..1431732))
                     /locus_tag="CND05230"
                     /codon_start=1
                     /product="Nuclear elongation and deformation protein 1,
                     putative"
                     /protein_id="XP_570158.1"
                     /db_xref="GeneID:3257026"
                     /translation="MQYLSKAYNYYSGINPATLSGAIDVIVVRHVDTEGTVTLSSSPF
                     HVRFGKLQVLRAAEKRVTIRLPNNLPAPHVAPFHMKVGETGEAFFVVETDEQVPADLL
                     TSPVVMPTESEVPPSPPLSGEHPPEEEHLESLTQEPFGDTEQKVPHESPLGEVDFLDL
                     NASPPGTPNKRRGDDQQEKHTAANISNSLTKSSLLGTASTLLPSPLKPSPSKYPDNSP
                     PPPPARQPSIDDGIPNGNDESLAKQSSHPVVSNTNDEPNPMQARPGEKTSLPLRDLKL
                     EKLKSDSHNATASVNATRGEEGLPKVKAGQGEGPEVVYGKDVVLDMDGYHSSTNADGS
                     ASENEQDGSVEAFIQDLLASIQPAALAMDGRPKPRKSKSADTEVPSSRSDEDEDEDED
                     EDAHTPVEYSPGQGLSSARQPLPVSNPRNRPPTRSRLDRGQSEPPQLQSQDDLSRSPD
                     RGAKAAMEMEWDWGRRKPLGGNGEIDEGGSTSIGRPPLGRLKNVEENPYMFVLEVGKR
                     THMFELALCEEWGHNSTEASQEAAFIKNRLTFQTFIESPTVVDDVNIILRYNELFFTW
                     STGYRLLYALAMYRRALVPPSASPSSPTLPEMSLSGLGAGEQRRRSDSRVETGEGTQR
                     QSGYGWSRWWRRGQSSGASAPQGPPSVPGQEPPREPKTETAPARTTPVPGTPATDVQG
                     QDKEGGVPGGTETEAGTRAGLQGEDEKVLPVEGVKNYAKTLRLSSEQLQQLHLKPGPN
                     TVQFSVTSSYSGLATCAARIFLWEETDQIVISDIDGTITKSDALGHVFAAIGRDWTHL
                     GIAKLYTDIGNNGYKILYLTSRAIGQADTTREYLKSIAQGQYRMPEGPVLMSPDRLMA
                     SLHREVIMRKPELFKMACLRDIQRLFGSQAKEAFYAGFGNRITDAMSYRSVGIDTSKI
                     YTIDSTGVVRTELLQAAGHRGSYIQLNDLVNEVFPPVSTKFKPEYTDFNYWRDPVPDI
                     PLPDFSPPSPALSARSDTSGRLSVLGKIAGIGRRSSRATIGHAHSPSSASMSGASASQ
                     IDASSRPSSPLIAPSVTSDDLSEVEDGEGEGDEQRSLSNMPGSFEDDRGKYLNDPFFA
                     PQDHGPQSRSSRSPGGKEGRRGKEEEEGEEGHEGGDSYSYDDDAIFDDDILAAGEMQH
                     VPF"
     gene            complement(1431994..1433916)
                     /locus_tag="CND05240"
                     /db_xref="GeneID:3256893"
     mRNA            complement(join(1431994..1432320,1432382..1432610,
                     1432672..1433221,1433283..1433916))
                     /locus_tag="CND05240"
                     /product="mRNA catabolism, nonsense-mediated-related
                     protein, putative"
                     /transcript_id="XM_570577.2"
                     /db_xref="GeneID:3256893"
     CDS             complement(join(1432280..1432320,1432382..1432610,
                     1432672..1433221,1433283..1433767))
                     /locus_tag="CND05240"
                     /codon_start=1
                     /product="mRNA catabolism, nonsense-mediated-related
                     protein, putative"
                     /protein_id="XP_570577.1"
                     /db_xref="GeneID:3256893"
                     /translation="MAAPFVQYGITPGQSAEAPKRPHLYVGNLSPRVTDYILTEIFAV
                     AGPVVSAKIIQDRNFQHGGFNYGFVEYADMRSADQALTTLNGRKIFDAEIRVNWAYQG
                     NQNKEDTQHHYHVFVGDLSPEVNDDVLSKAFGAFGSLSEARVMWDMNSGKSRGYGFLS
                     FRDKADAEQAIASMNGEWLGSRAIRVNWANQKTQTGGTRTGGGTPSYPAPPMGAPPAP
                     AGVPSAYGAPAPGVVPGVGVGGAVGSYETVASQTPEFNTTVYVGNLIPYTTQADLIPL
                     FQGYGYIVEIRMQADRGFAFVKLDTHQNAALAITHLQNQLVHGRPIKCSWGKDKGSME
                     GGAPAAGYPSMQPQIGYPNYNYYGGYNYNQAGVPGQPGQPGVAVASHPAPAVGAVGAV
                     GAESQAQQGAWDPAAAAAYYQAGGWGGYYAQQQDTQQPSAHQ"
     gene            1434401..1435439
                     /locus_tag="CND05250"
                     /db_xref="GeneID:3256917"
     mRNA            join(1434401..1434507,1434543..1434733,1434786..1435439)
                     /locus_tag="CND05250"
                     /product="hypothetical protein"
                     /transcript_id="XM_570156.2"
                     /db_xref="GeneID:3256917"
     CDS             join(1434465..1434507,1434543..1434733,1434786..1435331)
                     /locus_tag="CND05250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570156.1"
                     /db_xref="GeneID:3256917"
                     /translation="MVVIAASICTRSGKPLLSRQFRPIPRSRIDSLLASFPKLIPVNS
                     QHTTVETNDVRFVYQPFEELYVLLITNKGSNILQDISTLSLLVRLISSLTPSMTETAI
                     LHHSFDLLCAFDEVVSLGYKENVSLMQVRNVLEGESHEEKIQEIIARNKEAEAKEELK
                     RRAKQLEMQRREQQRRAQGGGGMGNVGGYGGMAGGYSPASRYDAPLPAQEYRAPSPVA
                     ASVPSKPAFKGSGMKLGSKKGKQSDLMNALGGEDAEPEAAD"
     gene            complement(1435755..1440478)
                     /locus_tag="CND05260"
                     /db_xref="GeneID:3257024"
     mRNA            complement(join(1435755..1435952,1436007..1436176,
                     1436233..1436781,1436840..1437412,1437465..1437650,
                     1437691..1437831,1437882..1438005,1438058..1438225,
                     1438284..1438630,1438670..1439218,1439284..1439809,
                     1439868..1440119,1440173..1440190,1440243..1440478))
                     /locus_tag="CND05260"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657090.1"
                     /db_xref="GeneID:3257024"
     CDS             complement(join(1435868..1435952,1436007..1436176,
                     1436233..1436781,1436840..1437412,1437465..1437650,
                     1437691..1437831,1437882..1438005,1438058..1438225,
                     1438284..1438630,1438670..1439218,1439284..1439809,
                     1439868..1440119,1440173..1440190,1440243..1440271))
                     /locus_tag="CND05260"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024512765.1"
                     /db_xref="GeneID:3257024"
                     /translation="MSASNDELLEYTLRVAYIHGELEQQQHRSHVAQLDSSSFPFPPS
                     SSSRRTLETSSSSSFFAFDFGSLVNRDTSKSPKFPEKLLKTVDFTLKRIAMGQEAKYS
                     SPSFRRSVALFWSSTWPEKSFQRQLKESRKIEDLILAFVTAATKSLKKEDARADSWRI
                     ELSRQVSLFVDLLSDCISAMGPVSSELKARLESYQGYLKVQDTPGAEDKDLASSLKSS
                     NSMRSLVTKEENVPGKKSMDLLEVVAQLFGMPTEVCRQKVEDLKETCTRQAVLDDLKI
                     CLKRLNTEDPYPYKPHDFDHDTTSWASWKADELSSLSQTMLQMMQLDPSLVQSSSRLS
                     QLNSLHASSSDNVTYPFTFIPSNPRQRYYQLLGKCLDHDLEVLKTLPEDQDVPLSILS
                     GGHALLLSECAARWRLPPFFRSRVFLEAIVRRFSEGLVPSACVQEALSMMDKVQVDQH
                     PSTWPVSERRALESVTAQRDESFLIAIRNALDGPQGYLSGEFLEAVEDWSVLNTRFTN
                     TQNIHHLLKDLEDAIQSAAFTLYVNEATNSLDLQETKSIAFLMHMVTWIEKGIKTLRR
                     GFKGPIGQDIPITKFVLQRQLDLWLRDLEDVLQASELNGEFLDDQFELYHKARKLGQM
                     CNFFSGNKEDSYGITIASMFDQVVRRWIDHTATKTAQWSSQALAVDNFEPSTPHGPSS
                     SVTDLFASLTSAAQFLMDLEWPDEPQLAVYVNKLAKIIGATVNEYCSKLEELFLGDMR
                     QSDTSQTMAKKKAWLEKAKETVATLQGERKLQAFFNFTPESCVKLNNIQAARQQLDKL
                     YDLLRVDDLSAYDTSASQPDNQQRNFLFTVKVVLAEGLTREGSSGHPDAFVTVSDEHG
                     TRHAKTRTVYDDNNPRWDESFDIPVQHRSWFMVTVRHRNMVGKHDLLGRAYLQLDPSQ
                     FSGVMARDALLTLDPKGHILLKVAMEGEEDDMQFHFGRAFRCLKRTESDMIHSLVDKM
                     NPVLRHTLSRSAIKSVLKGHTNYPPAYNEALGKLSAVYKSAMRTQEFIIPPTKEERHR
                     GPTDSEIETAIHPLFDYLDVNNHTLASTLSSDEMELVMAKLWKQILVTIEGLIVPPLS
                     DKRSHMRPLGDMELDIALSWLRFLKDFLYAGGDSSGVSSTILQNQRYHDLLSTRLYYD
                     LSTDKLMEECVRGFQSTLKYRVTKPSKSLRAQRNLGTIRARKDAKQARVNTNGNTEMI
                     MRILRMRDGTQEFLAQQLQTISMASASRAKRDPL"
     gene            1440669..1442307
                     /locus_tag="CND05270"
                     /db_xref="GeneID:3257199"
     mRNA            join(1440669..1440734,1440788..1441240,1441301..1441378,
                     1441447..1442307)
                     /locus_tag="CND05270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570154.2"
                     /db_xref="GeneID:3257199"
     CDS             join(1440704..1440734,1440788..1441240,1441301..1441378,
                     1441447..1441541)
                     /locus_tag="CND05270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570154.1"
                     /db_xref="GeneID:3257199"
                     /translation="MSNKSFKYVIEHMEEDDAVTRSLPEWVTLEYSHMLSLVGPSSTV
                     HFTSLSSTSISPLINSLNNNPKAQPTTKPILELLPALSPPVDKARVCLLDPRAEKVIA
                     PEDADKFDVFLYGGILGDDPPRDRTGELRKLGFEGRHLGEKQMTTDTAVGVTKKVIED
                     QVPLDEIPFVDFPTIKFNKVESIEMPFRYVKDENGEPILPPGMKAHLKADLDRTIDDF
                     "
     gene            complement(1441596..1442633)
                     /locus_tag="CND05280"
                     /db_xref="GeneID:3257095"
     mRNA            complement(join(1441596..1441712,1441778..1441857,
                     1441913..1441947,1442002..1442312,1442389..1442633))
                     /locus_tag="CND05280"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657091.1"
                     /db_xref="GeneID:3257095"
     CDS             complement(join(1441697..1441712,1441778..1441857,
                     1441913..1441947,1442002..1442312,1442389..1442591))
                     /locus_tag="CND05280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512763.1"
                     /db_xref="GeneID:3257095"
                     /translation="MSLPQKIAFTRIGAAHSPSTLEVYIDPVCPFSRKITESIDKNVL
                     PMITNGGKYDGKVNLVVRLYPQPFHYYSAPIIEALYVFGQTNPRLFWQYLLAVHSTET
                     TFYNRPAASLTLSSLRDKLVEIAVEQVLDKDEAGGKGPKSKIFGELRDALEVKASDNG
                     GNEGTEGLKYSLKLGRQNGIQVTPTALWNGLKDESVSSSYGKEEWEKYFKEKTG"
     gene            1442822..1445403
                     /locus_tag="CND05290"
                     /db_xref="GeneID:3257031"
     mRNA            join(1442822..1443314,1443378..1443551,1443609..1444759,
                     1444817..1445082,1445150..1445403)
                     /locus_tag="CND05290"
                     /product="expressed protein"
                     /transcript_id="XM_570530.2"
                     /db_xref="GeneID:3257031"
     mRNA            join(1442822..1443314,1443378..1443551,1443615..1444759,
                     1444817..1445082,1445150..1445403)
                     /locus_tag="CND05290"
                     /product="expressed protein"
                     /transcript_id="XM_570529.2"
                     /db_xref="GeneID:3257031"
     CDS             join(1442846..1443314,1443378..1443551,1443609..1444759,
                     1444817..1444951)
                     /locus_tag="CND05290"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570530.1"
                     /db_xref="GeneID:3257031"
                     /translation="MLEQIPPEIISHITYHLCLSPLALTTTTPPVALLQTCKAIYQAI
                     APERNMRLYARIYRGWFDVAAAERRLGNKELAGTPCGTGGENGNGRKGNLDMGMTKGQ
                     EGAITARLRAQDLVDEMKRRVKTLARLREMVERRDVTDVSDDDLWVLYFMLIENDGKN
                     AEILFGDQAIVHLPTFLELYHRQHLLAAAVEPGYPEETIGRSLAMWIAWLVLGSGPED
                     EALEQREERQFVLRPYVFAAPRYDAYFAPWTLPTLPLKHALASADESNPYIADLVPRS
                     RLVQVRAYGRQLDLCPPNISQAAILRFFYRRLGEEVEETTMVAPFVALRGDGIGGSEV
                     STRVHSASTSRASSGTTTPVTRHSLSASFLPSFSPPLLSSSSMHDLDFSRLSLCYDPM
                     HTPGMPRPTWRGRFEGCWEGTFSFFDFDAFREMLGGQARALYEGPYGEQAQVWKIKET
                     WVRKQGWVRRGRKNEKGKGKANQEEEEEYEEDEEELGRSPVSGPMLNAGFPVDQITPP
                     FPVLAPFAAEAATLNETIQQQLETLEGYEAVPEHELDEMIRQTEEDGDGGEGVGLELL
                     LTGTGHSAWGNFILKGRVRAWDGMASLVKEYAPDSRGKWIYRGYVLAGDIFVGRWRDT
                     YTPEAYVGYEGTFILNRR"
     CDS             join(1442846..1443314,1443378..1443551,1443615..1444759,
                     1444817..1444951)
                     /locus_tag="CND05290"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570529.1"
                     /db_xref="GeneID:3257031"
                     /translation="MLEQIPPEIISHITYHLCLSPLALTTTTPPVALLQTCKAIYQAI
                     APERNMRLYARIYRGWFDVAAAERRLGNKELAGTPCGTGGENGNGRKGNLDMGMTKGQ
                     EGAITARLRAQDLVDEMKRRVKTLARLREMVERRDVTDVSDDDLWVLYFMLIENDGKN
                     AEILFGDQAIVHLPTFLELYHRQHLLAAAVEPGYPEETIGRSLAMWIAWLVLGSEDEA
                     LEQREERQFVLRPYVFAAPRYDAYFAPWTLPTLPLKHALASADESNPYIADLVPRSRL
                     VQVRAYGRQLDLCPPNISQAAILRFFYRRLGEEVEETTMVAPFVALRGDGIGGSEVST
                     RVHSASTSRASSGTTTPVTRHSLSASFLPSFSPPLLSSSSMHDLDFSRLSLCYDPMHT
                     PGMPRPTWRGRFEGCWEGTFSFFDFDAFREMLGGQARALYEGPYGEQAQVWKIKETWV
                     RKQGWVRRGRKNEKGKGKANQEEEEEYEEDEEELGRSPVSGPMLNAGFPVDQITPPFP
                     VLAPFAAEAATLNETIQQQLETLEGYEAVPEHELDEMIRQTEEDGDGGEGVGLELLLT
                     GTGHSAWGNFILKGRVRAWDGMASLVKEYAPDSRGKWIYRGYVLAGDIFVGRWRDTYT
                     PEAYVGYEGTFILNRR"
     gene            complement(1444799..1445957)
                     /locus_tag="CND05300"
                     /db_xref="GeneID:3257120"
     mRNA            complement(join(1444799..1445326,1445394..1445509,
                     1445559..1445805,1445865..1445957))
                     /locus_tag="CND05300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570646.2"
                     /db_xref="GeneID:3257120"
     CDS             complement(join(1444938..1445326,1445394..1445509,
                     1445559..1445805,1445865..1445901))
                     /locus_tag="CND05300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570646.1"
                     /db_xref="GeneID:3257120"
                     /translation="MAASRVDILNDGGLRQDARRPYELRSTSFQLSTHSSSDGSSTAT
                     QGLTTVEVSVFGPREPRNRGLASHDRAVVSVEVGVVPWAAGAGARRTRGDKRLQEIGA
                     AIRQTFEPVIMTHLYPRSEIAIHVQVLSADGGILPTSINATTLALIDAGIALLDYVSS
                     ISIGLHLLQPLLDLSQPEESDLPSLVIASLPSSGKITLAQMETRLHVDRFEEMLTLGV
                     EACKVLKEEMDGVVKDRTERIVERRGIKIGGQGTGQEGEMVIDD"
     gene            1446084..1449364
                     /locus_tag="CND05310"
                     /db_xref="GeneID:3257363"
     mRNA            join(1446084..1446324,1446409..1446504,1446727..1446845,
                     1446896..1447039,1447096..1447621,1447707..1447870,
                     1447949..1448148,1448246..1449364)
                     /locus_tag="CND05310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570151.1"
                     /db_xref="GeneID:3257363"
     CDS             join(1446147..1446324,1446409..1446504,1446727..1446845,
                     1446896..1447039,1447096..1447621,1447707..1447870,
                     1447949..1448148,1448246..1448840)
                     /locus_tag="CND05310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570151.1"
                     /db_xref="GeneID:3257363"
                     /translation="MPHRDPQAKARDRHHHHHHHHHKHSPSTSRSGLDTGIGVLTEES
                     MHVHVKVHDAEQFWREIELVVTIPESPTLDQLDNTMRMFVNFCAAYHDKYLPSQSDIQ
                     QAVTMLLDSELFSYYDERMVGIMMSDAQENTNPHDLYILYHIILYYGKRHPSLFRSHR
                     KWKKLLPTLGEVVGLDVEETFVLGLPPIETRIRLPATCLMYEVARVQKLTSSELAQFD
                     DRFIDHLFDLVETTWDQQDERLNYAVIRLIVALNEQFMVATLPSKHHTRVHARVDKVG
                     DRNHLGISSIPSSSGDGDGGHTRHHYRAKSGNTTQSEGYTHDHQEEAKKNNRVLVVLM
                     RRLGSSKTFGENMIFMLNRAENTPDDLCMQLLILKILYLLFTTPGTQEYFFTNDLRVL
                     LDVFIRELVDLPEECEALRHTYLRVLYPLLNHTQLRSDPYKRPQIKLVLRSLIANSHI
                     REIDPTTVRLVERCLEEPRKLERSLSAENVQKALHHNSASTISLGALSSTQPPSKSQL
                     GTSIYTSRDPVRQSSLNDVSSSLTDVKSRPHSSASVASTCSTNTETGAKATPPTPTRR
                     RKPPAPPRHAHPRAGACAGARKDSTATNSSWTSFDSDAEASMSDSTSTGASVLGSSFG
                     AGGRVMSPTSPINGTDDLVREGGKGVPPPIIEVHPVGREQPMGWITFST"
     gene            1449596..1451300
                     /locus_tag="CND05320"
                     /db_xref="GeneID:3257442"
     mRNA            join(1449596..1449677,1449741..1449936,1450169..1450392,
                     1450461..1450673,1450735..1451072,1451135..1451300)
                     /locus_tag="CND05320"
                     /product="expressed prote