GenomeNet

Database: RefSeq
Entry: NC_006687
LinkDB: NC_006687
Original site: NC_006687 
LOCUS       NC_006687            1507550 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 5
            sequence.
ACCESSION   NC_006687
VERSION     NC_006687.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1507550)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1507550)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1507550)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1507550)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017345.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1507550
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="5"
                     /note="MAT-alpha"
     gene            complement(39..910)
                     /locus_tag="CNE00010"
                     /db_xref="GeneID:3257775"
     mRNA            complement(join(39..459,559..709,767..910))
                     /locus_tag="CNE00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657132.1"
                     /db_xref="GeneID:3257775"
     CDS             complement(join(369..459,559..704))
                     /locus_tag="CNE00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512955.1"
                     /db_xref="GeneID:3257775"
                     /translation="MSAYISQHLTFRSISNVQHHRLHQTWSAVLSHTCRNAALYYLPG
                     RLSTWTLLSTTPLPSIQILFLWPPWHLHREAKHL"
     gene            complement(1263..3507)
                     /locus_tag="CNE00030"
                     /pseudo
                     /db_xref="GeneID:3257853"
     gene            1661..3607
                     /locus_tag="CNE00020"
                     /db_xref="GeneID:3257642"
     mRNA            join(1661..1857,1928..2955,3015..3607)
                     /locus_tag="CNE00020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657133.1"
                     /db_xref="GeneID:3257642"
     CDS             join(2381..2955,3015..3474)
                     /locus_tag="CNE00020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512814.1"
                     /db_xref="GeneID:3257642"
                     /translation="MVSTSNNEKARKPTSRRHRYERFLLRDDYRGRLPRWISRFTGYR
                     QPGDEPPYDPLPFPPFNWLVKIPLRVEVWIFAWIGCFGGILLIEAIMCTNTAFRNVYS
                     SPIIITSFGASAVLLFGAIESPLAQPRNFIGGHFVSALVGTAITRLWVLNPRYQDYLD
                     NTGFHGNTFVNGGLCMATAALAMLISGMVHPPSGATALNAAVQTSVVSLSWRYLPVVL
                     ASALIMQGWALIINNLGRRRYPIYWWSPKQVFVRPEVLEHENDEETALRTLQEGPLRS
                     AEDAGRTRETLLEARMQGEGAGGADFMQDPSGQNNIPMGAVESPEIGVPEPRLKPMTE
                     GDRRRAEGFD"
     gene            complement(3971..6105)
                     /locus_tag="CNE00040"
                     /db_xref="GeneID:3257750"
     mRNA            complement(join(3971..4411,4473..4552,4610..4647,
                     4701..5131,5184..5294,5342..5477,5543..5739,5795..5887,
                     5946..6105))
                     /locus_tag="CNE00040"
                     /product="enolase 1, putative"
                     /transcript_id="XM_570692.2"
                     /db_xref="GeneID:3257750"
     CDS             complement(join(4245..4411,4473..4552,4610..4647,
                     4701..5131,5184..5294,5342..5477,5543..5739,5795..5887,
                     5946..6030))
                     /locus_tag="CNE00040"
                     /codon_start=1
                     /product="enolase 1, putative"
                     /protein_id="XP_570692.1"
                     /db_xref="GeneID:3257750"
                     /translation="MSFQSVRASQIFDSRGNPTVEVVVETLQGRFVAGVPSGASTGSH
                     EAVELRDKGDAYGGKGVSKAVKAVNEVLGPALIQSGIKASEQAKIDQLLIQLDGTDNK
                     SKYGANAILGISMAAARAGAAEKGLELFEHLADLTFPQRDKAKPYVLPVPCTNQLNGG
                     VHAGNQLAPQEFMVLPTGATSFEEAMRIVTECYHSLKSVITEKFGLAGTGIGDEGGFA
                     PPVDSIDQALDLLVEASAKAGHSNNVHFAIDPASSEFFKDGVYDLDFKSTDQLETHRC
                     LSPDQMASLYNDLISKYPLILLEDPFAEDDWDSWTKFMEKINGRIEVVGDDLLCTQVS
                     RVKMAKKASACDGLLLKINQCGTISEAIEAAQTAYSYGWSVFVSHRSGETIDDFIGDI
                     VVGLQTGHIKSGAPCRGERLAKYNRLLQIERLLKERGHPVRYAGVDFRRAATW"
     gene            6344..9412
                     /locus_tag="CNE00050"
                     /db_xref="GeneID:3257894"
     mRNA            join(6344..7074,7132..7207,7260..7416,7473..7632,
                     7681..7912,7980..8092,8153..8251,8305..8407,8448..8935,
                     9000..9412)
                     /locus_tag="CNE00050"
                     /product="expressed protein"
                     /transcript_id="XM_024657134.1"
                     /db_xref="GeneID:3257894"
     CDS             join(6518..7074,7132..7207,7260..7416,7473..7632,
                     7681..7912,7980..8092,8153..8251,8305..8407,8448..8935,
                     9000..9063)
                     /locus_tag="CNE00050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512940.1"
                     /db_xref="GeneID:3257894"
                     /translation="MTPAYEREETMNSPYSSSHYLGVSEGGSSGDSQINNVRSDAAQT
                     RNPLPRQETNATLPPYASSTAIPAYISNSCQEACSVGRAKGYLLLLSAFSKVLDQVRR
                     TSSCISLEHSVSEVSPVQAVNGSTSWSSDCEGPLSEECRVALFVEMAVRRFGYWQERL
                     LALKSTALPPLDVLLVWATYLGSPIWYHDDSVQGGTTHPQSAFPDFPLESVIACIDPD
                     TLDYQPVDPGEWKAATGTPFDPIVHFESSTSAAVNCPGCRTKFSWPWILEGGKGYAQC
                     LFVAECPTTNCRLRIDKEAMGVGRLARRIADMYDRSNCQLATRILTGGLLNHPLDIPF
                     KSIQTSEDKSKSLCKHWRWRRSYAFAFLVEQLPRVDKREISRLSSAFVGAEEASIDLA
                     PATFRHIGFIDTLKHLGWLNPSTWVDRSEALYTARLRYAKFMNLARSPNLIPVPTLGI
                     EIIWQTHMLASTTYRRETQMLVGRVVDRDEAVEESVLAEAFTETAEKWKASFHVPYTT
                     SGMLLPLPLSGLAAKVALKLHWRPRPRRLSLDRKVDYDNPIVYAVVDSTLSLPCERNS
                     IALIDDDKARTKRALRREEYELYRVAALQWADKGKVDPALAEGLRNLTPAFMTTTLED
                     AKCGPGGFPCSPSYLTISGNHISGKLISSTSNGMGIVGAGLWRGNDAELAKMQPSTSL
                     "
     gene            9579..10168
                     /locus_tag="CNE00060"
                     /db_xref="GeneID:3257921"
     mRNA            join(9579..9691,9806..10168)
                     /locus_tag="CNE00060"
                     /product="expressed protein"
                     /transcript_id="XM_570693.1"
                     /db_xref="GeneID:3257921"
     CDS             join(9637..9691,9806..9969)
                     /locus_tag="CNE00060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570693.1"
                     /db_xref="GeneID:3257921"
                     /translation="MCKQVTCPNDGKPTWWGCGKHVEQALASIPPSDRCDCPHEPASV
                     PGMYEVKKNGPSEGVQLKVGRAGADAEK"
     gene            complement(10241..11704)
                     /locus_tag="CNE00070"
                     /db_xref="GeneID:3257663"
     mRNA            complement(join(10241..10612,11128..11346,11527..11704))
                     /locus_tag="CNE00070"
                     /product="hypothetical protein"
                     /transcript_id="XM_571103.1"
                     /db_xref="GeneID:3257663"
     CDS             complement(join(10347..10612,11128..11346,11527..11683))
                     /locus_tag="CNE00070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571103.1"
                     /db_xref="GeneID:3257663"
                     /translation="MPNNRKITKKTIKGKEGLHPGSRKAAQLTRVQLRVEKLKGNNKA
                     RKDHVSAKVQRPLFFIHSLSSPNPLTLPSLKALITEVYLKRHDPRIEELTRERRPGRP
                     KPKELLDLEEVKKRETGEYETGMEVPDLTHPPTTLLIHSWLSSPNPPSIDHSHIDLLR
                     HIRVSPHGEVLLTKEGRTEEMGLGNWKGEGEGDDWTTFLEGVSTEKQGQEMEE"
     gene            11882..14659
                     /locus_tag="CNE00080"
                     /db_xref="GeneID:3257573"
     mRNA            join(11882..12016,12072..14659)
                     /locus_tag="CNE00080"
                     /product="hypothetical protein"
                     /transcript_id="XM_570695.1"
                     /db_xref="GeneID:3257573"
     CDS             join(11955..12016,12072..14577)
                     /locus_tag="CNE00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570695.1"
                     /db_xref="GeneID:3257573"
                     /translation="MRVPHTLRKLNNVRLKNHIYTGSFSNLHLSARRSNRNKKSDSYH
                     PFPLPSAINAIPPSPISQLPFPTSPLRGSWSQTPTSSIPAASLGQLQKLLQPYSGEKP
                     ESISASTTGEMLSIQHAEAVWLLYSSFPQAYRRTFPLSVLHQTFRQVVPRYSDIKILI
                     GNPRTRNPSVVREHRRKVRKLAAEWEMRLRVVAGDILAPRRNSARQEGEKKKEVLHTP
                     GVLTGGLRKLSILGDKTGCESILLELKSRFPPSLSSSSSDAASSSLPTVSPSEWRTLY
                     DYSLRSVVRWLSLNIYRAPTAQGEILSAISSLKRLISGMQSQGVPAGEQTALVLLDAG
                     RYTSSPAAVQDQKVREGFEDLTRVILGGGYGIKRRDVGGLGLGWEGLKVELPTQVKLA
                     VIEMMGREGNLWGMITAFEKMYPDLSVPSPAPASATTPTSTMMATSASVVGEFQENMM
                     EAEATTAKLTPEEVIEEEIPTLSSMMAKERAARAERDWLGRVRHSDTDASDISASTSA
                     NTAILAESAESAESTEPAEMVEHEPSYRRSFSTYLPSIPMPLSLLPSSSSSSSEPARA
                     CVNLADFDDANSIPPDYMIKTMLHYIYLHRHPDPEAVFHGGRGRPNVREMGLYVCRAG
                     LRFAALEQVRWLSQIVTTFFSSTLDSTFSRPTLKITQPRIHPNPLWFNTALRIVLSSA
                     GRNKKAIGKTVVLKEEIETLERRLEEEIRVLEMLRTSGANAANVVNASATGDESSVDT
                     SEGQLNDITTSTPSLTPNSNINIDIRTHLESLQTKLDQLASLKEEIQHRQEVVLAGKR
                     RAKDRAAEAQAIEAAETRALIEARADEAVAAAGSKSETKMKEKEQGREVDVSGVALG"
     gene            <16399..>18264
                     /locus_tag="CNE00100"
                     /db_xref="GeneID:3257947"
     mRNA            <16399..>18264
                     /locus_tag="CNE00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_570697.1"
                     /db_xref="GeneID:3257947"
     CDS             16399..18264
                     /locus_tag="CNE00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570697.1"
                     /db_xref="GeneID:3257947"
                     /translation="MLRTSRLIPLKKDDGSIRPIAVGELIYRLCAKALIISHFQPDFL
                     LPFQLGVKSIGGVEPIVRLTERVLEGSAGAEFSFLASLDASNAFNRVDRAEMAAAVKT
                     HAPTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDPFGPLFFSITLRPTLNALSQSL
                     GPSTQALAYLDDIYLFSNDSQVLSKTTQFLADKQHIIKLNEKKCKLISFDEIRQEGFK
                     MLGTMVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQHALLLLRFCIQQNLRHLQRSLR
                     SDDLVDLWERLDTMLWEEVKRMRMRQREDTVEEEALGRSLTKLPARLGGLGLLSFKDV
                     APLAYRSAAEASDTLLDNLGLLSSPEEPPTPIPQRTRCAELWESQQEAILHNLGDTER
                     KRLTENASRLGRSWLSVIPYLQPLRLSNVEIASGLHDRTLVGSSIPVCRFCGSDSPLG
                     HDELCRARNPWTQRRHNAINRVIYQHLKQIQGATVEIEPHTLSGQRRNDLRVRGSSAL
                     AFTDYDLKVYSLGDRDARSTVTPCAPNGKLADFCLDRCVNWLDKVGQVVSKNAPKVTG
                     GVFKPIILSTGGLMSRSTADDWKDWREAMPVGGFEKMEKRIGVELVKARARTLVL"
     gene            complement(18317..21323)
                     /locus_tag="CNE00110"
                     /db_xref="GeneID:3257899"
     mRNA            complement(join(18317..18516,18572..18862,18908..18974,
                     19024..19165,19215..19228,19276..19583,19632..19742,
                     19792..19829,19875..19885,19931..20263,20320..20467,
                     20523..20528,20574..21323))
                     /locus_tag="CNE00110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657135.1"
                     /db_xref="GeneID:3257899"
     CDS             complement(join(18431..18516,18572..18862,18908..18974,
                     19024..19165,19215..19228,19276..19583,19632..19742,
                     19792..19829,19875..19885,19931..20263,20320..20467,
                     20523..20528,20574..21283))
                     /locus_tag="CNE00110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512949.1"
                     /db_xref="GeneID:3257899"
                     /translation="MSAQDHLDSPELRFPSAEINDPTPQRKSGELDDTKVKRATVACN
                     ACRARKIKCSGDKPICTTCAKGSVRCEYPTVRKRKRDSTKKKKDSGSDQLDPALAAPL
                     FTQTSNMPESTAGTSPLDSNPFAPPFNPFAVTPQHASTSFVAHSIPDWAQSPWKNITG
                     GDIVGQGMDNVDQSTLDILSWDLGAKFPSGTEPGTGNHTSTSDIDSGRMWENTSSTSN
                     VDRRSGAHRKARFRVPYFRFFGPTAIAPGYRQVVCDVSAPVSPTRAPSDLPWDPMLQN
                     DQMIMASDGESPSIDALKQLLPIFKLHFGYFFPFIDLSIDDQGLLLSRPPSHLLNIVC
                     ALAARHSQVYGMQSLLGGADTGSPREIWASKAKGQVPRNLAVASIEMVQTLLLISWYE
                     FSQDRDGGLWMYSGMALRMGQDLGLDTFKNQIPSSDNPDQHAHQSLRCALFMMDAIMT
                     IGTGRAGMYKTSLDQVPSLPPFTTPSGLTLTNPYPYMTRIFSLADHVTRILVDKCTTT
                     IDEAALEQAQSRLNEFHTSLPADLRFETSAFQKYAAIAQGGAFVLLNLWFHTLIILVY
                     RPSLLVSPIPHESRQQYDVAGKEVSASSAKTILDIAIFAELIDPKAITQPWINYPLYI
                     AARTFLSQIAPSQSGQSADPTAGEIHIAKTARANFQRIISIFDGLQPYWNGVRYIRSV
                     LLQKAEGVSQVSLIDGENDVMSPDTLPPELAAILAGMTNDRRQDVLGMGLTGTMNSPS
                     DNLCSLILGTGTEG"
     gene            complement(22344..24692)
                     /locus_tag="CNE00120"
                     /db_xref="GeneID:3257651"
     mRNA            complement(join(22344..22614,22659..22853,22912..23023,
                     23068..23189,23239..23369,23417..23427,23511..23920,
                     23970..24307,24359..24435,24495..24512,24565..24692))
                     /locus_tag="CNE00120"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_570698.2"
                     /db_xref="GeneID:3257651"
     CDS             complement(join(22465..22614,22659..22853,22912..23023,
                     23068..23189,23239..23369,23417..23427,23511..23920,
                     23970..24307,24359..24435,24495..24512,24565..24620))
                     /locus_tag="CNE00120"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_570698.1"
                     /db_xref="GeneID:3257651"
                     /translation="MLRNTLLKGRAVNWAITACCGSAFLLFGYDQGVMSGLLTGSAFT
                     QQFPEIDTTDGGNGSASLQGTVVAIYEIGCLFGSLFTFFFGERLGRRRCIMLGCTVLI
                     IGATLQTASFGIPQLIVGRIITGLGNGVNTSTVPVWHSETTQATDRGRALAIELAINI
                     FGVMTAYWIDYGMSFVNSPAQFRAPLAIQLLFAIVTILLVLVLPESPRWLLKHGREDE
                     ALEVLNQLSLATGDVRVDSVNLEYAQIRLALEEEMAATVRDKNGDPISAVRACFTIGR
                     ERYFYRVMLGVGSQFMQQLCGINLITYYAPVIFEQSVGLSRDISLLMSGFNGIAYFLS
                     SLIPIWTIDRIGRRKLMLFAAIGQCACMAILAGTTSVSFKGTGIVAATMLFLFNFFFA
                     VGLLAIPWLLPSEYAPLPIRASAAALASASNWIFTFLVVEITPVSISSIGYKTYIYFC
                     VFNACFIPLIYFFYPETAKLSLEQIDLLFTGEKILRILPDELRNLHPGEEHGMVEREV
                     DSRASGDDKDLPITIEHQRPIPFKKEATEKV"
     gene            24563..26222
                     /locus_tag="CNE00130"
                     /db_xref="GeneID:3257955"
     mRNA            join(24563..24926,25015..25098,25154..25552,25597..25701,
                     25748..25845,25903..26222)
                     /locus_tag="CNE00130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657136.1"
                     /db_xref="GeneID:3257955"
     CDS             join(24923..24926,25015..25098,25154..25552,25597..25701,
                     25748..25845,25903..26115)
                     /locus_tag="CNE00130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512942.1"
                     /db_xref="GeneID:3257955"
                     /translation="MESFNAAQKFENGEEVVDLAVAGQPQPEDATPLVSLKTPQLFSL
                     AKQGVIVTGAARGLGLAMAISLLEASAAHVYCVDVLPSPVTDEWDLAQRTAKGFGSTI
                     EYRRLDITDEEAVKSSFADIYSTCSYPVKGLFAAAGIQQMIPAFDYPAKDFRRIMEVN
                     VTGTFLTVQAAAKEMKARKIAGSIVITASMSGSIANKGLTCSAYNTSKSALLQLCRSV
                     AAEWGQHGIRVNTLSPGYIRTAMTDGLLSELPDLEQEWLRGSMLDRLSTPDEYRGPLL
                     FLLSNASSFVTGADLLVDGGHTAF"
     gene            26630..31133
                     /locus_tag="CNE00140"
                     /db_xref="GeneID:3257936"
     mRNA            join(26630..27031,27080..27142,27194..27305,27349..27504,
                     27553..27726,27778..27944,27992..28522,28584..28699,
                     28746..28867,28925..29409,29462..31133)
                     /locus_tag="CNE00140"
                     /product="transketolase, putative"
                     /transcript_id="XM_570699.2"
                     /db_xref="GeneID:3257936"
     CDS             join(26957..27031,27080..27142,27194..27305,27349..27504,
                     27553..27726,27778..27944,27992..28522,28584..28699,
                     28746..28867,28925..29409,29462..29623)
                     /locus_tag="CNE00140"
                     /codon_start=1
                     /product="transketolase, putative"
                     /protein_id="XP_570699.1"
                     /db_xref="GeneID:3257936"
                     /translation="MTATRNTNGHGELNREAHTTNKVVSEKEEQLVLNTIRCLAADLC
                     QQYKGGHPGTVMGASAIGIALWRYEMRYNPLNPDWFNRDRFVLSAGHACLFQYIFLHL
                     SGYEAWTLDQIKMYHSPATSGSMAAGHPEIEYPGIEVTTGPLGQGISNAVGMAIASKQ
                     LAATYNREGLDIVDNKIWCFTGDGCLQEGVGQEAISLAGHLGLDNLILVYDNNAVTVD
                     GRIDNCFTENTSKKLQAQGWNVIDVYDGSNDLAAILEGFDKAKQFKGKPSLVNIRTVI
                     GYSSRKANTGPAHGQALGDDEVAYVKTQLGFDPAQKFVIPDKAYEYFAECKIKGAKAN
                     EEWNEKFEAYSKAYPDLYKQLTDRMNGRFAPDGWETLLPAKKDLPQGDQPTRKSSGIA
                     VQTLVPKNNTFIAGSADLLESTFVNFDGQVEFQNPSSGLGDYTGRQIRFGIREFAMVG
                     LGNGMAAYHKGMFIPIMSTFFMFWIYAAPAARMAALQHLRFIGVATHDSIGIGEDGPT
                     HQPIALAAFYRALPNINLIRPADAEECMGMWLLALSDQSANTPSIFALSRQPVPLLSG
                     TDRTKVAQGAYIVYGDDRSPDMTIIATGAEVARAIESAKLLKSVKKVRVVSMPSQKHF
                     DIQTAEYKELVLKSSTALVVAIEAWASYGWARYAHASLSMQTFGHSAPQQQLYEHFGF
                     SPKAMAEKIDEWAARWQTKGGRPGLGDFEELLLRYTQH"
     gene            31336..32170
                     /locus_tag="CNE00150"
                     /db_xref="GeneID:3257532"
     mRNA            join(31336..31422,31506..32170)
                     /locus_tag="CNE00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_570700.2"
                     /db_xref="GeneID:3257532"
     CDS             31562..32044
                     /locus_tag="CNE00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570700.1"
                     /db_xref="GeneID:3257532"
                     /translation="MSANAQSRPEPIPVPGASHAPVSPTSLPSDVATSPNARRKSNPS
                     PPIDPSKLNNHPAPLPEQPESPKAEPRSPPLRSPQNSTSPHSVTAADSAYLDTGLPAE
                     PASHPTVAETGALSSSHETGPRQGQLKRVEKKGDGGIIKLGSLGGDGLKIKPPVDRED
                     "
     gene            complement(32227..34506)
                     /locus_tag="CNE00160"
                     /db_xref="GeneID:3257520"
     mRNA            complement(join(32227..32581,32636..33928,33986..34506))
                     /locus_tag="CNE00160"
                     /product="expressed protein"
                     /transcript_id="XM_570707.1"
                     /db_xref="GeneID:3257520"
     CDS             complement(join(32248..32581,32636..33928,33986..34383))
                     /locus_tag="CNE00160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570707.1"
                     /db_xref="GeneID:3257520"
                     /translation="MFGGLLQLLPTRQSLSSIKAILRWRSKPLHVALNPLDRNLYLSP
                     ASASSAVYQHQSSCLLRTCSRVTYEPAQLFATIGLGSRYIHSSGGTGNSVVKILKDIG
                     ELNNRVSAENSKTEKQNIIAGYPWLRELLEYVYHPDHRTYMTFSSLKSFIDNSPKSFK
                     SIDLPSVATSDLSLIELFDLLSQKAVTGHDAKRTVVAFLKANGVIGNDELLKTFGRLL
                     DRNLVAGFGAKTLVNVPWVEGESELSNTVSPPSLSKKYPSTQITSSSKPSQLASSPRP
                     ISPSVSGVTPILPTFRPLDKFEVALGKSLEPPFSSLFKSEPVWYASRKLDGVRCLSFI
                     DVLVPSSSSKPLEFVHGHFVSRSGKPFHSLTKLSEQLRLLVKDHPDNPLREWLKNDPE
                     VVEIRETGVVKRLVLDGEICLMRPKTEEELKVVQPRDDGSAADKMWIASDPFIEDFPS
                     TVSAIRKSGTIQHLSYFVFDVLSWAEVYAKQGLLRPGLGKKFSERIADVERLGNWLNK
                     SLALEGIDEQERIMRALVQCKVERPEDVEDMVKRAANEGWEGLILRADQLYKGKRSSD
                     VRKFKKWQDAEYVVKSADTNIMRLAINGVFDEHEALASVWIEHKGHPVSVGSGFSAEE
                     RLRYAEKPEEIVGKTITVEYFSESEAIGREGAKSLRFPRVKAIWGGERDL"
     gene            34761..37948
                     /locus_tag="CNE00170"
                     /db_xref="GeneID:3257681"
     mRNA            join(34761..34911,34980..35160,35211..35256,35316..35581,
                     35655..35724,35774..35846,35901..36227,36278..36385,
                     36444..36632,36695..37043,37117..37243,37305..37316,
                     37366..37460,37521..37581,37642..37948)
                     /locus_tag="CNE00170"
                     /product="cobalamin synthesis protein, putative"
                     /transcript_id="XM_024657137.1"
                     /db_xref="GeneID:3257681"
     CDS             join(35426..35581,35655..35724,35774..35846,35901..36227,
                     36278..36385,36444..36632,36695..37043,37117..37243,
                     37305..37316,37366..37460,37521..37581,37642..37766)
                     /locus_tag="CNE00170"
                     /codon_start=1
                     /product="cobalamin synthesis protein, putative"
                     /protein_id="XP_024512817.1"
                     /db_xref="GeneID:3257681"
                     /translation="MPVPTDEDKRLPVTLLSGFLGSGKTTLLSYILKSKEHGLRCAVV
                     VNDMGSLNIDAALINNHKLTQKEEKVVQMQNGCICCTLRADLLEEIATLAEAGQYDYL
                     IIESSGISEPIQVAETFTTEFAETMGEGTVEEIIDSLPEDASTTPESRRRLAELIHAG
                     GLSKVARLDCCVSMVDCTTFLDDFDTTDFLTDRHGKEVAPEDERNITDLLTDQIEFAN
                     VILLNKTDMVSREHVAKVEGLVKTLNPTAKIILTSYSKVDLKDILNTRLFDFGKAAMG
                     AGWLQSLRENTLTEFTDARGNKKMVPKPETLEYGIGSFVYTARRPFHPRRLWDLVSKP
                     FCILQTTFEDDEDQDSDEEDEDDEMIQELTEEEGKQAMFEQMQKEKAELDLPGRAKYK
                     RESPIWKGLLRSKGFVWLATRPHVHGEWSQAGIMFTLNGGGPWMCRIPESEWPGGDDQ
                     EVIDAIKLDFMGPWGDRRQELVFIGQNLDKELITKTLNNTLLNDKEWAQWEKIMNSRR
                     SEEKKLERLCNVFDDGWEAWMDPEASVEEEEVNEGHRHAHAHDVPLVTKKAKLSA"
     gene            38007..38114
                     /locus_tag="CNE00180"
                     /db_xref="GeneID:3257862"
     tRNA            38007..38114
                     /locus_tag="CNE00180"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:3257862"
     gene            complement(38764..45539)
                     /locus_tag="CNE00190"
                     /db_xref="GeneID:3257600"
     mRNA            complement(join(38764..38965,39018..39256,39312..39399,
                     39447..39583,39637..39777,39836..39941,39998..40147,
                     40212..40489,40541..44375,44433..44489,44550..45217,
                     45292..45539))
                     /locus_tag="CNE00190"
                     /product="structural constituent of nuclear pore,
                     putative"
                     /transcript_id="XM_024657138.1"
                     /db_xref="GeneID:3257600"
     CDS             complement(join(38828..38965,39018..39256,39312..39399,
                     39447..39583,39637..39777,39836..39941,39998..40147,
                     40212..40489,40541..44375,44433..44489,44550..45217,
                     45292..45490))
                     /locus_tag="CNE00190"
                     /codon_start=1
                     /product="structural constituent of nuclear pore,
                     putative"
                     /protein_id="XP_024512820.1"
                     /db_xref="GeneID:3257600"
                     /translation="MSTLPIQQWDPDQFSDLQHILARVLTQPTTSSLRKLYATLEQAR
                     PWLLNLTALPGVNDKDKQFVEKNPIELANGTSINVTGDLLNATNALSSFLSLSHLFSS
                     ILSLQAETHRAVYPSRSTPEISIYLLHRWQTDLLDFLKELLKVVLEQGDMMGSGWEGL
                     KEFVEDLLGAKVTLADGGGKEGTLVDQILSQLSILQTKISSLLSTSSSGQGYELQQFR
                     LTALRAEQNKLAGILALIAEGGRLGRGQVIRVLKWLAKVERMDAVVGLVAASVWAAWK
                     PLEVLDASDARYDVAEDWCHDIKFLKLASSLALQERWAIPRLRESIKLSWSLFYLSCI
                     KHDPSVIQTGIDQHEMEGWLLDSIANGAFQFLHELVISIRQERGWDEPDEVKEAGTDS
                     LVKVALASDKGNDEFLFRQLQDLVDILAGKKQFLRNLRNREEDALIRRSSIALSHINP
                     NADANVYNYQTFLRLFASIYRSLPPDSALDLWGNPTFTGTILDTRGGFPGPAFWEMLS
                     SISSGPSCAAISYERLKDTRLPWTALFKFYQHYIDIMPHAYEPIKTTRNPPPSLDPMP
                     MEEVEICKGWTEVLSTVVKWSPAARGALLQMKPHPLGVLWDFVNCENVPLHLKAAILN
                     AITAFTSRPSQSQSEGSITTHDPMDDEVLVQSVGFYEKISYRDPNADVRYLEGGRIPA
                     PVGWLIRMGFLEGEAGRYELSRAYVNFLTALLPSPSSSSSSSTSGTVSISSTLGKPTL
                     SSTRPRLSNTLRRGTFQVIDGILLSLKMRRYTRDSERWEVLDGLTAFLERAVLGFDMS
                     ELLNLGSGSGSSSSASSVGGTGGSGRGIGQIALELSEEPGFIVILRLLSERDIFAVLA
                     EVLDSAASLGGNRERKKIVSKVLRQVLRIYHRVMELQLVFADVLLLALTDPSRNPVHT
                     LKRPYGLQPLDNHLLAHLTNVNNIALLIGDDDPMISYLSTKLIALLSNSPVFNRSDLF
                     QGEYKGEVNRLAGVLDVSDDSIRILQGFVRRLDVESEDPEQGVEAVEEIALHGDIEQV
                     KEELPMVIRSVILDILIDGTSSSNTSPNIAHFLLGYDFRHRQFSFSSEEGCLQVVLKQ
                     MLEGAGLAGSTGEGDGILEIHPQLGAKSAELVYQLFSGVLTGRATLAYAMSVTGYSAR
                     QLASLPRQCPEWQGLVPQGSSLSAPSISTTGLGWAVTRDTKVETSSETLVAYLEFQRW
                     IISSASLEIFTYDGHGASASRIAQILFNGQTQALSDSGDVGDGEGENRLPPLLIDLLN
                     SVDVQWVEEPIDNRQLEFYASFDFDAYKRPDVDWWDIKGLGAGLTAFKKQLEGQGAIT
                     QASIPGVDAEAEYVLRRLGGKNRETDVAIAKGNFLAAWNELLKVGLTLLFARHITEDH
                     QEAILFDLLEGLLARLDGEIDLAPGVEDLLCESSLVVMTTLVGVLQKFEGVNLPVEQL
                     GAVLAKVVDAATRPGSTETARGNLYAAITQYLQLIIPANSNIPDDRSISGSTVDPLAS
                     FSSTTMLQRITLQIFAAKKERLVPGLCRDAMDDRDVWKTQCFALLGGVVSICQGERDR
                     HVVAPLISNGYLPLFVRSVKEREGALMECLAPDAENLHAYWVFEAKIAFLIALASTRK
                     GSEDLLDAGIFEIFATCGFINIQLNEGMLDEYAGGEIVERQHRVLVASLQLLTRVLSS
                     LHKSARSGAGHAISFLNAHREAILALVREPQRNLTVTALDECRLVVSILAMVVHKVSP
                     EDLYSPSSFGAFHLAVLSAAAHAFDKNTWVEIAEENSKIESQMVLLNQVLLAFLTAAT
                     NGLKAGSGNPVFITGVQRSHGSAVKYIASAPSLQMAVNLLSDLAETTEEVSNQYEVIL
                     DRMQDGSDLEEEDVEKLRNEFIGDAPLSDDLIKVAFIARSQMLFNMIESLLLLIWRHL
                     LFYANDVRGSLAPIRPENLSPSLSSFAMSQQAQMEASRSNAGTMKMLERVAAGLRGTL
                     IRLDDMEVNLELRRLATGGGARGDAYSGMLVRRLKEIVGGLVGEREIMEEDQQ"
     gene            45710..47112
                     /locus_tag="CNE00200"
                     /db_xref="GeneID:3257766"
     mRNA            join(45710..45777,45836..45906,45996..46141,46380..46642,
                     46735..47112)
                     /locus_tag="CNE00200"
                     /product="transferase, putative"
                     /transcript_id="XM_570715.2"
                     /db_xref="GeneID:3257766"
     CDS             join(45749..45777,45836..45906,45996..46141,46380..46642,
                     46735..46882)
                     /locus_tag="CNE00200"
                     /codon_start=1
                     /product="transferase, putative"
                     /protein_id="XP_570715.1"
                     /db_xref="GeneID:3257766"
                     /translation="MSHLPSEVPMLRLSYNDIHKAIQDTAVEIKKDFAPTLFIAIGGG
                     GFIPARILRTQLKNDVNGKKRNIPIQAVGLVLYEDMGGVEEKVGAEVVRTQWLDFSTL
                     GDNFTHGGLLGRRILIVDEVDDTRTTLMYLVKELQRDINKQLEDVKDEVERERLRAET
                     KLGVFVVHNKLKPKAGTLPDDVAYFSAVDTPDVWLAYPWECDGDIDAHDTLRSENPKI
                     "
     gene            47498..49287
                     /locus_tag="CNE00210"
                     /db_xref="GeneID:3257575"
     mRNA            join(47498..47678,47825..47840,47963..48011,48086..48129,
                     48189..48317,48392..48863,48919..49028,49100..49287)
                     /locus_tag="CNE00210"
                     /product="inorganic diphosphatase, putative"
                     /transcript_id="XM_571083.2"
                     /db_xref="GeneID:3257575"
     CDS             join(47586..47678,47825..47840,47963..48011,48086..48129,
                     48189..48317,48392..48863,48919..49028,49100..49137)
                     /locus_tag="CNE00210"
                     /codon_start=1
                     /product="inorganic diphosphatase, putative"
                     /protein_id="XP_571083.1"
                     /db_xref="GeneID:3257575"
                     /translation="MNTTAVRRLSSTLSHLYKNIPKMAYQTRIIGAANTLEHRVYIEQ
                     EGKIVSPFHDIPLFADESKTILNMVVEVPRWTNAKMEISKEETFNPIKQDIKKGKLRY
                     VRNCFPHHGYIWNYGAFPQTWEDPNVKHAETGANGDNDPLDVCEIGEAVAYTGQVKQV
                     KVLGIMALLDEGETDWKVLVVDVNDPLAPRLNDIEDVERHLPGLIRATNEWFRIYKIP
                     DGKPENVFAFSGEAKSKKYAVEIIHECHEAWRKLVHGETAASTDAYNLAITNTTVKGS
                     KGFVSTNDAAYASVPADSRKPAGPIDPSIDKSFFISSASA"
     gene            complement(49232..49988)
                     /locus_tag="CNE00220"
                     /db_xref="GeneID:3257500"
     mRNA            complement(join(49232..49592,49689..49988))
                     /locus_tag="CNE00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_570717.2"
                     /db_xref="GeneID:3257500"
     CDS             complement(join(49265..49592,49689..49834))
                     /locus_tag="CNE00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570717.1"
                     /db_xref="GeneID:3257500"
                     /translation="MSTPTSNKGRGNPIHRPKDTPFTVHNSILHDQKLRALRAEAEAL
                     RLQLGDKDPKTIVQKHIQRLHTYNEIKDGTQALIGRVRLKFMMHTSSYRDNIDKGLFR
                     SYKVRAHDQPDYQRGPSRARTAAYRLIWKTRGEIQAGSVLQIFRAEVKRAMGEMK"
     gene            49959..51490
                     /locus_tag="CNE00230"
                     /db_xref="GeneID:3257813"
     mRNA            join(49959..50865,50925..51046,51101..51490)
                     /locus_tag="CNE00230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571085.1"
                     /db_xref="GeneID:3257813"
     CDS             join(49974..50865,50925..51046,51101..51466)
                     /locus_tag="CNE00230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571085.1"
                     /db_xref="GeneID:3257813"
                     /translation="MCHDKPPTQKQARDAQAADAPLAWETIPLPPAHVLSHRTPPPPP
                     PLWLMSTTVTDAHCHPTDLAHPPAVYDILALGGLAAMATAADDQAKVEALGRERQWFR
                     GDPGRNEGRGRGKGKGGAGVGVVACFGYHPWFTHRYTLSPPSAIPSRRDHYTSLFLQS
                     APAKSTSSDRPDENTLETLLETLLPFLPDPTPLQPLLHTLRQNLVKFLDEGRLTMLGE
                     VGLDASARLRWPVEARGIWEEMYGKGRKELEPAPGEGEEWKRLTPFKVPIAHQRAVLE
                     AQMEIAIELGVNISFHSVACAGPTMDVLNSMKTKHGPHFIRRVNVDLHSAGGWSPQFW
                     TQAQKSLPNLYASPSIPITSRSPSAPSLIRAIARDRMLVESDTHDARLSTRYVWAATE
                     WVGRLKGWKVEGLDRNRDCPRVEEDWELESEEEAYDHRGKPIDPAPEETWTVRTLERN
                     WARFMRLLD"
     gene            complement(52300..53788)
                     /locus_tag="CNE00240"
                     /pseudo
                     /db_xref="GeneID:3257556"
     gene            54250..59253
                     /locus_tag="CNE00250"
                     /db_xref="GeneID:3257665"
     mRNA            join(54250..54298,54347..54409,54470..54817,54872..56667,
                     56742..58042,58130..58398,58481..58617,58693..59253)
                     /locus_tag="CNE00250"
                     /product="cyclin-dependent protein kinase inhibitor,
                     putative"
                     /transcript_id="XM_570719.2"
                     /db_xref="GeneID:3257665"
     CDS             join(54293..54298,54347..54409,54470..54817,54872..56667,
                     56742..58042,58130..58398,58481..58617,58693..58714)
                     /locus_tag="CNE00250"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase inhibitor,
                     putative"
                     /protein_id="XP_570719.2"
                     /db_xref="GeneID:3257665"
                     /translation="MKFGKTIQSQQVPGWGEYYLNYKALKKIINSYAAGRPASDASLL
                     SLGLRPARLPVAITDTNTTSSLPNSSHPPSSSDVDTDAEHVNIQDLEPLPPQTAPPGN
                     TSSGLMGRNPMESAGRSESFKAHRDVFFFTLQRELEKINAFYLIKERDLRLRLLSLLS
                     NRKRLLQNSSSTTPDTSDGLPPTGARRDAEWASLEEGWRLFERDLGKLQGFIEINATG
                     FRKILKKWDKRSKSNTKELYLERQVEVQPCFNREFIAKLSDIVAANLIDVENGSEHLS
                     TAFLERDPSSFSGANFASTDVMAGGVGVGSNRSVDFDIDSTRALALDALADLEANLIK
                     AISAGHDALIDWVKVAHARQQRQRLSQSTTDPSLMRILWQCALHAPPTLLPFVLSSLE
                     LDYNCIDNINGRSILHKACIVGSLPLVERCVENSPGLVEKNDVYERRPLHYAAMHGFA
                     EIVSFLLQTSSNSSAADHRESAEPSPTDMDGYTPLMHAIQRGHLAVVQIFVSDEITDG
                     DRERITLEPTAMSNDLIPLSLACEHGHVEVARLLLQRGARVIPNSEGLYPQHLAAKAG
                     HSAICQLLVEEGGEEGGGKDRKDKYNLWTPLHHAAIGGEERHLECVKVLVEKGGCDVN
                     VPDEYGKSAGWYAAWFGHVECLNYLRDHGARLGGSGGGDVTATGTGGAGAQVGRRRED
                     GEETEEEMEVDEMGGLGLAADPQMGGLSPGSDLELDPPAEEFELIPSLSLPPPIIPLR
                     VYGHEFLAQRCLIQLSLGHRITSSFPPCNSNTPAHTHSHAPAIKLYSRSGSGQETLHL
                     WSSLKLVMTSKSDISAVPHSVILPLADEREVFSFHAQDLDRFTLELSLYPTFGSKVIG
                     RAILLPGTWKDIKYHKQLQAPLLDHNLKAIGEVALEVSCITPFEGAQLEIGGRVETYW
                     KSKVVKGDSAQDHAHLAPNKPLSVFSSSGAVAGAIGAAAAGAVGHGVGLEEGKVSDVG
                     VSSGADTGMSTVPAAGAASGGGGGESALVTASSLSGEYVHVVVQVTKDGVPVVYPHGR
                     LPVKEFDLGVSDVTYDQFMALATRLGLALQPPSSLSYQSTASDWYNLLSSTLASLTDV
                     LTLLPHEIGINLRLRYTREVDSSSVGKKVGRESGEVNKWVDTVLDSVYEVGKKVGGEG
                     GKARKIIFSSFDPVVCTALNWKQPNYAVFFASYCGVSRQSSLPTSTSIRSSDRDTTHG
                     PSPYITGEHGQGGRPTRRLIPAPREEESDVRCLSVREAVNFAKSRNLLGVILEASTLS
                     AVPSLVASVKDAGLLLAAFGEPADISVLRQGADDGRTIDAFVLEGIMTLTI"
     gene            complement(59485..61692)
                     /locus_tag="CNE00260"
                     /db_xref="GeneID:3257676"
     mRNA            complement(join(59485..59533,59589..59785,59863..60214,
                     60274..60341,60398..60939,60986..61000,61048..61138,
                     61188..61251,61305..61692))
                     /locus_tag="CNE00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_570721.1"
                     /db_xref="GeneID:3257676"
     CDS             complement(join(59514..59533,59589..59785,59863..60214,
                     60274..60341,60398..60939,60986..61000,61048..61138,
                     61188..61251,61305..61527))
                     /locus_tag="CNE00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570721.1"
                     /db_xref="GeneID:3257676"
                     /translation="MTSQPSFHPEPTIIEEKQGAQLDLNETDKQSFEGGGYTAGTDVE
                     ARSSKYADSDAGLVHKKELKKAERRLLWKLDAAILPFATLIYLGAYLDRGNIANARLQ
                     GLQEEVLEGSDTNYSIALACFFVTYIVFSIPGTLLAKYYLPSRSIACGALIWSIAATC
                     QAAAFNKAGLYVCRLFVGIGEAMSGQATVLYLSFWYTKRDLAKRVGLFVAAGTVSGAF
                     GGLISFGVSNITNSPIPQWRILFLIEGCPAVILAVCVFFFMPTRPETSKYLTEEQRTI
                     CLTRLNGENNVEEVGIDWRAVKRAVTDWKVYVMAVEYACINLTLGSVSGFLPTIIKGF
                     GYSNARAQLFTVPPYAVALVFMLLLTTYSDRRQTRGIPIAVVFILGLVGWAVLLSVPA
                     TTHYSARYFACILIVTAGYANLPLLVSWLSGATANQSQRATGLGVINTIGQCLSLTSA
                     FLFPTAEGPQYTKGASINIAFNALGLVIALIMTTYFRWENRRRDKREGGRPPRGTYLD
                     VGDKYDLAPGFRYVV"
     gene            63571..66221
                     /locus_tag="CNE00270"
                     /db_xref="GeneID:3257814"
     mRNA            join(63571..63787,63847..63921,63975..64074,64141..64389,
                     64442..64458,64513..64610,64664..64899,64958..65374,
                     65435..65573,65633..65900,65962..66221)
                     /locus_tag="CNE00270"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_571087.2"
                     /db_xref="GeneID:3257814"
     CDS             join(63649..63787,63847..63921,63975..64074,64141..64389,
                     64442..64458,64513..64610,64664..64899,64958..65374,
                     65435..65573,65633..65881)
                     /locus_tag="CNE00270"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_571087.1"
                     /db_xref="GeneID:3257814"
                     /translation="MSIPYETEKDKSISGGSQGAMTPINGKSGNEVLVTPALGEKGGF
                     EGSGGNPGEGTVHRTLKQRHMAMIALGGAIGTGLFVGSGSALATGGPVGFWLGYVFMG
                     LMVYSMMVALGEMASLYPVAGAFTHYAARFVDPALGFATGINYWYSYAITIPTEIVAA
                     TIVISYWDATTNAAVYITVCFVSIIAINFLGARAYGEAEFWFSSIKIVTIVGLIILGI
                     VLMCGGGPNHDAIGFRYWRDPGPFAQVTIENGAGVIPGRWGQFLAFWNVFVQAAFSFI
                     GTEIIATTLGEAENPRKTVPRAIKQVFFRILFFYVMGTFVISVLVPYTEPDLLNGSGT
                     AAASPFVIAINNAGIKALPSIVNAVLLIAAWSAGNSDLYAASRTLYALALERQLPRVF
                     RRCTKRGLPIWCVTVTALFGAFAYLNTGGEAAEEAFNWLYNLSAITGILTWWAILLSY
                     LRFYYGLKKQGISRDDFPYRAPLQPYLSWLGFIFFTLVTIFSGFTVFLKGNWDTSSFF
                     ATYITIPIFVGCWIGWKVVKKTKIVPLEHMDFTTGRRELDELEALDAERFKAETKYQK
                     IISILF"
     gene            complement(<66242..>67727)
                     /locus_tag="CNE00275"
                     /db_xref="GeneID:36392849"
     gene            66249..68130
                     /locus_tag="CNE00280"
                     /pseudo
                     /db_xref="GeneID:3257840"
     mRNA            complement(join(<66406..66618,66682..66801,66858..66953,
                     67014..67072,67125..67213,67265..67457,67531..>67594))
                     /locus_tag="CNE00275"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658506.1"
                     /db_xref="GeneID:36392849"
     CDS             complement(join(66406..66618,66682..66801,66858..66953,
                     67014..67072,67125..67213,67265..67457,67531..67594))
                     /locus_tag="CNE00275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514358.1"
                     /db_xref="GeneID:36392849"
                     /translation="MDKEQLAFQEEEPRLTLFVRLRHSPYILLPILATTVWFGGLTAL
                     MMLWVDAGKPRYDSEVASIAFISDIGGANEGLFLGICVIVIILYFSSVCVIRWLRWKG
                     RLPENIGRKEKIYGYLTIFFCFVGCAGLFVLAKWNCYDYPTVHWDGTLVFIIGVALSA
                     IFQTLEVWQLNKGHEERKHLKRNTYFKLAIVAGDVILATAFGATYMYCHGKATATNGH
                     TTSQCDDVSSKAAILEWAIAYGLNLYFLTLAADLWPAWKSSKRFLERAEFSEEKGRSE
                     V"
     STS             67075..67871
                     /locus_tag="CNE00280"
                     /standard_name="Hind4"
                     /db_xref="UniSTS:470790"
     gene            complement(68181..71098)
                     /locus_tag="CNE00290"
                     /db_xref="GeneID:3257734"
     mRNA            complement(join(68181..69081,69146..69561,69633..70055,
                     70112..70726,70792..71098))
                     /locus_tag="CNE00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657139.1"
                     /db_xref="GeneID:3257734"
     CDS             complement(join(69268..69561,69633..70055,70112..70726,
                     70792..71022))
                     /locus_tag="CNE00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512821.1"
                     /db_xref="GeneID:3257734"
                     /translation="MPAPQMMGIYPSESIQEVAQSLPLDPLGPGAATLLAGDVEYRLH
                     LILQEAKKFMVHAKRSTLMPEDVEHALEALNVEPILIPPRPLALPSFHPLNLPPPAAN
                     MPPQTIYTTTDDEIDFASYLKEPLPAGIASSAGVKWKAHWLAVEGVQPAVPENPAPSS
                     IHAGAGGGAQRVKGAPAPASTTLKPSARAHLPQELQLYFTRLTTALVPPTATLPESEP
                     ERHRLAALASLRNDVAVAGMLVYVVKWLCESIQKCLMAPTASIGHLVDAVGALLANEG
                     LFIEPYMHQLLPPLLSIILTVPLGPHPPQPASSSQPSPTEIRSRASDVLSKIASTYSP
                     SYPGLIPRLVSTLTKALHSPPFPSPLGAANPPTGRYEGAILGLGGLGPQAVRVGIWGE
                     KGEGVKRIDELAGRLYSEAGKRKNPLVRATIKALAQIIPPKPSNTPTPSLNVEQVTEM
                     FGPNIAAGLSKKGWTASEMVRMREEELMRAGSSDVSENERIGVDGERQLREAGQGGEV
                     EDEKMEVDTPVV"
     gene            71160..72313
                     /locus_tag="CNE00300"
                     /db_xref="GeneID:3257966"
     mRNA            join(71160..71396,71456..71505,71582..71693,71824..72313)
                     /locus_tag="CNE00300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570727.2"
                     /db_xref="GeneID:3257966"
     CDS             join(71184..71396,71456..71505,71582..71693,71824..72252)
                     /locus_tag="CNE00300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570727.1"
                     /db_xref="GeneID:3257966"
                     /translation="MPPWNAPRTKVQIKLSIQRLRTVQQKKSALAKSSRREIADLLAK
                     GRVETCRLRVEGLIQDDIYVELLELLELYLEMLQARFNILEASPATEPDPSISDAVCS
                     IVYAAPRTELKELQVLREILMHRFGRTFALSLLPTEPPPPTVPARVAHKLKLFTPGEE
                     LVDAYLWEIGKSYKVDWVPERLGGGVSGGEDEGGEDGGGTGVGVKGEGKEDEEDENDG
                     DGDSDGGDVESREKEKESQGSPKKVEIPRETKLTEEEELAQRFERLKNL"
     gene            complement(72244..73638)
                     /locus_tag="CNE00310"
                     /db_xref="GeneID:3257601"
     mRNA            complement(join(72244..72682,72748..73360,73475..73638))
                     /locus_tag="CNE00310"
                     /product="tRNA 2'-phosphotransferase, putative"
                     /transcript_id="XM_570729.2"
                     /db_xref="GeneID:3257601"
     CDS             complement(join(72363..72682,72748..73360,73475..73600))
                     /locus_tag="CNE00310"
                     /codon_start=1
                     /product="tRNA 2'-phosphotransferase, putative"
                     /protein_id="XP_570729.1"
                     /db_xref="GeneID:3257601"
                     /translation="MPRPPEDPDVRNSKTLAYILRHGAEKEGLYIRSDGFIKLADVLA
                     RPKLKGVDEPTILHLVQTNAKKRFELFWGYDPSPPRPKKKPTQGKTKKQLQRDRETAA
                     AAAASAAVAASGTGEGQEKGKEPDAATIDIIASSLASTDLTAPPSSLSINSTAPAPAQ
                     SSTSVDPPELPLISLPDPHTSASDSDANASANSDNPKGEYFIRATQGHSIQLESTAHL
                     EQVKDDEEGKRKVGLMVHGTRWELWDTLKEQGLQKMTRQHIHLAPGFSGPITPRPNST
                     LYIYLDLSKLVAAGIPVYVSANGVVLTPGSKGGENGEGAGVGKEFWRRAVRRKEGKRW
                     VVWEDGREVEREELSGEE"
     gene            73819..75885
                     /locus_tag="CNE00320"
                     /db_xref="GeneID:3257709"
     mRNA            join(73819..74926,75014..75142,75226..75885)
                     /locus_tag="CNE00320"
                     /product="expressed protein"
                     /transcript_id="XM_570731.1"
                     /db_xref="GeneID:3257709"
     CDS             join(74063..74926,75014..75142,75226..75663)
                     /locus_tag="CNE00320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570731.1"
                     /db_xref="GeneID:3257709"
                     /translation="MTRPHAHSTSASQPYHPKPPRLLRRSPSEPVHVNDSLASLNGVN
                     GENRASASPSQQIYVLTADGSRLFLLDPTRPNEEEPPPYASFPIQHIPGNDDDADAGA
                     DVEEDGGVGGGGDMLAPTSSRLLIPGYTSIFAEPSGRHRARTLSALSAERSRPRTSTT
                     TSRPDNRRARSALLTETANPEPPHGHGAYLSAVGPADERTPLLAVAARGGIGDRVSDA
                     DDDAEGEGDGSLGRKSRMRRGWWRGVWCGELEKGEQVGTWSDGWKRFWRPVGKGDYWA
                     SAFHLIFLNFPLALLVWPPLVVGTLAGTALLITLPIGAVVWWITLFIARSAARLETIM
                     QTYYHPLLPSKLSPYHPIFHLPLAPSPLPTPLPSPTSAPPSPSHHSTDSIHSLRDEEN
                     LTATPTQQWDKRFTKCSYAMFLDHYSYSSLSYFLLIKPVITLFSTILIVVVLVLGGVS
                     VVGLPVALRAIKRWGRWQAEVAVENL"
     gene            76117..77973
                     /locus_tag="CNE00330"
                     /db_xref="GeneID:3257481"
     mRNA            join(76117..76335,76427..76539,76669..76851,76923..77973)
                     /locus_tag="CNE00330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570733.2"
                     /db_xref="GeneID:3257481"
     CDS             join(76299..76335,76427..76539,76669..76851,76923..77711)
                     /locus_tag="CNE00330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570733.1"
                     /db_xref="GeneID:3257481"
                     /translation="MVKYDAVILGSGVLGLSIANELTLKGLKVAVVGKDLPEDLDSTG
                     FASPWAGANWYSLAVNEAEQRRDQYTFEQFARLAKEVPHLCERRVYYYFWKGEDAWKE
                     PWYKDVVFGYRMLKPEEVHAPFKYGVTYEAYTLNTPLYLLHLASTLRSVRVPILRARL
                     SSLDEAYSLPQFGPVDLVINATGLGARSLLGVEDPTVFPAKGQTVLVRAPVKECYGLG
                     DPLPQPGQKAYIIPRPGPDGHVILGGCYLPNDWSTNVDPDVAEEILKQCHTLCPRLDG
                     KGGKGTWKDIEVIAHNVGLRPVREAGLRCEVEERVIGEKVKTGLATKGGKVGGGRKVG
                     VVHAYGIGPAGYQASLGIAKEVSELVDGWMKKSSKKAKL"
     gene            complement(78028..80751)
                     /locus_tag="CNE00340"
                     /db_xref="GeneID:3257757"
     mRNA            complement(join(78028..78110,78219..78819,78885..79103,
                     79184..79356,79415..79531,79596..79906,79962..80049,
                     80121..80323,80377..80450,80519..80607,80702..80751))
                     /locus_tag="CNE00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657140.1"
                     /db_xref="GeneID:3257757"
     CDS             complement(join(78471..78819,78885..79103,79184..79356,
                     79415..79531,79596..79637))
                     /locus_tag="CNE00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512948.1"
                     /db_xref="GeneID:3257757"
                     /translation="MLGSLNNYTIAFVMTLEETERGARTSTQSGAQHLRNAMGLAGPE
                     HSHLWRKIHAINHWLCLQGRTALWDELKSQYLAAVGARQAHLLQQMWTSPVMAGEDRN
                     PRTFISRGKPTDPTQTTGVTVNSQVSSMPLHTSSSPPLSPSTSAHSPERQGKSGAKTT
                     RRYKGEDRRAVDDALVNTVAAIKIEYEQNEHHVIILGHEGDSDGAEEVVKSKKEGKQK
                     SGGKKEKKMHKFELCKGLWQEVEKRLQKDDRIVNLGANNRSYWAATFQQLRSEWYNPI
                     DQVIDKSGRNWIDNKLQLSEEDC"
     gene            80941..81799
                     /locus_tag="CNE00345"
                     /db_xref="GeneID:36392850"
     mRNA            join(80941..81195,81249..81799)
                     /locus_tag="CNE00345"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658507.1"
                     /db_xref="GeneID:36392850"
     CDS             join(81083..81195,81249..81579)
                     /locus_tag="CNE00345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514359.1"
                     /db_xref="GeneID:36392850"
                     /translation="MRGETTIKKPCQQRPWTHVMLLRPPNLYSAMLARMKTLHVLTLG
                     RPKRMERGRQLPRQIRHWVDVIDYRTDGIRSKRSPVCAAEASQDCCLARRLSGQEDVR
                     SQISMLEAAIACRGHLCIFLPKFRCELNPIEMRRDSNCCEDCFLK"
     gene            81964..84932
                     /locus_tag="CNE00350"
                     /db_xref="GeneID:3257577"
     mRNA            join(81964..82329,82401..82673,82848..83041,83166..83220,
                     83321..83452,83551..83688,83782..83920,84055..84159,
                     84274..84356,84449..84932)
                     /locus_tag="CNE00350"
                     /product="Mitogen-activated protein kinase CPK1, putative"
                     /transcript_id="XM_571094.2"
                     /db_xref="GeneID:3257577"
     CDS             join(82523..82673,82848..83041,83166..83220,83321..83452,
                     83551..83688,83782..83920,84055..84159,84274..84356,
                     84449..84657)
                     /locus_tag="CNE00350"
                     /codon_start=1
                     /product="Mitogen-activated protein kinase CPK1, putative"
                     /protein_id="XP_571094.1"
                     /db_xref="GeneID:3257577"
                     /translation="MSTSTRRHVLEDKLANHKADPNAAANAGQVQERTTKGSSSSAPR
                     KVRFNVGNNYHVVDVIGEGAYGVVASAVHRPSGTKVAIKKIAPFDHSMFALRTLRELK
                     LLKYFAEEGVSENIISVLDIIKPPSYDTFKEVYLVQELLETDLHRVIRTQDLSDDHCQ
                     YFLYQTCRALKALHSAEIIHRDLKPSNLLLNANCDLKVCDFGLARSTQTAFPAEGNNQ
                     GFMTEYVATRWYRAPEVMLSFRMYTKSIDVWSVGCILAEMLSGKPLFPGKDYHNQLAL
                     ILDVLGTPTIDEFHAITSKRSKDYIRSLPFRKKRTFESIYPSANPLAIDFLRKTLTFD
                     PRKRYTVEQCLAHPYLDAYHDPEDEPSAKPLPPSFFEFDMMKDDISREELKRLLYEEI
                     MGFRPVLEG"
     gene            85184..88069
                     /locus_tag="CNE00360"
                     /db_xref="GeneID:3257984"
     mRNA            join(85184..85492,85621..85800,85897..86021,86088..86939,
                     87016..88069)
                     /locus_tag="CNE00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657141.1"
                     /db_xref="GeneID:3257984"
     CDS             join(85353..85492,85621..85800,85897..86021,86088..86939,
                     87016..87956)
                     /locus_tag="CNE00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512824.1"
                     /db_xref="GeneID:3257984"
                     /translation="MDIDDDDAFLYGDEPEQQPQSIAQAQAQAHAQAEAAKESAISAS
                     MAASLAAYGIDASAAVVEALPENPEDGGVEEEDEGDEDEDEESDEDDVKLVFTGGSSR
                     QLDLRKPQQAPAVVGIGKWAHASTGAQAPATPSTPQAGQVTGTPTKSNQNDPGQTTEY
                     TPAPRPSASATPQPQSVNALANPPIAPTSQAPNLQPQPSSITSVVTADANGPPTNPNL
                     PPSHLPPVTNPSANPRFDPSNPSGLIPSSGQSVYDIDLSLFEGSGQPWRQPGAVVSDW
                     FNFGFDEHTFPKWVRYRTEMGENVKSLAAGGGLGAGAGVGGDTMNQMGMNGMNGMTPQ
                     AQAQAQAQAAAAAAAAMQGMGGMGGMMPNQMQAQMQQMQQMQQMQQMQQMMAMGGMPG
                     MQGMDLGMMGQMGQMGQMGGMGGMGQMGQMGQMGQMGGRQGVRPNSNLANNAAAGNAL
                     ANNANPNANTIANSGSGGGQEVKQEEGEHVEQASANPAFAGRAPPPPGRNMNIAPTPA
                     SGAAAVTPNAGAVNPAAATTAATGSANANPNASTAANVPTGPRAATAVPLGPRAGAGV
                     VPTGPKGRFRDKDRVVDVGSASGGALDYGGGDDVMPASASNSNAGSGSGSGMKSTSKR
                     DRERERDKESHSRDSRGRDRARDKDRERGEYDEEGYTSDEKDRERRRRRERSERSDKD
                     KERSDKRKREGGSVSASASLGPGGWEEGEEEEEYVPRERERERTRRKRSESEEDEGYR
                     RSKRR"
     gene            complement(88138..88746)
                     /locus_tag="CNE00370"
                     /db_xref="GeneID:3257664"
     mRNA            complement(join(88138..88288,88398..88541,88628..88746))
                     /locus_tag="CNE00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657142.1"
                     /db_xref="GeneID:3257664"
     CDS             complement(join(88175..88288,88398..88541,88628..88687))
                     /locus_tag="CNE00370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512825.1"
                     /db_xref="GeneID:3257664"
                     /translation="MSATPIPHLYRSLLRELRLASHKSRTSRNPTVNTHIRTLVESSL
                     RDPHALSKILLETRDFLRATRIHADLLKRYNPTHGMSQEERVVATARRVGLNAPKEYE
                     GKE"
     gene            88984..92106
                     /locus_tag="CNE00380"
                     /db_xref="GeneID:3257879"
     mRNA            join(88984..89061,89147..89912,90300..91198,91366..92106)
                     /locus_tag="CNE00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_570741.1"
                     /db_xref="GeneID:3257879"
     mRNA            join(88984..89061,89147..89912,90300..91198,91369..92106)
                     /locus_tag="CNE00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_570740.1"
                     /db_xref="GeneID:3257879"
     CDS             join(89032..89061,89147..89912,90300..91198,91366..91878)
                     /locus_tag="CNE00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570741.1"
                     /db_xref="GeneID:3257879"
                     /translation="MTDPHKPRPKVTSHISSTPSHSPSTTYRASVRAKVTPSAITASQ
                     TTPGASSRPSLKTTSSSSSLRSHVSASSANTPRAGARSPLPRTPSTPASVPQARVTKP
                     FQPQRSPLTPGFAPNSGNPSSSSSASALGVASGTPVAVPRVRTARSALGVSTVSGVSN
                     SSASKGKNNTENGNGSASGSGYDGSNGYGQTPAAPVVGTSTTNASMYSTRTRTDSLKS
                     TSSVGDRAPRVRVKLQPQPQSQAQTWLHPKSSSQFTSPPSTSSPSPTPQAQTQNQNQN
                     RSTHLPPHVPYHLLTNPTASAPTSPTPFTQPQSPDIQPTSQGPHPPSPLSSTSAMTTS
                     FTATTMTTKRRTSKPRLPPMILHPSERQQALKEGRKVVGWLGMGGVGRGMRMMPGSPE
                     RKTVELPDLTPAAPGTPGLEEKGEEEWEGENGLYADERGEQGDLGREEYQSLYENGNE
                     NDNDNDDKHGCEYKHRYEYDYVKDNENGERYSIENRNGKRNAEQVEVTSVLPIVGDRQ
                     DSSKGGEEGEAKRKCVGENGVEAEAEAGAGTEIGGEQEQEVDDMLVTDAVEAKINRKQ
                     VADLEISNASLLAINKSLEATKSKQRAEIGKLRRRLRETLAFPHLGSEAPGGSSSGLD
                     FGLGLGVGASSLEEEADPESEHDLSLFLLHEAEMADPQLDARWSKMEDLVVGMKKAAE
                     EALRRGEEEGSREGRGRVLGWAEMEEMEEVEEGDVSFTSEGAGERSEEEGTVS"
     CDS             join(89032..89061,89147..89912,90300..91198,91369..91878)
                     /locus_tag="CNE00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570740.1"
                     /db_xref="GeneID:3257879"
                     /translation="MTDPHKPRPKVTSHISSTPSHSPSTTYRASVRAKVTPSAITASQ
                     TTPGASSRPSLKTTSSSSSLRSHVSASSANTPRAGARSPLPRTPSTPASVPQARVTKP
                     FQPQRSPLTPGFAPNSGNPSSSSSASALGVASGTPVAVPRVRTARSALGVSTVSGVSN
                     SSASKGKNNTENGNGSASGSGYDGSNGYGQTPAAPVVGTSTTNASMYSTRTRTDSLKS
                     TSSVGDRAPRVRVKLQPQPQSQAQTWLHPKSSSQFTSPPSTSSPSPTPQAQTQNQNQN
                     RSTHLPPHVPYHLLTNPTASAPTSPTPFTQPQSPDIQPTSQGPHPPSPLSSTSAMTTS
                     FTATTMTTKRRTSKPRLPPMILHPSERQQALKEGRKVVGWLGMGGVGRGMRMMPGSPE
                     RKTVELPDLTPAAPGTPGLEEKGEEEWEGENGLYADERGEQGDLGREEYQSLYENGNE
                     NDNDNDDKHGCEYKHRYEYDYVKDNENGERYSIENRNGKRNAEQVEVTSVLPIVGDRQ
                     DSSKGGEEGEAKRKCVGENGVEAEAEAGAGTEIGGEQEQEVDDMLVTDAVEAKINRKV
                     ADLEISNASLLAINKSLEATKSKQRAEIGKLRRRLRETLAFPHLGSEAPGGSSSGLDF
                     GLGLGVGASSLEEEADPESEHDLSLFLLHEAEMADPQLDARWSKMEDLVVGMKKAAEE
                     ALRRGEEEGSREGRGRVLGWAEMEEMEEVEEGDVSFTSEGAGERSEEEGTVS"
     gene            complement(92414..95249)
                     /locus_tag="CNE00390"
                     /db_xref="GeneID:3257925"
     mRNA            complement(join(92414..92855,92921..92930,92993..93073,
                     93131..93140,93203..93344,93422..93543,93607..93652,
                     93714..94033,94086..94138,94194..94261,94311..94415,
                     94471..94540,94595..94689,94743..95249))
                     /locus_tag="CNE00390"
                     /product="multidrug transporter, putative"
                     /transcript_id="XM_570743.1"
                     /db_xref="GeneID:3257925"
     CDS             complement(join(92641..92855,92921..92930,92993..93073,
                     93131..93140,93203..93344,93422..93543,93607..93652,
                     93714..94033,94086..94138,94194..94261,94311..94415,
                     94471..94540,94595..94689,94743..95097))
                     /locus_tag="CNE00390"
                     /codon_start=1
                     /product="multidrug transporter, putative"
                     /protein_id="XP_570743.1"
                     /db_xref="GeneID:3257925"
                     /translation="MSTIPAVPKEVPADAGRSSTSTIRGEVFNPVANHERLMNDPAGM
                     MNKDPKNTQISHLEGHTRPQHRRGDTGDGRHILQEEEAPEVLGFAWSSRKKWTTLTVI
                     FIVQCSMNYNAAVYANGTAFLQEKFDISAQAARVGQMIFLISYAFGCEAWAPWSEELG
                     RRWVLQLSLFLVNIWQILAALAPNFGSVIVARFLGGISSAGGSVTLGMVADLYDPNEQ
                     QWAVAFIVFSSVGGSVIGPIVGPFIAAHLDWGWICWTQLIFGGFVQILHLLIVPETRA
                     TILLDREAKRRREAGEHNIYGPSEIKTFKEKFSLHEMAKTFCRPFVMFVTEPIVLCLS
                     LLSGFSDALIFTFMEAFTPVYEQWGFDTVHMALAFVPIAIGYFLAYLIYIPPLMKQRK
                     VLRENPDAAPELRLHPLLYLAPLETIGLFGFAWTSLGPPHVHWIAPMIFSCLVGIANY
                     AIYMSTIDYMIAAYGPYSASATGGNGMARDFLAGVAALYATPFYTNVGGSSYRLHLEW
                     PSTILAIIALLVAIPIYIFYYYGAWFRQRSKFAMSLAGERLERRVSRLEEKKMDA"
     gene            complement(99517..100692)
                     /locus_tag="CNE00400"
                     /db_xref="GeneID:3257934"
     mRNA            complement(join(99517..99763,99831..99881,99948..100112,
                     100175..100385,100455..100692))
                     /locus_tag="CNE00400"
                     /product="expressed protein"
                     /transcript_id="XM_571096.2"
                     /db_xref="GeneID:3257934"
     CDS             complement(join(99652..99763,99831..99881,99948..100112,
                     100175..100385,100455..100557))
                     /locus_tag="CNE00400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571096.1"
                     /db_xref="GeneID:3257934"
                     /translation="MFNKLALIALLPLAFSAPTKRWSETLNCVQFQYGGPFTSSGSRG
                     FIHLYSNITSFDSSTQHTDYNETRLGLAEDGTIENCGECRTTELFGFEVCQDDQRNGF
                     DGLGNGPSGFYGHVTYTNVSPNIQCLTASKSPYEGASLKLADCQYDYDSAATSGQYFE
                     MTVTDGVYHALLIDGSNSYGPTPELNNNASLVLYNVVGPNTTFTSFGFKAPVF"
     gene            101797..105844
                     /locus_tag="CNE00410"
                     /db_xref="GeneID:3257808"
     mRNA            join(101797..102237,102294..102698,102762..102777,
                     102830..103178,103237..103271,103332..103572,
                     103644..103685,103739..103791,103848..103885,
                     103958..104084,104141..104219,104291..104474,
                     104557..105844)
                     /locus_tag="CNE00410"
                     /product="expressed protein"
                     /transcript_id="XM_024657143.1"
                     /db_xref="GeneID:3257808"
     CDS             join(101907..102237,102294..102698,102762..102777,
                     102830..103178,103237..103271,103332..103572,
                     103644..103685,103739..103791,103848..103885,
                     103958..104084,104141..104219,104291..104474,
                     104557..105605)
                     /locus_tag="CNE00410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512951.1"
                     /db_xref="GeneID:3257808"
                     /translation="MFLPTDQPIQPRRKLTRSGEQLKRNAACLPCRRRRIKCDAGKPH
                     CSSCEKSYNFLRRSQPDDERDDGGIRCWYNTEVDEQPVISVKRKKTDDGNEDNPKDEM
                     IKKLEAKVVELQKALAAAPAQTLETRCSGTSDNSSIGQSTKGSRPEVLANPTESLEFD
                     GNNHVPSYNASSQCATVYNKHLSKDLFETQAVNRKTALKSSAEKYAGSADKSPPKNDT
                     VDGEAGSIGQPLLELLWPGWPSTLPMPSTVEHMVDTFFSSVSSIPQILNRTEFLRRLA
                     LLPSHPEFPHRALLHAICAASARFSAAVTTRSIPDMIIKMDIDAKTANGKGCWEDIKD
                     ETCFAERNARYAMRFLDYHHVSGRGLLDICQAMLIIGHWCQNNARWMDAWVLIGDAIR
                     LASCLGLTSFVPRPSQCSPQLRQVILDTPRDDAEREERAATVWMALCYENALMCSSGW
                     SGSMIVDDLTMPLPASRIDREKGGPIPLNPQNYHSPDIYTHHPVADGFVMLCKAKILM
                     GRVARFVRRCRRMSLDEKQTAKNLPEFEALDRDLNLFLANFPPSLRDPVQYMTGHSKV
                     LDADLISAHLVPHIAAIHLHEPFADIADPNCPSARRLLDAAQACLNVLYQMSNLSAPI
                     FYSLTAISSWFFYTGAKTLILFYQHALENSNFQDALTHHQAITAFRNVLIALAPGNAL
                     ASRYDTMLKMMMSSIEEEVLGQSIVLYHHLPSNKHSTQTSNSSSDSSPLSSTSSNPSF
                     GPLTPAEPPEDTYLPALVSCLHPEAMFYLEHIQKKFLERCKNPSEYERRTAFPANDIG
                     RSKSMGRSKEGARKGEGVRSFHEILDIKRGWVGGRKKARIFEPGVGAKADDSGGLMDL
                     GNISSPSQWLNRDQPAMGLRANDRSGSLFYDFSFSPFNTSFPNDDTFALDPLSSTSNF
                     SLQNDMALTLPNLQCTQATLQNWLEVMPSMMSTVAFNSSSGFGPRHSGTHCGSGYISE
                     ETDDKTGSTT"
     gene            complement(106110..109871)
                     /locus_tag="CNE00420"
                     /db_xref="GeneID:3257764"
     mRNA            complement(join(106110..107164,107227..107293,
                     107369..107426,107517..107651,107765..107886,
                     108021..108679,108737..108848,108897..109871))
                     /locus_tag="CNE00420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657144.1"
                     /db_xref="GeneID:3257764"
     CDS             complement(join(106360..107164,107227..107293,
                     107369..107426,107517..107651,107765..107886,
                     108021..108679,108737..108848,108897..109632))
                     /locus_tag="CNE00420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512956.1"
                     /db_xref="GeneID:3257764"
                     /translation="MFSARRQSSTSSSNSAAIPLNHPTAPISNNPSSNEASQGTGSGN
                     GDSPSTSTEGNGKQRPRRKVTIVPPVTAACLDDLRSALPTGTILPKSSQANVPSTPGP
                     HVTTGASTTRTSSKRRRAHTVSVCLPDSAKYVQLEEKDYPAVAQGARAGKRGARRQWS
                     HDIELGMSSTDTNPAHPPSSPVPGGRQRSVSTASQSATYPHRRRRERRASSPGPVGYE
                     MEGRDGDVELGDELVGVLDVVDPQVSTVNHLQNMCNSVMVPYLPQLWTRRPEVQLPST
                     PSDEDVGLLNSTATVTRRRSNTTRSRRRTLSLSRFVPGKSASESTALAAEDDTLPVTA
                     PASWGGAHPLSIMEEEPEFQPQDSTIQSLPSAFATKQLIPSSTTSLPLPTKPTSLTSS
                     PTASTISLRRSTLFDKHIKSVLSTSTRQKILLALQGLWTFVKTPMGFLTAIYGFAVVF
                     WGAAIVLFLLGWIPTSSKYRQDVWVEISSQVENGLFTVTGVGLIPWRVVDTYRMSVIW
                     TLKRRAERRREKMGLPPIEDENDLPDPQDIPGYIHVLDEKETAKLRHHQEKFALSQTW
                     YKPHATATHRAFPIRWALWNTILMDGNSFFQCILCGCMWGMNWHIRPAWTTGSLIPLS
                     FLCGIGAAVLIYCGSVKTKKHQAVSEKLKHAMGIPLAIGQPAVRPPGVGEDPTSKERV
                     KHGGGGSENDIVEERGGGGEGKRAQAQAQAERAPDGGVMVGVGSRDVNGEQLSGGDER
                     DNGKDNEDETEGGKKGDSQGAKQDSLNFLAPLLRRSRHHPQRRATVTFGPTVSTSPHH
                     PLPLHPQPLSYSSRHHPLLQKRHRDNTMSMRLPSPSPSPSSSPSPPLGIKVETETSAK
                     PDHQEKDIPSIGVRRVESDSDEKGDIMLSEENLRRPKESSV"
     gene            110039..115490
                     /locus_tag="CNE00430"
                     /db_xref="GeneID:3257807"
     mRNA            join(110039..110691,110757..111034,111075..111168,
                     111228..111418,111455..112314,112377..112793,
                     112865..112975,113042..113782,113903..114967,
                     115038..115246,115297..115490)
                     /locus_tag="CNE00430"
                     /product="expressed protein"
                     /transcript_id="XM_024657145.1"
                     /db_xref="GeneID:3257807"
     CDS             join(110546..110691,110757..111034,111075..111168,
                     111228..111418,111455..112314,112377..112793,
                     112865..112975,113042..113146)
                     /locus_tag="CNE00430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512826.1"
                     /db_xref="GeneID:3257807"
                     /translation="MTSLFRSRKDKANKTLPATSSKSARATTPNGKDQVKFSEFGTVA
                     NITPRTMPAKHSQPLTPPESPYGTSAPLLPPKYSFCPTQVPLHVNTLNSVDSFNYSAD
                     DVTGLKAYGFLAGVGSRITLGLQEVGWVIKNVGDELEQRGLTTPLLFSNQALELNQTR
                     TRMLIQSFIETLSPNDRMRARQNAFIHDIRFAKEHELAWFLRWALSRITRVKEGTKMI
                     CHGVMEWEVYEEWRGRERAANYPADAFPFLAQLVPPDVYNLILTPLFHLLSRFAAHSH
                     LSGLTPHALSSLFAPLLFDTPTSTTALTSHAIFVRSACATEHLLLASIRSSGTAGTLV
                     TDLPFRLKEWVAGYPSMVVSDADLARGAPRRGSRIIRCERASRTVRAYTKDLLPHVES
                     WIGEVPDGEKWEAWERIMWKARRGSVARPKPSSAWKRRLAVKNIPTPPTRPNDLSHSV
                     SYGVALRPASIMSGVSCTDINKGRDEEEEARYGSLAGKEWSMFEEGGFDAPTEEKRED
                     IDTRLQFDLNESAKLNIAEKRQTMDWNEFAGPSGGFNRNDPFLDVSLSFSPPISSSIA
                     SWPEERDQLAKRLHKAQKDAVPFHYDTLPVFGKDVPFHGDDDWMSLGGRAGGVEQVDG
                     KGVVYVEEAWVDVWADLMLGAGWVDREELTFREANWAIVEYKAKPSKVDSDVILDPMT
                     DPRTSGLYILYEERVPLDYQLAIADPKQKKSFTSSFFFPKSKKRAPLPHRL"
     gene            115618..117822
                     /locus_tag="CNE00440"
                     /db_xref="GeneID:3257638"
     mRNA            join(115618..115719,116114..116389,116473..116520,
                     116572..116899,116958..117422,117515..117822)
                     /locus_tag="CNE00440"
                     /product="carrier, putative"
                     /transcript_id="XM_024657146.1"
                     /db_xref="GeneID:3257638"
     CDS             join(116198..116389,116473..116520,116572..116899,
                     116958..117422,117515..117567)
                     /locus_tag="CNE00440"
                     /codon_start=1
                     /product="carrier, putative"
                     /protein_id="XP_024512952.1"
                     /db_xref="GeneID:3257638"
                     /translation="MSSDSSSSQVPRFHVHPHGAHLDHPAPPIQAGESSLALEEEEEH
                     DYESLPVGSGWAVNMAAGAMAGISEHSAIFPIDSIKTRMQILAPVLHPVTGTTSATIT
                     GTIAPQLNTISQHVRSISTTEGLRSLWRGVASVILGAGPAHAAHFGMYEFVREISGGR
                     NDGWQGVMGTAVAGAAATVSSDALMNPFDVIKQRMQIANSPYSNVLHCARTVYAREGL
                     TAFYVSYPTTLTMSVPFTAVQFSAYEYLKTLLNPSGSYSPSTHVIAGGIAGGLAAAVT
                     TPLDVAKTLLQTRGSSADERIRGARGMGEALRIIWERDGWKGLRRGMAPRVLTVAPST
                     AISWMSYEFFKVLIRQHGSLPETGQSL"
     gene            complement(118527..121016)
                     /locus_tag="CNE00450"
                     /db_xref="GeneID:3257907"
     mRNA            complement(join(118527..119618,119675..120444,
                     120496..120646,120695..120713,120768..121016))
                     /locus_tag="CNE00450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570749.2"
                     /db_xref="GeneID:3257907"
     STS             118991..119990
                     /standard_name="Eco29"
                     /db_xref="UniSTS:470788"
     CDS             complement(join(119385..119618,119675..120444,
                     120496..120646,120695..120713,120768..120967))
                     /locus_tag="CNE00450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570749.1"
                     /db_xref="GeneID:3257907"
                     /translation="MSDQHPPTLVSAAMQTNRSTTVSESSAPPSARSTPGPSAGPSGE
                     GAPAGGIQRMKFKPKVPIRRVKTEAETRTEPAPVVQPPGRGGMNGRGRGGGTRGRGRG
                     GAVVSTSIAAGVFGGPRPAASSSRRFTAAAPAPRTTDYASDAEIYSDHSEEDGFPSMR
                     PIDIDMVSTMSESAPTSIYRDRKLTQGKAKGEKNKKDVKRRAAKKDTGKHRDDGRNGV
                     KDEPMSPRQRERDDDAMMSGDEEQDRDERGRRVRNFMQTGGIDEPEVEEVNAAQAVDL
                     SESESEDEEEDLKGDFISVDGNDPPENKLFIFQFPHLFPKFNPAGPVDLTNPDGDVKP
                     DIKPTAAQLRAKKNVVEPTPEGRVGTMVVMKSGKVKIVMGKDIVMDVNPGVPATFVQQ
                     LVHLDAKQKSAIVLGDVHKNYVVTPDIDRLLQDLYSNGGQTPGDREVEARMKALRMRG
                     LVKMEDH"
     gene            121192..122133
                     /locus_tag="CNE00460"
                     /db_xref="GeneID:3257729"
     mRNA            join(121192..121430,121481..121543,121601..121792,
                     121844..122133)
                     /locus_tag="CNE00460"
                     /product="mitochondrial fission-related protein, putative"
                     /transcript_id="XM_024657147.1"
                     /db_xref="GeneID:3257729"
     CDS             join(121298..121430,121481..121543,121601..121792,
                     121844..121920)
                     /locus_tag="CNE00460"
                     /codon_start=1
                     /product="mitochondrial fission-related protein, putative"
                     /protein_id="XP_024512828.1"
                     /db_xref="GeneID:3257729"
                     /translation="MPTDLPYAAEAESSLSPDELEVLRRQYYREIEQGHVTIQSKFNY
                     GWGLIKSPSPELETEGVKLLQEIYSASPDHRRECTYYIAVGYYKLRNYAYARKFNNLL
                     LSVEPGNMQAQSLSTLIENAVKRDGLVGIGMITGAVAVVGLIAGSVWKRSRR"
     gene            122984..126024
                     /locus_tag="CNE00470"
                     /db_xref="GeneID:3257672"
     mRNA            join(122984..123151,123205..123935,123986..124481,
                     124531..126024)
                     /locus_tag="CNE00470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657148.1"
                     /db_xref="GeneID:3257672"
     CDS             join(123853..123935,123986..124481,124531..125934)
                     /locus_tag="CNE00470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512953.1"
                     /db_xref="GeneID:3257672"
                     /translation="MIPAPPYSTENSIPSPTVPYISLGRPASTTPRSRAILSTFPNHT
                     TMPPPSSIPNANSRKRKILPMTRSQDSTPSSPALSESSSLVSDDGDGEYAPESVRPIR
                     KAKRPRDNDFKLNSGGRSGATTNSHGNSNGATGKNCKVKGKDMSREQLRKVNHSLIER
                     RRREKINAALNELRRMVPSLGENGGKGGEFKLEVLEKTVEHMKDLKGRLEDLERGAAA
                     SANNSSCESNARGKDRETELEVESRSRSKTSTYPSPSPDRQQFSNSPPPDPNETDVES
                     NLPPPYTLASRARARSRAHASSLPSTSACISASNRGTTTSQESKSPSFWSGQTQEQVT
                     ENLHGQRGYQPLPSTRPKPPTSTSNPIFLPFPSPSPTSPFLHPNASFNTNPNADTLNN
                     SSAAGSMMSGENEGRGFGPNYNSSASVNGSVQGAAEARNTHPSPFLPPIPNMSLFSIM
                     SLENSPVDTFRQACMEGFGGAGKSGSFSPPELNLEDTSQTARRSSFAEPRGALDVGMS
                     TMNTDVKERRHDTNDKSTSIDSDKNRNKHQDDVTTKAGANTNANTEMLPEEAANLLLA
                     FSSPETLRPLGDVPVVPLAGQGYGQGQGQIRRTVEEFSLDSGAALGSESGSGLGAVRA
                     IKTGKGREVSSVKMMGSTSKDRLVVGKSVRDMLKLT"
     gene            126948..128406
                     /locus_tag="CNE00480"
                     /db_xref="GeneID:3257942"
     mRNA            join(126948..127131,127219..127384,127445..127512,
                     127570..127679,127750..128406)
                     /locus_tag="CNE00480"
                     /product="expressed protein"
                     /transcript_id="XM_571112.2"
                     /db_xref="GeneID:3257942"
     CDS             join(127108..127131,127219..127384,127445..127512,
                     127570..127679,127750..128359)
                     /locus_tag="CNE00480"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571112.1"
                     /db_xref="GeneID:3257942"
                     /translation="MPPHGHRPASPPNRSQTSSPIRPAPNAPYHPPADTSTYRDLLLF
                     EERLKSNAEMLRRRRRRYSIFMWSFLLVLVGMGHMLFWHPPESILMLRALEASVAVVS
                     ITLVLFFASGMYEEKIRYATSYINHSNKSLRPLNLHLNMRRPPRFPLSIPFFPSSNRN
                     SSPISPISPSLHKPFLSPKSFPSSLPSGKGAGGGIRRVSNTPNVMAQIPPSTNPRGEL
                     IFSSRVDRTFREGYERYRAAFERRREEKAREEAKRARRGWGWIFKRQGSPTVVSRGAS
                     PSPGLGGQGIKREAREKGTPSPAGTPKSTIRGVGMAKRSLSPSGLGEKT"
     gene            128553..130007
                     /locus_tag="CNE00490"
                     /db_xref="GeneID:3257692"
     mRNA            join(128553..129210,129297..130007)
                     /locus_tag="CNE00490"
                     /product="expressed protein"
                     /transcript_id="XM_571115.2"
                     /db_xref="GeneID:3257692"
     CDS             join(128605..129210,129297..129926)
                     /locus_tag="CNE00490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571115.1"
                     /db_xref="GeneID:3257692"
                     /translation="MSTLSCQTCSSTLLPSHLASAFSPTCCNNPICSRCLEKNPRLRE
                     YVPCLRCGDPRNAMSGGASSHQDRRGQRGEVVFDVTDLGLDLGLGLDEHNGAEEDEID
                     ALPPPPGYDEVVVETERMEFTPTAGVPSIEKVENNIGDSIGGSSSSSEPSRLDSFVPT
                     KNVQDSSHIQKKANTNTETVQVIHKIQRGDTLLSIARKYAADPHEIIYLNSLPPSALT
                     SYPRILQTRKSLIISQRSIPWIPSSGSPTEHMHIGEEGTEKETEERRRQRQEKRFQLL
                     TKSTDPEIGRAYIGVEEIEEKNLYSSLDTNPNPRHPLEYSTGESLDRPHHQSNPIKHI
                     VGGIENEMEKSKKMVVPEEGNREERALGRFWDDELWEVENGTSLDKERRKIGKWNVVG
                     GDIAINFTPPGLSSKAVKN"
     gene            complement(129988..132356)
                     /locus_tag="CNE00500"
                     /db_xref="GeneID:3258013"
     mRNA            complement(join(129988..130352,130423..130532,
                     130597..130815,130892..131095,131171..131482,
                     131535..131669,131729..132144,132195..132356))
                     /locus_tag="CNE00500"
                     /product="cop9 signalosome complex subunit 1, putative"
                     /transcript_id="XM_570755.2"
                     /db_xref="GeneID:3258013"
     CDS             complement(join(130130..130352,130423..130532,
                     130597..130815,130892..131095,131171..131482,
                     131535..131669,131729..132144,132195..132282))
                     /locus_tag="CNE00500"
                     /codon_start=1
                     /product="cop9 signalosome complex subunit 1, putative"
                     /protein_id="XP_570755.1"
                     /db_xref="GeneID:3258013"
                     /translation="MASKRSYTDILASIDPAQFDWPAYEGTYKGRALITRYAHLVNTC
                     VAYPSLSASELAKTALLKLIPLVKSSTWDINTYLWAVSVLFTIVHPGQRWKAAEEMEV
                     DREEDDEGGITKITSRGIPPGEGKEEDGFPDERWINETRDTVAKEVSRLDVELRGYMS
                     NLIKESIRLTQLAFAELAFKVGKVREALNYYAATREYSSTPQHHVDLGVGVVETCLAF
                     NYPAPLSGHIAKLETTLDRLHPPPHTQSKQQAGLSTTASDLRERQAEESRSQAARRSV
                     MVRAKVGKGLISASQKDWARAGRELGWIEEDEGGLGDWEGKAISTSDLALLSAFYVLA
                     SSDRSRIRRVLLDRATFKNQLDDSQGWIVDLVRAYVDANYEQVMSLLQYSEPILLLNP
                     FLSSCTRSIISCIQTRSIIQYVQPFSTIRIQTMTQAFGMEGDKMLDVIEKLIGDGDVG
                     AKIDLIDNVLVMDTPDPRAEMFEKALKAGQRSSELAKASLLRMKLTEAGITVNPHAES
                     ISTEISGKQQQQQQPPLGPDATATSTTTAVQVPGTAMAEDQSAGDVVMQATGEPNGEH
                     VA"
     gene            132564..136701
                     /locus_tag="CNE00510"
                     /db_xref="GeneID:3257704"
     mRNA            join(132564..132853,132909..133329,133380..133924,
                     133981..134180,134232..134412,134474..134589,
                     134645..134812,134874..135253,135321..135353,
                     135406..135506,135578..135787,135846..135995,
                     136059..136119,136175..136275,136349..136549,
                     136608..136701)
                     /locus_tag="CNE00510"
                     /product="DNA repair protein rad16, putative"
                     /transcript_id="XM_570757.2"
                     /db_xref="GeneID:3257704"
     CDS             join(132608..132853,132909..133329,133380..133924,
                     133981..134180,134232..134412,134474..134589,
                     134645..134812,134874..135253,135321..135353,
                     135406..135506,135578..135787,135846..135995,
                     136059..136119,136175..136275,136349..136549,
                     136608..136631)
                     /locus_tag="CNE00510"
                     /codon_start=1
                     /product="DNA repair protein rad16, putative"
                     /protein_id="XP_570757.1"
                     /db_xref="GeneID:3257704"
                     /translation="MPALRSTRKSAQNQPEMAVIDSVGHSRTNNAVSIKAQRQSTVEV
                     SIPTRRTRSSTSNTASLVPNGVDRDETEDEDWADGDVNMENGDSDIELIEDQKPQING
                     VNGKGKGRAKEQAQPFNIGKYSRVAKASVTDLKEDTRTSGRSSRAPRRSKSQASVKIE
                     ELDGDSTESEFVVDGGGYAMDSEDEARQLKQAIRASSSKAASSKGKRTNHVALNAALA
                     RIAGKRSGQSSTATDTANATPLSDDDPVPSDSEFEEAEEQGSDLSDLSTSDSEVEVPL
                     SRGKGSMRGGRGGAQGSKAARPSVAKGKTAAKGKTKKFQGKGRKLGGSDSEKEEEFDG
                     AEALSDEDESLSELSDPNMSWLEKRQMQKRKEKRHAAREAAPRKKKERELAKKLGRKL
                     TNGEKNLIALCMHRPELENVWGDLQANIEPVKPITMEAHPSLKLTLLPFQKESLYWMK
                     KQEEGPWKGGMLADEMGMGKTIQTIALLLSEPRRKPSLVVAPVVALMQWKNEIETHAE
                     GFTVCLWHGQGRMKAAELKKFDVVLVSYGTLEASFRRQQRGFKRGDKFIKEKSPMHEF
                     EWHRVVLDEAHNIKERSTNAAKAAFALKATYKWCLSGTPLQNRVGELYSLVRFLGADP
                     FSHYFCKKCPCKRLHWQFSDKRHCDECGHKPMDHVCFWNTEILTPIAKYGVEEGGPGH
                     TAFKKLKVLLDRMMLRRTKLERADDLGLPPRTIVVRRDYFSPQEKELYMSLFTNAKRQ
                     FATYVGQGTVLNNYSNIFSLITRMRQMACHPDLVLRSKNSTLTDVQEGTVCRLCNDTA
                     EDAIMSQCKHVFDRECIKQYLEVKQMRGHKPECPVCHIEISIDLEAEALDLEENNKKA
                     RQGILSRLNLDNWRSSSKLEALVEELEKLRHKDCTIKSLVFSQFVSFLDLIAFRLQRA
                     GFNICRLEGSMTPQQRDATIQHFMKNTGVTVFLISLKAGGVALNLTEASMVFMMDSWW
                     NPSVEYQAMDRIHRLGQKRPVKVVKLVIEDSIEDQIVQLQAKKLAMTEAALSSDSDSA
                     LGKLTVEDLGFLFKL"
     gene            137210..139791
                     /locus_tag="CNE00520"
                     /db_xref="GeneID:3257550"
     mRNA            join(137210..137573,137644..137760,137831..137909,
                     137960..137979,138046..138106,138169..138264,
                     138360..138483,138539..138601,138659..138700,
                     138768..138805,138857..138904,138963..139054,
                     139111..139168,139227..139329,139391..139791)
                     /locus_tag="CNE00520"
                     /product="mitogen-activated protein (MAP) kinase"
                     /transcript_id="XM_570760.2"
                     /db_xref="GeneID:3257550"
     CDS             join(137482..137573,137644..137760,137831..137909,
                     137960..137979,138046..138106,138169..138264,
                     138360..138483,138539..138601,138659..138700,
                     138768..138805,138857..138904,138963..139054,
                     139111..139168,139227..139329,139391..139458)
                     /locus_tag="CNE00520"
                     /codon_start=1
                     /product="mitogen-activated protein (MAP) kinase"
                     /protein_id="XP_570760.1"
                     /db_xref="GeneID:3257550"
                     /translation="MTIDQSQINFNVPSTYKLEEIVGEGAYGLVVAGTHLPSGTQVAI
                     KRITPFDHTMFCQRTLREIKLLRHFHHENIISILDLIQPESYEVFNEVYLVQELMETD
                     LHRVIRSQELSDDHCQYFVYQTLRGLKALHSADVLHRDLKPSNLLLNANCDLKICDFG
                     LARSSAKPPPGTSDGGQGFMTEYVATRWYRAPEVMLSFQEYTKAIDLWSVGCILAEMI
                     NGKPLFPGRDYHHQLSLILQVLGTPTMDDFNEITSQRSKDYLRALEFTRRQDFSAICP
                     KAKPAAVDLLKQTLTFSPSKRITVEEALMHSYVEAYHDPHDEPNAEPLKPGFFDFEFH
                     QEKLSRDQWKRMIYDEVQDPVPTILSQWTESH"
     gene            142196..144597
                     /locus_tag="CNE00530"
                     /db_xref="GeneID:3257914"
     mRNA            join(142196..142399,142496..143006,143055..143165,
                     143215..144091,144144..144205,144259..144597)
                     /locus_tag="CNE00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657149.1"
                     /db_xref="GeneID:3257914"
     CDS             join(142222..142399,142496..143006,143055..143165,
                     143215..144091,144144..144167)
                     /locus_tag="CNE00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512832.1"
                     /db_xref="GeneID:3257914"
                     /translation="MPASISLSTSYAWPAQATHSPILVARQDAGNGTTEPSAEASQEA
                     APSSAAPAQSSDAQQDSSPAASASPTQTSELQPSPSSDDAAQSTSPSPTPTSDAQTTT
                     SEASAEPQPSSAAPTSDPAPSSEAPASSAQPTSEAQPTTSEAPPSSAQESQSASPSPS
                     PSPSVTTTASPSESPSASPTPSPSQSASPSATESASPSEQASSQGVTTIYSTTQPVSS
                     QAAQSSAAQASSATPSTTEVTTVVVGGSTTASSTAQQSSADNSSRAGTLTSTIVISDT
                     SSSQSTAAESAFVATTTDSAGHSITTTPASYTSSYVTTSDGEVYTVTQIVHNPTGALD
                     TGSSSSDSSTNTFFSNKGAVAGTFVVVGLVVIGLILALSLLCFRRRRRQRLDREVTAA
                     AMAAPAGATGRPPLDEDKGYNPSSGPQTSESYPSTANQTPMGQYDGYGATYGDPHGGY
                     DPYAAAAAGYGATGGYETMQPGGQGYYYDPHAPPEQYSVPEQYSDAPTHSGEAYSDVP
                     LNEEGQHYYFDPSQAHAYAPEGEGYGDAYGGYSGTEGSVGTPQHERENPLHVANPSRQ
                     "
     gene            144763..146642
                     /locus_tag="CNE00535"
                     /db_xref="GeneID:36392851"
     mRNA            join(144763..145303,145421..145486,145567..145797,
                     145889..146272,146403..146642)
                     /locus_tag="CNE00535"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658508.1"
                     /db_xref="GeneID:36392851"
     CDS             join(144970..145303,145421..145486,145567..145797,
                     145889..146272,146403..146533)
                     /locus_tag="CNE00535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514360.1"
                     /db_xref="GeneID:36392851"
                     /translation="MPQPPILPSLFPREPATSSTASSSSSSISLPSLLSILLPLLMLL
                     LAIITLGVYKYVGWRRGKKLDEAVEKHAREVEQRRKLAKIRYVYGTPGMYGSGCDADG
                     RMDGPPVGWCTQKWLEAADARRSFISLSSLSASSSRPSSLVDIGNKITTEPKGEIKGQ
                     GSDQKRYSQLYQQLQSYRPRLHTTGGSPSYHALPSRTDEIPLSPDQYDHTTPNPSFQP
                     SSCPPAKETPTTPPQSQPQSTAATTVMAAPYPSPPSLPLPAFGLGDDSRIEFEDAMPS
                     LTFALKPTAPIRRFEQRTSPLKRQFKMESVGDGRSKKELIRGRLFEEKSSLGLSGIEK
                     QTSTSTFNTGITPIEDDFHTSLIHGPGISDQSDHLEFTDADSSVTTR"
     gene            146833..148092
                     /locus_tag="CNE00540"
                     /db_xref="GeneID:3258014"
     mRNA            join(146833..147088,147245..147300,147388..147727,
                     147804..148092)
                     /locus_tag="CNE00540"
                     /product="expressed protein"
                     /transcript_id="XM_570764.2"
                     /db_xref="GeneID:3258014"
     CDS             join(146957..147088,147245..147300,147388..147727,
                     147804..147953)
                     /locus_tag="CNE00540"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570764.1"
                     /db_xref="GeneID:3258014"
                     /translation="MTSSPTPTAPCPILIDTSGEPYIPIPSHPELKLTMRKESDIDDL
                     LVLFNTPEIGKWFWRRPFPYKPSDAGVFMSPVPRFATYISTTLLPSLPFPPSPPLPHA
                     ENFFPFSVLRTASDGKMIGIVFLSPGAEDKGGEEGTWELAYDLLPAWWGKGVGTGMIN
                     AGLGYLEWIGAKKVVAFHEPENAASGAVLCKTGFTRVEDKKLIWPEEKGGGERVVYGW
                     EKRLLRH"
     gene            complement(147984..149596)
                     /locus_tag="CNE00550"
                     /db_xref="GeneID:3257926"
     mRNA            complement(join(147984..148965,149077..149281,
                     149384..149596))
                     /locus_tag="CNE00550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570766.2"
                     /db_xref="GeneID:3257926"
     CDS             complement(join(148175..148965,149077..149281,
                     149384..149551))
                     /locus_tag="CNE00550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570766.1"
                     /db_xref="GeneID:3257926"
                     /translation="MTSMAAALAASLPAAVSTQATPQPAAQQPSKVPQRLEGVVDVEA
                     AREVENVSLSSLVFLKMMKHSTDSLPAPPASVLQQDRNPPPSTELSSHVDALGVLLGL
                     DLDGVMEVEDCYALPGGETSLGPNSYSAKLLSRLGTVSTPDSPVGIYLSTHNGGFATR
                     VSIELLSAVEKAAGRGKAILVVHDASRSNGGDVSVKAYRLADGAREAAKLGRWDGQVL
                     IEQGITASTLLTSIPITVTSPSLVNAFISTLNTPSPSETSAPSLTNPSVPLPPSFAPL
                     INPLPGSLTAYLQNTLDALTLHSHEANNIAFLTRQIAREKTKHEQAIRDREEENARRR
                     KMGLSEFPSIPQEIRGGTKEPSRLEMVCLGGTVEGIAKGMAAEAGKGLVRAYL"
     gene            complement(149685..150969)
                     /locus_tag="CNE00560"
                     /db_xref="GeneID:3257889"
     mRNA            complement(join(149685..150155,150300..150604,
                     150679..150969))
                     /locus_tag="CNE00560"
                     /product="3,4 dihydroxy-2-butanone-4-phosphate synthase,
                     putative"
                     /transcript_id="XM_570768.2"
                     /db_xref="GeneID:3257889"
     CDS             complement(join(149947..150155,150300..150604,
                     150679..150887))
                     /locus_tag="CNE00560"
                     /codon_start=1
                     /product="3,4 dihydroxy-2-butanone-4-phosphate synthase,
                     putative"
                     /protein_id="XP_570768.1"
                     /db_xref="GeneID:3257889"
                     /translation="MSRPSQVSNPPTAPPTPFQFDPVPDAIEAIRRGEFVVVMDDESR
                     ENEGDVVCAASAVTTEGMAWMIKWTSGYICLSLPPSRLKALQLPPSLPPSGVSQDPKG
                     TAYHLTVDSAPGRHPVSTGISAHDRAYTARLLADPKSDESDFTRPGHMVTLRYAVGGV
                     RKRRGHTECATDLCYLAGLPPAGLLCELVNPYDPAGSMARRDDCWRFAKEWGLKIISV
                     EGLAEYVLKEGKQLVPEEEAKA"
     gene            151046..153522
                     /locus_tag="CNE00570"
                     /db_xref="GeneID:3257796"
     mRNA            join(151046..152072,152135..152712,152771..152962,
                     153069..153152,153249..153522)
                     /locus_tag="CNE00570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570770.2"
                     /db_xref="GeneID:3257796"
     CDS             join(151210..152072,152135..152712,152771..152962,
                     153069..153152,153249..153436)
                     /locus_tag="CNE00570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570770.1"
                     /db_xref="GeneID:3257796"
                     /translation="MHRTNQKRDADRRGWPPGSAECHCAYSAPAIGCLYKYTSTFSSL
                     LHQPTITLLRLPPAAPRIAARLQPPMASISLPPSSSPTPPPPASRNIPKDFRSSLAAW
                     WSTSSYKETRVAEERLLRRLSMYQPAPAAAPPPPSTAPAGVQEQAGGRSWFGFGTSSK
                     STSTTSLPTQTHAAEDVAPRPQPVASSSAPSSGLVATLRNVFIPTPDPADAPAHPADP
                     RDLSPSSSATSSVHDPTHEEKKSHHRKSKYCKTDEGKLRDYINTLEISTPANQDSKEA
                     VVVLHGYAAALGFFFRNWESIATSSAATSRRTFFLDWLGMGLSSRPSPSLVSSPSNAP
                     IPSRVARAEHFFLASLENWRERVGVEKMVLVGHSLGGYLASAYAVRYPERVSGLVLVS
                     PGGIPHGPEYVRYPLTAELSSQTRQAQRLRREGSETSQELEGAVDAAEMELGTGPGGR
                     GSGGKEGAKGEAKEWEERREASVVRRGMMKFFVWGWERGLSPFSILRTAGPLGPLWVG
                     KYSSRRFAKQTEEDVRDLHAYIYGTSVMKGSGEYCISHILAPGAYARIPILDRIDRLK
                     IPVTFMYGDNDWMDVQGGHDSAAALAKAGNPNCSVHVVPEAGHHLYLDNPEVSNRLLD
                     EAIRAVPKAF"
     gene            complement(153695..155130)
                     /locus_tag="CNE00575"
                     /db_xref="GeneID:36392852"
     mRNA            complement(join(153695..153792,153856..153866,
                     153954..154242,154361..154501,154638..155130))
                     /locus_tag="CNE00575"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658509.1"
                     /db_xref="GeneID:36392852"
     CDS             complement(join(153783..153792,153856..153866,
                     153954..154242,154361..154501,154638..155023))
                     /locus_tag="CNE00575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514361.1"
                     /db_xref="GeneID:36392852"
                     /translation="MSHPFSPAFTPHPAEASLPPLRTPAPPNPTTTTPVGQSPESDQP
                     HPYIHPDFGVNATAVNYHTTTNTNVHGRGQEQGQGKGTTTSFSVLRTQAGGSGFDDWE
                     GEYERQTNRAWEEKVKADLEGWRGGHGTPRSSYPHSALPPMSYFHQPVTGEIGKHLPK
                     EMVRIERDWSGGEMCQFETIFPLELEGRIQPSELSSFLNAINTKLAEAYAMTPNITDN
                     LIAVATLWTSLLWKTSHFEKKLREVEKMIGDANKEMFNKAGLNVLSPRDVALQFLEIE
                     YY"
     gene            complement(155264..156320)
                     /locus_tag="CNE00580"
                     /db_xref="GeneID:3257824"
     mRNA            complement(join(155264..155457,155536..155672,
                     155760..155901,155972..156021,156088..156320))
                     /locus_tag="CNE00580"
                     /product="glutathione peroxidase, putative"
                     /transcript_id="XM_570772.2"
                     /db_xref="GeneID:3257824"
     CDS             complement(join(155352..155457,155536..155672,
                     155760..155901,155972..156021,156088..156210))
                     /locus_tag="CNE00580"
                     /codon_start=1
                     /product="glutathione peroxidase, putative"
                     /protein_id="XP_570772.1"
                     /db_xref="GeneID:3257824"
                     /translation="MTFFDSIASKFGYESLPGDVANKSFYDLKAKLPGSKGDLDFSTL
                     KGKVVLIVNTASKCGFTPQYTGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQ
                     FCTLNHGVTFPLMKKSEVNGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLINK
                     EGKCVGRYGSSTKPEKLKEEIEKLL"
     gene            complement(156696..158971)
                     /locus_tag="CNE00590"
                     /db_xref="GeneID:3257801"
     mRNA            complement(join(156696..156892,156955..157445,
                     157519..157666,157732..157850,157920..158971))
                     /locus_tag="CNE00590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571165.2"
                     /db_xref="GeneID:3257801"
     CDS             complement(join(156819..156892,156955..157445,
                     157519..157666,157732..157850,157920..158905))
                     /locus_tag="CNE00590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571165.1"
                     /db_xref="GeneID:3257801"
                     /translation="MSAEELVASPKLSKEEKKARKEAKKLKKAEKAAKEAAAQEGVAT
                     EEVKEEVRKKDKKDKKEKKDKKRKEVDQEEAESPSTSTAATEEPPKKKKKSKDADSSE
                     TPVSTATPTESETPALSKKQQKKLAKASAAAAATSSAAAIPAPTVPTTFTAEHNTFLT
                     SNNITLTPSLFPPLLSIRDLPINSKLQPFLNKFEKPTPIQACSWPALLSKKDVVGIAE
                     TGSGKTLAFGVPGINLLSQLPPVTGSKKGRGQVPGQIQMLVLAPTRELAQQSHEHLSA
                     FGEQVGLKSVCIFGGVGKDGQARELSQKDTRVVVGTPGRTLDLADSGELDLSSVSYLV
                     LDEADRMLDAGFENDIRRIIAHTPGHKEGRQTVMFSATWPESVRRLASTFLNNPLRIT
                     VGSDELSANKRIEQIVEVLDNPRDKDFRLTHHLKAHLKVHPNSKTSPTRILVFALYKK
                     EAQRLEYTIRRAGYAVGALHGDMTQEARFKALEAFKTGQQNVLVATDVAARGLDIPDV
                     GLVINVTFPLTTEDFVHRCGRTGRAGKTGKAVTFFTGENHEKSLAGEFMRVLRDVGAE
                     IPKEMDRFPTTIKKKEHGSYGAFYKETTNAPAPTKITFD"
     gene            complement(159098..160580)
                     /locus_tag="CNE00600"
                     /db_xref="GeneID:3257825"
     mRNA            complement(join(159098..159194,159288..160035,
                     160105..160172,160223..160279,160329..160580))
                     /locus_tag="CNE00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657150.1"
                     /db_xref="GeneID:3257825"
     CDS             complement(join(159512..160035,160105..160172,
                     160223..160279,160329..160549))
                     /locus_tag="CNE00600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512837.1"
                     /db_xref="GeneID:3257825"
                     /translation="MSPNATYASTHSHPSHIDIPPASGPPQVAADDLVITPDDGYTPS
                     AAKPPPARGILKNPLSDSIGPDGERIVGEHLQWDEANIALTEVQKDSLMKIDEPKTPY
                     VRYDAINDQVLANDSDVPSFDLEDDKAPRSPTTPLSPRNSIGISPDQVARNTLMNSQP
                     PRRPSSSTSTSSRSPSFSLPSKDHPVRPGSSSPRTSTGSIHSANGSVGGMELGATAAN
                     TAANSGEVFSDSEEEMDEETKARHKEFEKKRNSHYSKEAAFAMRKAKELLQKEEEEEE
                     DEGNAKEKMDLDE"
     gene            160886..163251
                     /locus_tag="CNE00610"
                     /db_xref="GeneID:3257812"
     mRNA            join(160886..161044,161111..161297,161357..161544,
                     161603..161772,161832..162132,162188..162298,
                     162355..162517,162581..162751,162831..163251)
                     /locus_tag="CNE00610"
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /transcript_id="XM_570776.1"
                     /db_xref="GeneID:3257812"
     CDS             join(160958..161044,161111..161297,161357..161544,
                     161603..161772,161832..162132,162188..162298,
                     162355..162517,162581..162751,162831..163108)
                     /locus_tag="CNE00610"
                     /codon_start=1
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /protein_id="XP_570776.1"
                     /db_xref="GeneID:3257812"
                     /translation="MRPQNVAGVAGTGALIMAAGALADQTVFHPTSLTAPFIEQFIES
                     IPDSRWTVSRATKQTPVGDEIFSYVGQWEVEEPEVYPGIPGDKGLVLKTKAAHHAIST
                     LFTEPIDPKGKSLVVQYEVKLQKGLECGGAYIKLLTDQQDEGLRAGEDYTDKTPFTIM
                     FGPDKCGSTNKVHFIFRHKNPLTGEWEEKHLKNPPSPKITKTTALYTLITNPDQTFEI
                     LINDESVRKGSLLEDFDPAVNPPKEIDDPEDFKPETWVDEAEIEDVTATKPDDWDEDA
                     PMMITDASATKPEDWLEEEPETIPDPEAEKPEEWDDEEDGDWIPPMVPNPKCEDVSGC
                     GPWTAPKIRNPDYKGKWTVPRIPNPEYKGPWAPRKIANPAFFEDLHPSDFTKIGGVGI
                     ELWTMTEDILFDNLYIGHDAAQAKKFAEETYHVKKPIEKEAEGSNEDELEEPSSLVEK
                     VQLKVYEFLHLATFDIAQAVKQMPEVAAGLAAAVFTLLGMLLALFGFIGSAPTKVRQT
                     TVKTKAVAPVAPAGEEEKKALDQAGVEVPAEGSKKRVTRSTKE"
     gene            complement(164107..168627)
                     /locus_tag="CNE00620"
                     /db_xref="GeneID:3257841"
     mRNA            complement(join(164107..164304,164378..164498,
                     164559..164745,164798..165136,165184..165521,
                     165584..165626,165677..165874,165926..167892,
                     167942..168627))
                     /locus_tag="CNE00620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570778.2"
                     /db_xref="GeneID:3257841"
     CDS             complement(join(164251..164304,164378..164498,
                     164559..164745,164798..165136,165184..165521,
                     165584..165626,165677..165874,165926..167892,
                     167942..168546))
                     /locus_tag="CNE00620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570778.2"
                     /db_xref="GeneID:3257841"
                     /translation="MFKNKGPSLSPDTDYTRNLRETTFYRYGQLRSLGFTGEVTALAV
                     DPVLSLFAIGTSNGMVHCYGAPPFQFTLPVSPISSSGPAHVIKFLLFHPGHNRIIAID
                     DGNTIHTYTLEHMTDHPNPSLHPPLPMKEIAYTLWGTVTSVEQPLPCHTHLFLTVRDG
                     TTLTWDLSRRGLGNWKIGNCWQDYEDRMIRSGVPGREKTLGGPMATCLAMNPRDLNIM
                     LIGYEGGVVAWDMQRNMVVKTFEMILPPGAPGGGSYQDADGSLWTERAPSVTFITWRP
                     DGLVFAVGHVDGCIAFWAFSESDKPLMVRTITHEDVNVADAESLLESGALPSKDKKVE
                     RDQNGNAIVSAVSANREPIYKMVWASFPDQASLKALISAQGTPQAREPLTNATVELAE
                     RGETLLLILGGQSPGDKPGINILQFPAYKPPINASSKSPSESMPLQERYAFRDSLLPT
                     GSFNWLTRTPPEDFILIPRSNPYFNLSHDPISIVISLAPDPSIPEIKQPYATRSLEAW
                     VFPPPRSDVAPPSSGRKNYIQPGAGEKIVAMTPAPITPPAPMSPRAGGGWRLPWSIRT
                     PSPALSIPPAASPDTPVSDISGLSGITTNFQRSAKMRKQLSFPSTVWSGALSVLGTEL
                     YALSTPVFKRLISWTIEHAGEEEMPRLPLRGGLAVPDLQSHGAPEVMVAKMESYRILV
                     TYHADGTVRFWDASPHILILPTPLRFEFPNPLPHLTINTGNYLKHPDVSHLPLAQLWL
                     NDRSKVRIKSVHLAREALECVITFTTGEVLVTKFQKAKTSTDDDRYQEILNRGGDQVG
                     EETEGSYFPPQPRQQGKSEWVEEVLEIGHLAKPNTDGFKPVAIFTTKQGEPISCAVSD
                     IGFIAVAFSSKSLAIIDMRGPDVILREGFDEDGAMMKKKKKKGNIQNVLPETSVVGSL
                     KWTVSGMGGDMVNRPRLIVSYVKGLTKIYALINVLGEWVVEAKPPTFTNDSLFGPIAS
                     FVLDPMTGNELATSATALQAAMQEPTDYGKGKEASVHCLWIAASKKSIRCAINFSGER
                     IAKVELEDEELSNVFYVTRHGHKIIIAVTTTGSALVYTVPFLQYITRINLFFGPQGRS
                     SGKLSIDDRSGDFVEYSGPLDINLRTFFHFRKPLPPRIDPCAHKKAIPPQPQPVNAGV
                     ISWIWGATLTGAQLDALIGGPLRAPPPKAPAGPHKPLISWGKPEEEPEKPPQLPSNTL
                     PNRTAVKKTKAPKAQEGERQDVYTEMTNAISLRGDVLDMLGESLNNVSTSATQYLGQA
                     KNAAMKETAKAGAKGIFGKLL"
     gene            complement(168806..171894)
                     /locus_tag="CNE00630"
                     /db_xref="GeneID:3257614"
     mRNA            complement(join(168806..169226,169273..170207,
                     170261..170512,170562..171720,171798..171894))
                     /locus_tag="CNE00630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657151.1"
                     /db_xref="GeneID:3257614"
     CDS             complement(join(169218..169226,169273..170207,
                     170261..170512,170562..170898))
                     /locus_tag="CNE00630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512840.1"
                     /db_xref="GeneID:3257614"
                     /translation="MPPLLPSLLLPLLLIPSPFARQITVKNSCSSTIWPGMHTGGSFI
                     PDQATGWELAAGGQTEFTVPEDWTAGRIWARTGCVVQDGVFQCLTGQCGSGENGDITC
                     ENSDQPPATLAEFTLIPGKEDNYDISLVDGFNIPLNIIPSISTCPQPQCQVNINVLCP
                     PLLRTSLDQKGVNLGCIAPCNRGFGQELYGNRACCTGAYADSALCLACGVDYYALFKD
                     NCNTSYAYAYDEKSHTALWTCGGSPDYIVEFCPAGSDYIGAKEASTKYVNATATCSSM
                     ATTFSTAFSVGPSPTSIATIGELDVVATVATGVDGAAAIQIDETSAASSGATTIATTV
                     TATQTAAGIVAQAMSSSVATAITAPVQTSVVIAAQSSVVNAAHYLEPEMDLVAETTLT
                     TPTIVPSSDGSEFIAVQATSAAEGQGYTSVEIFTVYGGSTLYEVIHGVDGSGSEATNT
                     AGSVIATQASQTDSAWVAAERTGTEPGDDMPWSGHRWGEGNWLSAVPTGASDNSHKKR
                     VI"
     gene            172761..173958
                     /locus_tag="CNE00640"
                     /db_xref="GeneID:3257618"
     mRNA            join(172761..172857,172912..172963,173033..173225,
                     173353..173704,173769..173958)
                     /locus_tag="CNE00640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657152.1"
                     /db_xref="GeneID:3257618"
     CDS             join(172840..172857,172912..172963,173033..173225,
                     173353..173704,173769..173891)
                     /locus_tag="CNE00640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512842.1"
                     /db_xref="GeneID:3257618"
                     /translation="MKIDVTSDVICPFCLIGVKQLLAAIDKYKVTHPDAEFNIRFLPY
                     ELNSGLTEEPIPRKQFYVTKFGEEKAAQILSMLPAKYEAVGCKCDLSGNISSTQLAHR
                     LQTYALCHRPSAQLPLVLDIFTGFHSEAKHPSDKPWLTSLAVKHGIFPDEKAAREWLD
                     GKQCDKEVKKAYGTARDLGVTGVPFFVFQDKYAASGAMGTEEFVRLLEEIDQREKVFS
                     EKSAPALKSGETCTNEGLYSFVQNNGC"
     gene            complement(173912..175369)
                     /locus_tag="CNE00650"
                     /db_xref="GeneID:3257589"
     mRNA            complement(173912..175369)
                     /locus_tag="CNE00650"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570785.2"
                     /db_xref="GeneID:3257589"
     CDS             complement(174001..175269)
                     /locus_tag="CNE00650"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570785.1"
                     /db_xref="GeneID:3257589"
                     /translation="MTHRSRSGGPLKKHGGKKQQTHTRKLHHPPPLRSETPPLPVPDN
                     LPLPPAEGPFNPPDSELLALIHRALHSTLSSDEFQPTIQKIKGLLYDKKWLEVFCGPE
                     GLLESYAGRWVPSRAACFRELMGQLVGEVFDGEGDVDQQLGQLSLGGDESDKDEEEAE
                     EEGQEEKGEDKEGSEKVGKEASGNASPAEKPTHHILSLGGGAGSELLAISALIRSTLL
                     ARPRSHPSWTWTGIDIGNWHNVLKKLEGAVRMDWEITEDMLEVEYVKGDLIASIKPTA
                     AKEGEKEDGDGEIMEGIAWGPIDWKGLLTRKSPALITLFFTLAELLTQSRPLTLSLFA
                     TLTTQCKPGTLFLIADSASDISEFAIGSEGRKWPAWMVVDAMLTGKGKGWEKVRGEDS
                     RWFRFEEGVGAGWACKLENTRYWYRLYRRV"
     gene            176797..179610
                     /locus_tag="CNE00660"
                     /db_xref="GeneID:3257838"
     mRNA            join(176797..177078,177145..177171,177225..177390,
                     177463..177736,177795..178058,178118..178254,
                     178307..178421,178482..178727,178780..178860,
                     178908..179121,179180..179610)
                     /locus_tag="CNE00660"
                     /product="KEX1 protein precursor, putative"
                     /transcript_id="XM_570787.1"
                     /db_xref="GeneID:3257838"
     CDS             join(176958..177078,177145..177171,177225..177390,
                     177463..177736,177795..178058,178118..178254,
                     178307..178421,178482..178727,178780..178860,
                     178908..179121,179180..179535)
                     /locus_tag="CNE00660"
                     /codon_start=1
                     /product="KEX1 protein precursor, putative"
                     /protein_id="XP_570787.1"
                     /db_xref="GeneID:3257838"
                     /translation="MSGNVACARVRSQSSTFSPLETRDGDEQESSSSDSQHGSSKRGP
                     QRRATDLPSAADLYVPSLPGLPEMATHPTHPLNIYAGMLPSYPGEGKVGGEGQTGKDA
                     KLYFLMAKARRNAGKERVIFWFNGGPGCSSFDGSLMEVGPFRTVPATETTSGMVEAKL
                     VEGGWEEFATVVFVDQPPGTGYSYAATDGYLHDFDELSAHFIEFLQNFYTVFPELKGV
                     DTYLAGESFAGQYIPFFADALIKSIELPNFPLKGIAIGNGWIDPKEQYPGYVEFAYEK
                     GLIVSGTPEAEEMESALKRCQEEMDKYSDPFTTPVNINNCGQVMDSVTRPFTQELNGK
                     KVCMNVYDVRLVDDFPACGMNWPPDLPDVYTFLRQDDVISALHATSKETAWVECNNKV
                     SYELNLKKSHMSAALLPSILEAGVPILMFAGAEDLICNYKGIERIVNGLEWDGEKGFG
                     NATSQEWYFNGTQVGTWQTSRGLSYAKIFDSSHMVGFDVPHVSNDMIMRFMDVDVSLL
                     PGMTAQWPSRIGDDERTMIHVGDGESGGVPLIEGGNTDWEAWYNAIFAFLVLGILVSI
                     AGLYFYFRRKPVSYRSRISLKQRSRRHRGHDMDEDEAAERMPLGSERLELDDIERAEG
                     YEFHDGDGERYSREGKGKGKERAKDREEVVFALGDDDEDDHH"
     gene            complement(179656..181334)
                     /locus_tag="CNE00670"
                     /db_xref="GeneID:3257848"
     mRNA            complement(join(179656..179904,179956..180391,
                     180450..180523,180591..180619,180691..180772,
                     180829..181334))
                     /locus_tag="CNE00670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657153.1"
                     /db_xref="GeneID:3257848"
     CDS             complement(join(179792..179904,179956..180391,
                     180450..180523,180591..180619,180691..180772,
                     180829..181003))
                     /locus_tag="CNE00670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512972.1"
                     /db_xref="GeneID:3257848"
                     /translation="MPSASDQYSLTSPYDYTPTGWVTILFIVLFSVSGALHLVQATIF
                     KYWIVFPTIAVGVALEIIGWAGRYWSNQNVLYNPPFLMQIITLIIAPVFFSAWDYTIL
                     GIAIQNLGRQYSILAPKAYVALFVTCDVISLILQAVGGGWAASSEFPVPKSPTNIMVA
                     GIIFQLVSMIIFSLLACDFMYRAWKKKPYQRKLRQVVDEPIGETGSGATEGTEGEKYD
                     EVERSAVVRGWWWVMAGTAICSLMIIIRGVYRSVELVQGWNGYVISREVYQDCLDGIP
                     MFIAVLSINIFHPGFFLPRRRKWGRA"
     gene            182971..184197
                     /locus_tag="CNE00680"
                     /db_xref="GeneID:3257767"
     mRNA            join(182971..183137,183194..183229,183289..183327,
                     183379..183540,183595..183654,183710..183768,
                     183824..184197)
                     /locus_tag="CNE00680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657154.1"
                     /db_xref="GeneID:3257767"
     CDS             join(183135..183137,183194..183229,183289..183327,
                     183379..183540,183595..183654,183710..183768,
                     183824..183968)
                     /locus_tag="CNE00680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512845.1"
                     /db_xref="GeneID:3257767"
                     /translation="MSVTLHTNLGDIKIELFCESVPRTAENFLALCASGQYDGTLFHR
                     NIRGFMIQGGDPTGTGKGGQSIWGRPFSDEIRQTLRFNNRGMVAMANAGPDTNKSQFF
                     ITYAKQPSLDGKYSIFGKVIDGMETLDSMEKTPVNPKSRPLQEIKLLNVTVHANPIAD
                     QAKGGLA"
     gene            complement(184049..185669)
                     /locus_tag="CNE00690"
                     /db_xref="GeneID:3257996"
     mRNA            complement(join(184049..184249,184306..184391,
                     184446..184620,184677..184827,184881..185054,
                     185105..185231,185288..185368,185429..185669))
                     /locus_tag="CNE00690"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_570791.2"
                     /db_xref="GeneID:3257996"
     CDS             complement(join(184157..184249,184306..184391,
                     184446..184620,184677..184827,184881..185054,
                     185105..185231,185288..185368,185429..185633))
                     /locus_tag="CNE00690"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_570791.1"
                     /db_xref="GeneID:3257996"
                     /translation="MSEESGPSQIPEDSQRRTSYSLRDEFHEATQKQKRHKVTDVSEI
                     FQRPDAEEQKRLNKEYRTLQSEAEELKANLANATARDLAQALQKQALLFQNVKDTGIG
                     TLDANLLRTNTENAMGLAKRFKIDGVTFDVDEFLIKMKGHLGLDRVEMMDAEINSDEE
                     EEGAEPRGRKGALGDWEKIGWMAARYYRRIPGAEFLYGPLQAEPKVRKVAQRRAKADI
                     AQETRPIEVQNQTASTKSRDEFTTNVKTVMKTLARLDPDGEGVNFFRLVVNPDDFGQT
                     VENCFYLSFLINQGQAGIYVKKDGEVMARSTVHEEIGEGGDQAKNQAVLEMDMETWEI
                     AKETFEITHSEIPHRDYAEIKIQSNSWYS"
     gene            185822..189247
                     /locus_tag="CNE00700"
                     /db_xref="GeneID:3257628"
     mRNA            join(185822..185906,185957..186000,186053..186062,
                     186116..186353,186402..186448,186498..186594,
                     186646..186941,187009..187194,187248..187416,
                     187480..187572,187631..187751,187804..188020,
                     188072..188150,188215..188234,188300..188342,
                     188394..188442,188497..188615,188673..188905,
                     188962..189247)
                     /locus_tag="CNE00700"
                     /product="meiotic DNA double-strand break
                     processing-related protein, putative"
                     /transcript_id="XM_571170.2"
                     /db_xref="GeneID:3257628"
     CDS             join(185869..185906,185957..186000,186053..186062,
                     186116..186353,186402..186448,186498..186594,
                     186646..186941,187009..187194,187248..187416,
                     187480..187572,187631..187751,187804..188020,
                     188072..188150,188215..188234,188300..188342,
                     188394..188442,188497..188615,188673..188905,
                     188962..189028)
                     /locus_tag="CNE00700"
                     /codon_start=1
                     /product="meiotic DNA double-strand break
                     processing-related protein, putative"
                     /protein_id="XP_571170.1"
                     /db_xref="GeneID:3257628"
                     /translation="MSAPNRVPDSQPSSETGDEPPLSIVEPDLENCFRILIATDNHIG
                     YAEKDPVRGQDSINTFREILELARDHDVDFILLAGDLFHENRPSRTCMHQTIALLREF
                     TLGDKPIEFELLSDPMDGSTPGFSFPAVNYEDPNINIAIPVFSIHGNHDDPQGTGPEG
                     ALCALDVLSVSGVLNYFGKSDLVADESAADNPEKGIQIRPVLLRKGTTHVALYGCGNI
                     RDQRMYQELRANKVKMFMPTGGNVPDSDWFNILLVHQNRVRHGPQNYVPENMFDDSMR
                     LVIWGHEHDCRITPESVADKSYFITQPGSSVATSLAPGEAIPKHVGLLSIQGSQFQLE
                     EIPLKTVRPFELDEVVLSYAAEQGAVDLNDRDSITSFLREQVEALILQAKKNWKEKNN
                     GSTKNMMLPLIRLKVETTDAKEMVNPVRFGQEYVNRVANPRDILQYYRKKKNERKVKN
                     NPDMPDIDHDEWEEDPESLTADERLSKLRMATLVKQYLQAQSLDVLVENGMEDAVMRF
                     VDKDDKDAIKDFVADTLRMVGRKMKEKEVKEDDVDLAMAEAKVKEYNRYADSNPVPPQ
                     SVKGKNKQRDSDVDSMAASDDDMDLDEMPTQQRAPVRRTTAKQSVRSAKGKGKQPLFD
                     DASEEEEEEEDEEEEEEEPAPTKSRGRAAAASTKKAPAKKAPARTPAKSTTKAPARRV
                     PTASQRSTGRGVTQSQLTFSRSGAGKASAVPIELSSDED"
     gene            complement(189209..190832)
                     /locus_tag="CNE00710"
                     /db_xref="GeneID:3257974"
     mRNA            complement(join(189209..189408,189463..190114,
                     190168..190299,190360..190832))
                     /locus_tag="CNE00710"
                     /product="mannitol-1-phosphate dehydrogenase, putative"
                     /transcript_id="XM_570793.2"
                     /db_xref="GeneID:3257974"
     CDS             complement(join(189342..189408,189463..190114,
                     190168..190299,190360..190594))
                     /locus_tag="CNE00710"
                     /codon_start=1
                     /product="mannitol-1-phosphate dehydrogenase, putative"
                     /protein_id="XP_570793.1"
                     /db_xref="GeneID:3257974"
                     /translation="MTTLQGVSIPKTQTAAVVPSVGDPIKIDNQAKVIQANELKSGQC
                     LVKITHTGVCHTDLHAKQGDWPIPPKNPLIGGHEGVGHIVAIGANTVNSPVQLGDRVG
                     IKWLANSCLTCEACRRGFEMNCDHAELSGYTIDGTFAEYVVSFVNHVTPIPPSLDSAG
                     AASILCAGVTSYKALKVSNTKVGDWVALPGAGGGLGHLAIQYAKAMGLKVVAIDTGAA
                     KEKLVKSLGADAWVDFKTTKDLVADVKAATGGQGPAAAVVTASHKTGYSQAIDYLKPS
                     GTLVAVGLPNAEMGANVFWTVFKSIRIQGSYVGNRQDAIESLQLVEDGKVKVIFEQKP
                     LADLKAVYEGLEEGKIAGRIVLQVAKE"
     STS             190076..190889
                     /standard_name="Pst15"
                     /db_xref="UniSTS:470789"
     gene            194173..197489
                     /locus_tag="CNE00720"
                     /db_xref="GeneID:3257586"
     mRNA            join(194173..194502,194660..195639,195690..196115,
                     196180..197489)
                     /locus_tag="CNE00720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570795.1"
                     /db_xref="GeneID:3257586"
     CDS             join(194209..194502,194660..195639,195690..196115,
                     196180..197347)
                     /locus_tag="CNE00720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570795.1"
                     /db_xref="GeneID:3257586"
                     /translation="MTVPLQSAPKVEPPLGPFATLPPDVAGLKKLKILLLVTSINSFS
                     QRVFSYLQYLGLNQVSVQLATSDEDMLEAAESWQPDIVLCPFLTKKLPPSIHNKWITL
                     VVHPGPPGDAGPSSLDWVLLGDTGTQSSSADLLGQLLESIPSPTPQRSHWGTICFQAT
                     EDLDGGAVWAWEQYELPRLGTVTKAQVYQGYHSAAAVSAVIHALCRVYELTAGAGLPK
                     GQWMNAVPKETWQTRCVSLGETFMGGKTHERPLLQSAKRRPDWEKHTGEDVLRILNAG
                     DSQPGAMLHALTTDAKSSLFAYGAHLENASIPLELYTSLGYETYDAVPNGRAIATRDG
                     AVFFKTRQTTGASAGIWITHGRVPRGKDKPIDPKVPMVEAIQLGGHGRALEGVQEWKQ
                     DSWEQKEGEWQEVYVKSIKEGDGIAQLVYWNFYNGAFTTENCKTLLSALQWATSPERG
                     NVKLLALMGGNYFSNGIALNTIEHASSPGLETWHNINAIDDIVSFLVSDVSDEVPAFM
                     QGIEPLCKRGIATVACVRGNAAAGGVALATACDVVLAGRGVVLNPSYRGMGLHGSELH
                     SFSYLQRCGRIHAAEILREMKPLNTSLAQSYGLVDGQIGSSSQTVLETEPLFVEAVTS
                     ILTAKTSSAPFSSAPWARSSDLTTEGMRVSSKSWVDDMCTTKLCTYTASRTFPPLQHY
                     RTEELSQMLLDSFHPIRSQRYHTRRYRFVRKLKATGTPARYKLHGVVGREGEKVVQDE
                     EDREAFDDAPGWEKGEEWGWVGMAVPESLKTSQVLRIPLYPSSSSSPCQSQSQPLANP
                     PALDEESRQTSYLSTETSTSNTSGPDESLPLTPRANSNSNSPPCQIISGNGNGNGKDE
                     GDGFAKSLSFTDKLCTALGLKTKTKSPKPFSSEKKENSMPISSPTSRISPVPPMSHPV
                     VNRPLGKGEQASEWPCLVTGGEEWEGKRGNGAAEDGIKVDI"
     gene            complement(197575..198815)
                     /locus_tag="CNE00730"
                     /db_xref="GeneID:3257624"
     mRNA            complement(join(197575..197848,197929..198316,
                     198370..198815))
                     /locus_tag="CNE00730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570797.2"
                     /db_xref="GeneID:3257624"
     CDS             complement(join(197757..197848,197929..198316,
                     198370..198783))
                     /locus_tag="CNE00730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570797.1"
                     /db_xref="GeneID:3257624"
                     /translation="MPHVAAPSRQALERERLHRHAQQPSSSLSHAAARRLSPLKLYLL
                     AYNILSALLWGHLLVLTLSFLLAGPTAPRFVDHLRGSYDYHGLGWWTKWTQTLAVLEV
                     VHAALGWVRSPVGTVASQVASRLWTVWGVVEAAPEITHGHPLFTTMLFAWSLTEVIRY
                     SFYALSLLSISAPALNYLRYTTFIPLYPLGAASEAFLSFATLPALAPVVSRAVTNVMA
                     QAPREIMKSKVGREVLWWCAKHGGGTAGAQQDWGWIEIVRAGLFLLWWPALYVLYTYM
                     LKQRRKVLGKGKTVGGVSKAQ"
     gene            complement(198979..200408)
                     /locus_tag="CNE00740"
                     /db_xref="GeneID:3257791"
     mRNA            complement(join(198979..199119,199168..199263,
                     199326..199857,199937..200214,200273..200408))
                     /locus_tag="CNE00740"
                     /product="translation initiation factor, putative"
                     /transcript_id="XM_024657155.1"
                     /db_xref="GeneID:3257791"
     CDS             complement(join(199052..199119,199168..199263,
                     199326..199857,199937..200214,200273))
                     /locus_tag="CNE00740"
                     /codon_start=1
                     /product="translation initiation factor, putative"
                     /protein_id="XP_024512957.1"
                     /db_xref="GeneID:3257791"
                     /translation="MDPNVDLFAGMKKKKKKVTVADAEETPEPSPAPAPAPVDDTPAP
                     VAEAVAEVEVEAPVATPEPSTEKPAEDSGDLFTDLKKKKKKKKDIPLDLESAEPSATV
                     DGLDVPMKKKKSKKTTDFSKELQDLDAEQHHENADIEGDLGDDVFQKSGEGETSESGK
                     EAWVVENRDPTYPELLKRFFNLLHAHNPELAGEKRRYTIVPPQVAREGTKKTLFANIT
                     DICRRMRRQPEHVIQFLYSELGTTGSVDGAQRLVMKGRYTQKQIENVLRKYIVEYVTC
                     KICKSPDTILDKENRLYFMTCESCGSRRSVSAIKTGFQAQIGKRIKAA"
     gene            200571..201920
                     /locus_tag="CNE00750"
                     /db_xref="GeneID:3257641"
     mRNA            join(200571..200680,200780..200816,200886..200970,
                     201057..201598,201665..201754,201818..201920)
                     /locus_tag="CNE00750"
                     /product="ATP synthase gamma chain, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_570799.1"
                     /db_xref="GeneID:3257641"
     CDS             join(200586..200680,200780..200816,200886..200970,
                     201057..201598,201665..201754,201818..201835)
                     /locus_tag="CNE00750"
                     /codon_start=1
                     /product="ATP synthase gamma chain, mitochondrial
                     precursor, putative"
                     /protein_id="XP_570799.1"
                     /db_xref="GeneID:3257641"
                     /translation="MLSRAARPAIALARTANQQQAGMATLKEIEQRLKSVRNIEKITK
                     SMKVVASTKLTRAEKAMREAKKYGAANNELFKHTEAQSETEPKILYVGISSDGGLCGG
                     IHSSISRYIKKEMAEQPGALAVVGDKPKAQLSRAMSQAFKVSFSAVGKDVPTFGEASA
                     IADEIVKNGGEWDVIKIVSNKYLSAISYEAGTTTVISAKALQEAAGFQQYEMEEDVSK
                     DLAEFALANAIYTALVEGHAAEISARRTAMENASNNALDMMGSLQLQYNRGRQAVITN
                     ELIDIITGASAL"
     gene            202032..203327
                     /locus_tag="CNE00760"
                     /db_xref="GeneID:3258010"
     mRNA            join(202032..202322,202453..202570,202699..202964,
                     203087..203327)
                     /locus_tag="CNE00760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571163.2"
                     /db_xref="GeneID:3258010"
     CDS             join(202246..202322,202453..202570,202699..202964,
                     203087..203216)
                     /locus_tag="CNE00760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571163.1"
                     /db_xref="GeneID:3258010"
                     /translation="MPEGKKDDGQGKKDDNPIKKDEKPLPNVYLKISINGKEVGKVVI
                     KLYDDVVPKTCANFRSLCTGNKPDQTPLPPSFTYRSTPFHRIIPSFMIQSGDFERQDG
                     TGGVSIYGEKFPDENFEKKHDKVGLVSMANCGAHSNGSQFFITTVEKCEWLDGKHVVF
                     GEVVEGMDVVKEVESKGNKEGKPPKDKIIISACGAV"
     gene            complement(203280..206961)
                     /locus_tag="CNE00770"
                     /db_xref="GeneID:3257768"
     mRNA            complement(join(203280..203635,203706..203776,
                     203828..203830,203911..204345,204399..204665,
                     204719..204749,204799..204872,204919..204950,
                     205004..205069,205131..205153,205207..205265,
                     205316..205486,205545..205852,205903..205916,
                     205967..206606,206663..206796,206877..206961))
                     /locus_tag="CNE00770"
                     /product="plasma membrane protein, putative"
                     /transcript_id="XM_024657156.1"
                     /db_xref="GeneID:3257768"
     mRNA            complement(join(203280..203635,203706..203776,
                     203828..203830,203911..204345,204399..204665,
                     204719..204749,204799..204872,204919..204950,
                     205004..205069,205131..205153,205207..205265,
                     205316..205486,205545..205852,205903..205916,
                     205967..206606,206663..206863))
                     /locus_tag="CNE00770"
                     /product="plasma membrane protein, putative"
                     /transcript_id="XM_024658511.1"
                     /db_xref="GeneID:3257768"
     CDS             complement(join(203495..203635,203706..203776,
                     203828..203830,203911..204345,204399..204665,
                     204719..204749,204799..204872,204919..204950,
                     205004..205069,205131..205153,205207..205265,
                     205316..205486,205545..205852,205903..205916,
                     205967..206606,206663..206664))
                     /locus_tag="CNE00770"
                     /codon_start=1
                     /product="plasma membrane protein, putative"
                     /protein_id="XP_024512847.1"
                     /db_xref="GeneID:3257768"
                     /translation="MDYTSLRTKHRAEHLARDAAAASHASYYAHPALHIHTYLDKSKP
                     AVVTQEGKVVGALNDPAQPLAQSPAPETLGEAPPTGAPTKPGEHVHNIPQVNANTDEA
                     RKVGTEGTKEEEGGKEDAGAPSGLDKGALEVGGEAGGTKTSPGPTAEEVARHAHMIGD
                     KANMAALGVPNGRPGMERHWSVSGKMQPHLQLMCGPLLAYYTVKDNVWQGAAMVVVRD
                     EGSVLDPPPYLKLSFHPYTPPSAEQPTLYEPEIQLLPPTTIGSQNIFTYNSPEGNMSF
                     HRFIMEIPLQKIQTAVRYRLNGGAGMDFIVPALGQNMRWAAHSCNGFSSGVNPDDFKG
                     PYPSGYDPVWEDLLLKHQEKAFHCMVGGGDQIYCDAVTREPELQSWINAPTRKSKLGH
                     PLTDEMRIAIDRFYFNHYCKIFRSNAFGRANSTIPMVNMLDDHDLIDGFGTYDDETQS
                     AAVMSFVGSRGYFWFLLFQLFICDAFDGVNPVPGTHAVKSLIIGDKNGPWIPFPSHSL
                     LIYLGPKVTLLALDCRAERKLTEICRPESYAKVFNEVKKVQGIEQLVILLGVPIAYPR
                     MSFLEHFLELKWNPINILARHNALGLGSMVNKFNQASELLDDLNDHWCANTHKKERNW
                     LVLECQELAKQLHARITFLSGDVHLAAVGCLFTKKKKGAKELKPEQDWRYMLNVITSA
                     IVNTPPPAGAAKLVAMLGGHRHRTLHHKDTDEHMMPLFGKDTDGSKLSRKFVQPRRNY
                     AIVEYTSQSELLFDIRVEKSQGAGETVSYPVTAPAPKW"
     CDS             complement(join(203495..203635,203706..203776,
                     203828..203830,203911..204345,204399..204665,
                     204719..204749,204799..204872,204919..204950,
                     205004..205069,205131..205153,205207..205265,
                     205316..205486,205545..205852,205903..205916,
                     205967..206606,206663..206664))
                     /locus_tag="CNE00770"
                     /codon_start=1
                     /product="plasma membrane protein, putative"
                     /protein_id="XP_024514362.1"
                     /db_xref="GeneID:3257768"
                     /translation="MDYTSLRTKHRAEHLARDAAAASHASYYAHPALHIHTYLDKSKP
                     AVVTQEGKVVGALNDPAQPLAQSPAPETLGEAPPTGAPTKPGEHVHNIPQVNANTDEA
                     RKVGTEGTKEEEGGKEDAGAPSGLDKGALEVGGEAGGTKTSPGPTAEEVARHAHMIGD
                     KANMAALGVPNGRPGMERHWSVSGKMQPHLQLMCGPLLAYYTVKDNVWQGAAMVVVRD
                     EGSVLDPPPYLKLSFHPYTPPSAEQPTLYEPEIQLLPPTTIGSQNIFTYNSPEGNMSF
                     HRFIMEIPLQKIQTAVRYRLNGGAGMDFIVPALGQNMRWAAHSCNGFSSGVNPDDFKG
                     PYPSGYDPVWEDLLLKHQEKAFHCMVGGGDQIYCDAVTREPELQSWINAPTRKSKLGH
                     PLTDEMRIAIDRFYFNHYCKIFRSNAFGRANSTIPMVNMLDDHDLIDGFGTYDDETQS
                     AAVMSFVGSRGYFWFLLFQLFICDAFDGVNPVPGTHAVKSLIIGDKNGPWIPFPSHSL
                     LIYLGPKVTLLALDCRAERKLTEICRPESYAKVFNEVKKVQGIEQLVILLGVPIAYPR
                     MSFLEHFLELKWNPINILARHNALGLGSMVNKFNQASELLDDLNDHWCANTHKKERNW
                     LVLECQELAKQLHARITFLSGDVHLAAVGCLFTKKKKGAKELKPEQDWRYMLNVITSA
                     IVNTPPPAGAAKLVAMLGGHRHRTLHHKDTDEHMMPLFGKDTDGSKLSRKFVQPRRNY
                     AIVEYTSQSELLFDIRVEKSQGAGETVSYPVTAPAPKW"
     gene            complement(207174..208968)
                     /locus_tag="CNE00780"
                     /db_xref="GeneID:3257830"
     mRNA            complement(join(207174..207405,207459..208082,
                     208131..208307,208363..208968))
                     /locus_tag="CNE00780"
                     /product="expressed protein"
                     /transcript_id="XM_571128.2"
                     /db_xref="GeneID:3257830"
     CDS             complement(join(207384..207405,207459..208082,
                     208131..208307,208363..208865))
                     /locus_tag="CNE00780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571128.1"
                     /db_xref="GeneID:3257830"
                     /translation="MFISRPQLRLLALFFLLATDPPLTSAQINTSTIADAIAITQGRY
                     PSSSPTQAHSANGGVIKFEDPISTSLSSTPTTQKSGMYEASSLPVHKVDTNPSTLPGQ
                     KVGVSGVASSNQYPGHKASVSATISPAFPQVDPSLTRFSGHKIPVRSQPQDGSTRLFD
                     IVAVSALKETNSADSADCYEWVWVDESGNEISKRTDSKLEAMELLVKDHENYEKEKNP
                     SSQEGSAEFGRKGRRAAQVVKRAPQDTNPSATSTSHASSSVSGTSHDPSTSNHLPTNS
                     TADFSSAISTTTKPVSSVPGSLLTTYPVTSLAASATEGLHDSRRAPNDFHPFNHAGLI
                     ASIVLIVIGLSTISYVAIYLYRNRQKKNKEAQAKINQHEPSFSMYNAPSRYNSIKDDD
                     MYGHEVAHLGYQASSDDTMAPRLNRLYSIQAAFAKNKKISQLAQHENRV"
     gene            complement(209103..210115)
                     /locus_tag="CNE00790"
                     /db_xref="GeneID:3257733"
     mRNA            complement(join(209103..209311,209363..209617,
                     209679..209809,209882..210115))
                     /locus_tag="CNE00790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570804.2"
                     /db_xref="GeneID:3257733"
     CDS             complement(join(209267..209311,209363..209617,
                     209679..209809,209882..210047))
                     /locus_tag="CNE00790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570804.1"
                     /db_xref="GeneID:3257733"
                     /translation="MASAVSGPSTKQVHPFYCAVCSLPTEYCEFGPSVSKCKAWLEEQ
                     DKDEYERVWGEGALASRIGTLSLDKQEKLEADAAKLEKKAAKKAEAEAKKKEQTKIII
                     KRSERTKRKHQTHIQNLELFGVDLKKAAKQFAGKFATGSSVSKTPQGEEEIVIQGDVG
                     DEIVEMIRQQVGALKGVPADQITRVEVKKKKEAEEPAA"
     gene            210286..212057
                     /locus_tag="CNE00800"
                     /db_xref="GeneID:3257491"
     mRNA            join(210286..210521,210569..210885,210951..211025,
                     211082..211119,211175..211256,211311..211371,
                     211424..211539,211594..211667,211722..212057)
                     /locus_tag="CNE00800"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_570806.1"
                     /db_xref="GeneID:3257491"
     CDS             join(210377..210521,210569..210885,210951..211025,
                     211082..211119,211175..211256,211311..211371,
                     211424..211539,211594..211667,211722..212025)
                     /locus_tag="CNE00800"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_570806.1"
                     /db_xref="GeneID:3257491"
                     /translation="MSLIRNCSGVVIRCFKHVEYFADWLTGAAGPVFVFLCWLLIGSG
                     GVLFFDVVARDLSFLSLLLLSPLLILVPLNLYLQYYLVTHVPPGFPAPRASGPDENMS
                     WIVPDTKSIWAPERWGFKKMVRPLTSSGQPEGAAETGRRVRRCRKCDGPKPERTHHCS
                     VCKRCILMMDHHCPWINNCVGLHNQRHFVLFMAWLSIGCWVAAILGYHRFLDTFKYHS
                     EWNSWTPKLGWTIIWVLAVAIGIAVPVLTLWHLYMVSNGETSIESHDNAYLASKAKSE
                     GLIYLNPYDLGRRRNLQLFFNLGPGGYSATTLLFPFLISPATNGWSFYRRPLPTHPLA
                     SMKELHAPELGEGLIARTNTSSGRGLGLGLGLDVGGDVGSHAEDGLGGYVMGDDGSLT
                     DDEEGGGGYMD"
     gene            212963..215727
                     /locus_tag="CNE00810"
                     /db_xref="GeneID:3257539"
     mRNA            join(212963..213076,213131..213201,213247..213369,
                     213416..213656,213712..214106,214161..215177,
                     215227..215358,215431..215727)
                     /locus_tag="CNE00810"
                     /product="expressed protein"
                     /transcript_id="XM_024657157.1"
                     /db_xref="GeneID:3257539"
     CDS             join(213040..213076,213131..213201,213247..213369,
                     213416..213656,213712..214106,214161..215177,
                     215227..215250)
                     /locus_tag="CNE00810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512973.1"
                     /db_xref="GeneID:3257539"
                     /translation="MDASIKGASHIKTFVRLLQCASKFGDDLHICIGEGLWEMSAVDS
                     SKSAFCLFKLNKDFFYKWEKRVSGQIICRILVKSVIAVLGKSAQMSTVQRIDLRIIDP
                     SDELKSRLRRRRRGGREANGEEQKVFVDDGPAYPDDDEAVGGIEAKLIMRLVCDHGVI
                     RKHSLHLGTSEFNRADVDPETTPSGFTISSRTLRDWLDHFSISMPTSGSNASGGLSQL
                     GWMFAKDHVKIKSWEGPGNGNAGLSTEITIDTEEFEDYGLIETRYLDDEATQQGGNLG
                     PRVDLTLPMKEFKATLVLAEQLSINLNMAFSEAGQPLTITNLENELEYIELFCAIATR
                     ECYAFADIMLPGQESSAHTRNAQISKSRTATAQQPEGGNAFPPSSRRKREEQSQRKGP
                     SRLTLTAQPTDEERLVTVYLPENGHAQKQLSQRASDHIHPHAEGAASASPSSRRNTDH
                     EPLFLPQSQDAGSPETLPPQSQRQATQSGVRMTQREVLEYAGLGDVNMDELGEELDFE
                     EEEEEEVRASQLGDRVKPWGNSASAHQKTKDETVRRQDVSTHRSANTTGAEESDFTWD
                     TTIDMGLLDSRVRAQLDEGHVEAKAEHMEVEEAQKDEDLSMEEWDEEDTDGLELTQIP
                     EKSKYRPLFDD"
     gene            216968..218316
                     /locus_tag="CNE00820"
                     /db_xref="GeneID:3257994"
     mRNA            join(216968..217186,217245..217495,217543..217572,
                     217635..217932,217998..218316)
                     /locus_tag="CNE00820"
                     /product="glycerol dehydrogenase, putative"
                     /transcript_id="XM_570808.1"
                     /db_xref="GeneID:3257994"
     CDS             join(217126..217186,217245..217495,217543..217572,
                     217635..217932,217998..218287)
                     /locus_tag="CNE00820"
                     /codon_start=1
                     /product="glycerol dehydrogenase, putative"
                     /protein_id="XP_570808.1"
                     /db_xref="GeneID:3257994"
                     /translation="MSAPTSFKLNNGVEIPAVGLGTWQAPPGQVQAAVAHALKNGYRH
                     LDCALIYQNEAEVGDGIKESGVPRSEIFITSKVWNTHQPNVADGLRQTLEALQTDYLD
                     LYLIHWPVRLVPNESSGLLPVNPDGSRSVDRDWDQSETWRQMEEVYASGKVKAIGVAN
                     WSIPYLEELKKTWKIVPAVNQVELHPFLPQHKLVKYCRDLGILLEAYSPLGSTNAPLL
                     SDPEINAIAEKYKTSPATICISYQVNRGIVVLPKSVSPKRIEDNLKTIPIEKEDMVKL
                     DGMAAAGKAQRINTPKWGWDLGFDDWYGPVKQQ"
     gene            218491..220130
                     /locus_tag="CNE00830"
                     /db_xref="GeneID:3257999"
     mRNA            join(218491..218916,218982..219022,219084..219405,
                     219477..220130)
                     /locus_tag="CNE00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657158.1"
                     /db_xref="GeneID:3257999"
     CDS             join(218637..218916,218982..219022,219084..219405,
                     219477..220015)
                     /locus_tag="CNE00830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512850.1"
                     /db_xref="GeneID:3257999"
                     /translation="MGYRLIASGDRPSFTVIEFDPAQSALKLEHNYPAPHNCSWLEKS
                     PFRQENDGTVDKLFALSEGDEKGELFTFELHGEDVKITSREPTLGAPAQFQLLSDRSA
                     VVLATYLGGSLALYPLSANGTFASNVKRTEITFDFTYSSHPGAHGPVPYRQKQCHAHQ
                     VLEHQKTGWFFSCDLGSDRVWIARRSQGNAQLEVVGSLHLPPGSGPRHAVFSKDENLA
                     YVICELSHQVHAFPLPSSTTENVEDIQPLSAFSANVIPPNVPLEHQTLMDSSEIWLHP
                     TIPNVIYASNRWQLHIAERQPESQDVAPPPKGDSLAIILLNETGDKVESVKHVETGLD
                     AIRGFRVSPDGKYVAVAGQEGGGVEVYGITGSRGDEWDLIARLGEKEGVGRGIKDVLW
                     L"
     gene            220436..224688
                     /locus_tag="CNE00840"
                     /db_xref="GeneID:3257920"
     mRNA            join(220436..220748,220818..220853,220903..220975,
                     221036..221789,221840..222078,222137..222425,
                     222493..222588,222659..222720,222781..222840,
                     222899..223009,223077..223145,223207..223348,
                     223412..223555,223619..223690,223743..224351,
                     224443..224688)
                     /locus_tag="CNE00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657159.1"
                     /db_xref="GeneID:3257920"
     CDS             join(220541..220748,220818..220853,220903..220975,
                     221036..221789,221840..222078,222137..222425,
                     222493..222588,222659..222720,222781..222840,
                     222899..223009,223077..223145,223207..223348,
                     223412..223555,223619..223690,223743..224351,
                     224443..224601)
                     /locus_tag="CNE00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512852.1"
                     /db_xref="GeneID:3257920"
                     /translation="MSPTSFQNSAGPGPLLNQHSRSPPSASNVSSRDRQGTAESDIEA
                     REENGASKAPLRKKQRKQRPVFSCAECRRLKLKCDRQVPCDNCVKRRCHSICPDGVRV
                     TRQYLANPDSALLTRLEQLEGIVSRHRLDPVITEAASAKETNKTQTPSGMQLRSQQAT
                     GNINGSSRSRGQNSPHMASPSSVAAQPPTNRPEEASSSLQQSDDDDHLRGSSSSGPFR
                     YDMLESPRYEHQPQPQHLQQHPPQTHASDLQFNTVRPGNPDISHRVEAVHEINKIVPC
                     DGSIRFDFPTHSTSSTSPPAAGRHSDSNAEPHSHHPHHFGPPVLAENVDVEEEQSYGT
                     LVMGQGGTSKYLGPTAASEWLRDQETRDHAESRDQSRLPSPEIPEASVPPHNLRPTAV
                     PHSFPFHTSKTKVVSWSRYDLLSRLPDRYYADMLVDSYYRSFSWHYDICPRSEFQPVY
                     EEMYLFRITSITSPPEPLQRLGRGRMNYQDLGLVFMVLAFGTLHCLELAPNDPTAYEL
                     ASVAQVALSKGDLLSRPSISGLQALHILAQFSNESEEGRNGDASWPLWGLSMRLIQAM
                     GLHRDGARWDLDPELVEQRRRVFWECHSADIFQANCNSRPNTLWPGVYDTAYPSQPPI
                     HIEKDYYTLKFELSRIAASILGSATNVQAPPYSTIMELSRQVTDFERQVPFNLRCRQA
                     LQALPSIYPDPQAAIDNSPEISSKELHKTFQKFFLSISISETLLFLHRPYFVRALIRT
                     SPDPSQSVYAPSYLTVVERCNAIVQCVVTIHKIHRNVSTRHWPLWYHAFNSAVSMGTL
                     IFKSPQNPLSDFALGLINTVIEAFTSAVQTGSSPRLSTNLQWLIRLRRRCQDAIDKSK
                     CESAGQQTTSDNSTFALREGDTGDNSDQDDPDNFSLLGWRTRLIQRAAFGGQVAKIIS
                     QSTPSQSNDSSPQIMSSNINLLPDILGPTMGGLTGAGVLNPIPGAENIANKQMSSSTS
                     TAGDQTEINETFTNQLLQQFWEPMLLQDAPNVGDSTWDPFQTVNCWDWNMHLYREERS
                     HQAPNPDTHA"
     gene            complement(224795..227318)
                     /locus_tag="CNE00850"
                     /db_xref="GeneID:3257869"
     mRNA            complement(join(224795..225842,225899..226241,
                     226297..226705,226757..227318))
                     /locus_tag="CNE00850"
                     /product="flavin-containing monooxygenase, putative"
                     /transcript_id="XM_570814.2"
                     /db_xref="GeneID:3257869"
     CDS             complement(join(224970..225842,225899..226241,
                     226297..226705,226757..227045))
                     /locus_tag="CNE00850"
                     /codon_start=1
                     /product="flavin-containing monooxygenase, putative"
                     /protein_id="XP_570814.1"
                     /db_xref="GeneID:3257869"
                     /translation="MSPTAIIDNHKVDLADLKSKVVDGHVELEETPKPPVADNFMYDF
                     KYNHALPTTDALGVSIPDDVDAQNAAEEIVAKLSKVLSEGDAKGFTGLFLEYGVWRDK
                     LAFTWDYRTFNFTENIARAAADLLPSTHCTNFKLLKPAPAIQKPYPDLSFLQFVLSFD
                     TPLVQASAVINAVFTQEGWRLWTVHSVAESLLKFPELDPADGHMTGPVSWEKQREMDD
                     EEIVPDVLIVGGGQNGLALAARLKALGVPNLIVERNAQIGEIWRKRYEYLSLHFPHWA
                     DHFPYFPFPKYWPTYTPAQKLGIFMEWYASAMELPVWTKSTVVKAEQDADGKWTVEVN
                     KNGETRVLNPKHVVMATSLCGVPMTPVIPGMDKWKGTARHSTSHDSSREWVGKKVLVV
                     GTSSSGFDTAYDCARRNIDVTLLQRSPTYIMSLTHSVPRNIGSFEPKNGVAPNIEEQD
                     RLFNSMPVGPGEELARRNRAVLEELDKEMLDGLRAKGLKTYKGQRGTGQATLGSTRNG
                     GFYFEAGACEQIIKGKIKVEQGYVESFTEDKVILSGGREREFDLVVFATGFSNTIDSV
                     RQTLGDKIADQCGPIWGVDEEGEMKSAWKECGVPNLWLVIGYLPLTRYHSKLVALRIK
                     ALLEGVSPAPYKA"
     gene            228564..231074
                     /locus_tag="CNE00860"
                     /db_xref="GeneID:3257696"
     mRNA            join(228564..229340,229391..229502,229562..229663,
                     229713..229774,229826..230083,230136..230194,
                     230247..230326,230382..231074)
                     /locus_tag="CNE00860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657160.1"
                     /db_xref="GeneID:3257696"
     STS             228708..229224
                     /locus_tag="CNE00860"
                     /standard_name="Pvu7"
                     /db_xref="UniSTS:470791"
     CDS             join(229044..229340,229391..229502,229562..229663,
                     229713..229774,229826..230083,230136..230194,
                     230247..230326,230382..230503)
                     /locus_tag="CNE00860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512853.1"
                     /db_xref="GeneID:3257696"
                     /translation="MPVATTPDTKLKLAVIGLGRIGAVRARILSNYAPKIHVVAACDS
                     KPGSDVWAAENLPSHVQFFSDPEELFQKSGAQAVLISTVTATHAPLVLRALELGYHVM
                     CEKPIAVDIATTKQVVEAARAKPELKFLVPFCRRYDESNRALKMLVDAGELGDIHAVE
                     SWCLDAQDPTGFFVQFSAMSGGIFVDMGVHDIDIARYFLNVKKGLINPKKQVNRVIAF
                     GQTAVYHDLQKFGDADNGYGIVEFANGKILTSHIGRTLTNGHESSTRVFGTKGTAVVN
                     AESPANRVQLRDAHGVRSETTGDAFVLYQQSFVNDLDEFATCVLEDKPLSLQPEDALE
                     ASKIATALQYSFRNRVAVEFDDEGEPIMP"
     gene            232034..233705
                     /locus_tag="CNE00870"
                     /db_xref="GeneID:3257522"
     mRNA            join(232034..232145,232208..232289,232435..232957,
                     233013..233257,233314..233705)
                     /locus_tag="CNE00870"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_570818.2"
                     /db_xref="GeneID:3257522"
     CDS             join(232604..232957,233013..233257,233314..233440)
                     /locus_tag="CNE00870"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_570818.1"
                     /db_xref="GeneID:3257522"
                     /translation="MTTPTAVTLVGATGLTGSHSLNCLLTSPHAFSINALTRRPLSDT
                     PSAVNPLTKLTTRIYNSLFDAPTDKDALVQQGGIYVSCLGTTRADAGGTAEQEKVDLG
                     LNKDLATRAKKDGASTLILVSSLGAASSSYFFYPRIKGQLEDAVKALDFDHTVILQPA
                     VLLGDRAESRGISEIVLKGVIRGIRKVGLPVDSLAVEGADIGACIAHLAANPPSEKVL
                     TIGDHEIIAYAKQYRAAQAQSSK"
     gene            complement(233665..235901)
                     /locus_tag="CNE00880"
                     /db_xref="GeneID:3257754"
     mRNA            complement(join(233665..234013,234068..235901))
                     /locus_tag="CNE00880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570821.1"
                     /db_xref="GeneID:3257754"
     CDS             complement(join(233911..234013,234068..235845))
                     /locus_tag="CNE00880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570821.1"
                     /db_xref="GeneID:3257754"
                     /translation="MVLRSTLIALVTLLSLSSAAAFYLPGSAPRDYLEGEKIDVFVNT
                     LTPMLNSKLKSLISYDYYDSRFHFCSPEGGAKRQPESLGSILFGDRILSSPYEIRMLE
                     NSTCQKLCQASVPKDDAAFINQRIKEDYGLNLLIDGLPSSEMRRDSKTGETFLDAQGF
                     SLGNDEMNPDKPALNNHYDIYIQYHMRDENHFRVVGVLVYPSTVNSMVAGSTEPDCFN
                     KQPFYLSEENSNEFFYTYSVSFLESDIPWGLRWDAYLHVFDPRIHWFSLINSLIIAGF
                     LVFMVGMILLRSISRDIHRYNAVDLSDEVQEDYGWKLVHGEVFRLPQRPMLLSVMVGN
                     GIHLIMMCIVTLVFALFGFLSPSNRGSLATVLLICWTLFGCVSGYSSARTYTTLGGEQ
                     WKTNLILTAVLFPTVVFTIIGMLNFFLIFASASGAVPFGTILAVLFLWFLISAPLSIG
                     GYFYGMKHGAFINPVRVASIPRQIPPKPWYLSTWPAAILGGILPFGAAFVELYFVLSS
                     LFGNRAYYAFGFLFLTFVIVALTTATVTVLFVYFLLCAEEYRWHWRAFLIGGGSAFWL
                     FAYGVWYWVSRLYLNGFTSVVLYFGYLFLVSLLDFLVGGSIGYVATYFMLRRLYTSIR
                     VD"
     gene            237291..238300
                     /locus_tag="CNE00885"
                     /db_xref="GeneID:36392853"
     mRNA            237291..238300
                     /locus_tag="CNE00885"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658512.1"
                     /db_xref="GeneID:36392853"
     CDS             237352..238227
                     /locus_tag="CNE00885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514363.1"
                     /db_xref="GeneID:36392853"
                     /translation="MLVLRPPMTLRAISHARLIPIPIPPILSRPASSGPPRPRQTQPA
                     AHPLSYRDSSIPHSVVRLIGPEGLLPPQRLSSILSTYSTSTHTLTLVSVDGEYPVVKL
                     VSKAEERDREKEKEEKSKVKRKISMEEKEVQVSWQSAKGDLGHKLEMAKGILEKGDRV
                     QVVFANRRRAEPVSERQKDEIVAMFQGILEEVGKKWKEDDKNRGLWVLYYNPLDSVRQ
                     EVEKKVLEAEQAKKEEKEKAKQEKLEARRKKEERRRQRAEEMEKEKAEEAARRDEEYQ
                     RRIANSRKSGFGGWR"
     gene            complement(238239..240237)
                     /locus_tag="CNE00890"
                     /db_xref="GeneID:3257771"
     mRNA            complement(join(238239..238426,238475..238530,
                     238585..239144,239196..239628,239694..240237))
                     /locus_tag="CNE00890"
                     /product="phosphoric monoester hydrolase, putative"
                     /transcript_id="XM_570823.2"
                     /db_xref="GeneID:3257771"
     CDS             complement(join(238304..238426,238475..238530,
                     238585..239144,239196..239628,239694..240153))
                     /locus_tag="CNE00890"
                     /codon_start=1
                     /product="phosphoric monoester hydrolase, putative"
                     /protein_id="XP_570823.1"
                     /db_xref="GeneID:3257771"
                     /translation="MVTLHQYSPPPESDADHEQEDHLTLPLYSEPHHPPALHHRPSFL
                     DEIVPLPSPSHFTPVGKDPRTHALRRSVSVAIISIFMLAVIFMASTESRSTAKDAAAR
                     LKGVFGIGSVAELGEVLAGNMGLGDGEQSTNIDDEGLAAETGEKSSARPKIDFDRFTM
                     IKSVDHKDLDFSSGHRVIFVGDVHSSYDPLQRLMSKLQYDDTSDVLFHVGDLLAKGPK
                     PEQVLQWMREHKIRGVRGNHDQPVIQWRTWMEWAGGVEWEAYMDLLSGKEEEEAIHIL
                     GKDKKKYPDGWVWKGEHWNIAREISKESYEYLTNLSLILHFPSLHAFVVHAGLLPSNP
                     LRSSSDASQPLVEYSNTTLSPPYRKAEELAIVKNVIQNTSPYNIYNMRSVYTKGPNKG
                     QVTKSSTEGTPWSEVWNKEMKRCKGPGAWSTQDEGDEWQVEQEQVDDVQLENEEELDE
                     TVKRQKPGTPEAEKQKSAKKKLKCSPVTVVYGHAAGRGLDIKPFSKGIDTGCVYGRQL
                     TALVLGDTTGLDGQSVRVGDYKGVLVSVDCGKNGT"
     gene            241391..242947
                     /locus_tag="CNE00900"
                     /db_xref="GeneID:3257705"
     mRNA            join(241391..241440,241490..241662,241721..241933,
                     241986..242080,242132..242178,242234..242320,
                     242386..242947)
                     /locus_tag="CNE00900"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657161.1"
                     /db_xref="GeneID:3257705"
     CDS             join(241418..241440,241490..241662,241721..241933,
                     241986..242080,242132..242178,242234..242320,
                     242386..242905)
                     /locus_tag="CNE00900"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024512974.1"
                     /db_xref="GeneID:3257705"
                     /translation="MEDEQVPQLLVSTPEAGTSSLPPARFERPQVPITLLTGYLGAGK
                     STLLQYILTANHGYRIAVCMNDFGDTTDIESKSLTMSDPDSSTTTSEFLSLPNGCLCC
                     SVKDMGIAAIEDMVMKAPGGVDWVVVELTGLADPTPIVKSFWSNEEMGDLFLDGVVCV
                     VDSRNVLKQLDGHKDYDEITECQKQVASADVILLNKIDLVSEEHLSKVERAVRELNAT
                     LRIHYTRNSQAPISELFHIRAFTNSVTPAIKEAPAALDDGHQHSSDCGHPHENGELLP
                     HRNSRINTTLIPIPPLNLLQYNRINTFLESVLWSATFPASSKVAPEILRTKGYITLQD
                     DRAFVLQGVADLFELKEVDRALDPEMKGKIVFIGKGVGEDLKRELQVWVGL"
     gene            complement(244397..247808)
                     /locus_tag="CNE00910"
                     /db_xref="GeneID:3257990"
     mRNA            complement(join(244397..244489,244539..244991,
                     245043..245157,245209..246384,246436..246581,
                     246632..246857,246908..247294,247345..247424,
                     247476..247563,247615..247808))
                     /locus_tag="CNE00910"
                     /product="Golgi to vacuole transport-related protein,
                     putative"
                     /transcript_id="XM_024657162.1"
                     /db_xref="GeneID:3257990"
     CDS             complement(join(244558..244991,245043..245157,
                     245209..246384,246436..246581,246632..246857,
                     246908..247294,247345..247424,247476..247563,
                     247615..247782))
                     /locus_tag="CNE00910"
                     /codon_start=1
                     /product="Golgi to vacuole transport-related protein,
                     putative"
                     /protein_id="XP_024512855.1"
                     /db_xref="GeneID:3257990"
                     /translation="MFERTLQDLIRGLRAHKGASKTQEDAFIAEAMTEIRDELKGKDM
                     ALKAEAVIKMCYLMMLYPIPPPAGFAFHVVEVMSSPRYHLKQLGYLAAPMAFSGDTEE
                     IVLTVNGIKKDLLSPHVPLPPLPLTALPQLLSLSSSLSTSLHPDLLHLLTHSSPRIRK
                     RAVLCLLPCWEAFPEGLREGFPRLRERLQDEDQGVVGATVGVVMELARRQGGKNYLPL
                     APELFGILTGSSNNWMLIKVVKLFAILTPLEPRLVRKLLPPITTLISNTSAISLLYEC
                     VRTCIVGGMLNADRPEADALARVCVEKLGGYLRDEGGDQNLRYIALLAMVKIIPTHPQ
                     LVAEYQDEVLQSLDDPDVSIRMRALELATNMVDPNNLQTIADTLLSHLAPVSPVLPSA
                     AASLAAIASSSGTSSNALPSLSPAYRHLLSTRLLAILSHNTYANVTDFEWVLSVLVDV
                     AYVSRVNVSQDIKKMILDVVARVKSVRNYAVSVLEKVLGDDDFKERLGDDNESADGLI
                     EAAVWVCGEYPSELSSPLSAISNLLSPSTSTIITSLSIQAVAKIFGYYCTIAASSWSG
                     DKFEETKALVASIDKGLTEVERNAKGDMEVVERVGEIKGLLGFVKADLEHHLPPQNTL
                     RRDSGSSIPELEGGFEAEAKQTNQNDPPYPKSLYIFPPLSTSHPLNAVASYAQSSIRI
                     PEGLDLDTDLVPGGGWPEDIEEVDESEEEREKGLLNLGEGGGEGMEELRRVLREGRKK
                     KKGKKGEEGEDRVERERRRAARRAKHKNDPYYLYDREDEDVDNIPIVKLDDSELPHDI
                     TDPSSRPKSKSRQKKKAPPEFDRTGELPEGVSSPQIPTPSSRLSPSASRMNSTTGLAA
                     VDLSASGSMSKPVSRSSSRFEEYKLHEEEGLSGATSQVDFQRNGGEDVPVASVPEVQV
                     VKVKRKKKAGEKKKKKEGKRESPAE"
     gene            247966..252019
                     /locus_tag="CNE00920"
                     /db_xref="GeneID:3257697"
     mRNA            join(247966..248074,248133..248222,248272..248334,
                     248390..248522,248570..248664,248719..249047,
                     249098..249404,249452..249815,249872..250414,
                     250467..250572,250625..250832,250883..250989,
                     251049..251213,251272..251341,251393..251478,
                     251527..252019)
                     /locus_tag="CNE00920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570827.2"
                     /db_xref="GeneID:3257697"
     CDS             join(248002..248074,248133..248222,248272..248334,
                     248390..248522,248570..248664,248719..249047,
                     249098..249404,249452..249815,249872..250414,
                     250467..250572,250625..250832,250883..250989,
                     251049..251213,251272..251341,251393..251478,
                     251527..251910)
                     /locus_tag="CNE00920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570827.1"
                     /db_xref="GeneID:3257697"
                     /translation="MDIERLVRTHVSTADLNPSQELVQGVNSGQVQLLQVVKALGNYL
                     TSTEDDIRLKGLTFLTNLLGVIIPGKINRQATTTLTNFYISKLDDFESLPPALSGLTT
                     LSKLTTFDDTAAVDVYKGVVENVNIKAYAQAIRHLVYVLFDSLLATHRDALKKMGTAF
                     INSYTKIVDGEKDPRNLMLLFSIDRVILLEFDVKDHIEDFFDITFCYFPITFRPPPND
                     PYGITADDLKLALRECMASNPYFAKMALPLFLEKFATATGATMKDLMLTMAACFPTYG
                     ADAVNERSKELWEGIKTEILYSSDSTIEAAALSALESLMRALYPNEDSVPSGLAQEII
                     QECMKSLEEPEKNQALGSTKIIAAIFRGSPSAGKFALSQVFPQLFRTFNTPTVPSHRA
                     PLLTAISSILLACQSTYNSSSRSHEQEQNLEPYRGDLLDILREGLRTDGLKGPAIKGC
                     IALVGVQGYWSRKEVEDVVRGIDEILIHDENQEIRPEVIQALITISKSHPTVIESLTL
                     PLLFHNLPSSAPSVEDFTARERYRSILGSLGRLCIQPALWGTMIVRVTSRLDVLVSAT
                     PENSEGADVEMDDIDARECNIAYAWDLLNSLLTVIEAKVKQKHMDVGKYYEELMPRLL
                     GLVVRASQQKVGESGEPLFKDRRLVAIVSKIEEKMIWELGAEKQEKQFNLVYRAFEQG
                     EMVGIVHEKSTVQSSSPLRTSASSAEQDLIALYSSALQGLSPPVSLPLASCGEYLRGK
                     IHWTIHVARDDWQVKWGLQMVCALVNKKDNDLKEALEGVLEKIWAEVQDTTQDFEVRR
                     RGLLVYFHIIKALSLLRQPLAYTALDKVIEVLGLFSMDPEFVSEAARAFGVLAKKGDG
                     HLIAKLLYAQKLWNFVLPKLIEGDKEASGKERIVYLVAFASLLPLVPPSLCLSDLPTI
                     LPLIQRSLTLSSPVQRTNVIHALISILETPSSPSTDTILHSSASSLVSALLTSSVPSP
                     ETPTSSKVRQSALACLAIIPDTIRFEVLYKQKAEVIKELGNAVDDRIRNVRKEAVECR
                     ARWYRYGQAT"
     gene            complement(251980..254931)
                     /locus_tag="CNE00930"
                     /db_xref="GeneID:3257507"
     mRNA            complement(join(251980..252325,252373..252473,
                     252534..252579,252638..252890,252938..253173,
                     253240..253329,253379..253396,253444..253555,
                     253608..254110,254168..254531,254588..254677,
                     254760..254931))
                     /locus_tag="CNE00930"
                     /product="expressed protein"
                     /transcript_id="XM_024657163.1"
                     /db_xref="GeneID:3257507"
     CDS             complement(join(252089..252325,252373..252473,
                     252534..252579,252638..252890,252938..253173,
                     253240..253329,253379..253396,253444..253555,
                     253608..254110,254168..254531,254588..254677,
                     254760..254875))
                     /locus_tag="CNE00930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512857.1"
                     /db_xref="GeneID:3257507"
                     /translation="MPSKHRASDSEESSSRPALPPSKRQVRHASRACDECRRRKIRCD
                     GMVPQCTICKNRDSACEYKDEDRRKTNLEHIEDINARMDRFEKLVENLLAATTASRSM
                     AAPPTQSLSDVGLIESIIQTPSNESSSRMAELPTNHAIDRLPAALGSKNTTPSSTTSA
                     RQMLHNIDTLPVTSSRLRKVEGGPDYELFQRVGKADAALVQHGPTSLWTCASSRLQET
                     EASSTHEPRMGDWIDWSRNLPSSLNISKTIHDQALDYFSAFYAPWCLSVDMPAFITDL
                     NICNMTQVSGRDRQSPPIRTAHYSPLLHCCVLYLGLRLIKQEHPALMRSYESIFMRHC
                     SALLFEECDHTALSSLRAYNLFSNCAHFVRLSTCENQFNLGDRQHATGYLYSGMAIAG
                     VHALGLNLNCESYVRRGQITPDERNLREYAFWTTYLQDTIRALAAGRQPILVDTSSAP
                     FPQIDSILDDVLWSSPTVPLYSVTPPSPGLSVNGLRSMRSTAFHWMARLAVISRSVLE
                     TLYSSSNGESTREESAWDLLQQLETWHDRFPLAHPDMNPLPHVLLLLMTYHLVVIFIL
                     RPFYRSTSTTIPAQKCQQAAQSILYLLDLFESVHGLRFCHHNLINAIFGAATIFLLGN
                     IKSKDIGFSSTDLLNFNRCVDHMSRLSLTWTEAAMSHDILVALQAECEQPSAEPLLDQ
                     NDLNPSFPPFNSFNDMQDIWGLMFPDQAFQWQDLNEASM"
     gene            <255676..>258297
                     /locus_tag="CNE00940"
                     /db_xref="GeneID:3257783"
     mRNA            join(<255784..255927,255986..256090,256140..256284,
                     256335..256402,256451..256513,256566..256640,
                     256696..256784,256835..256903,256966..257038,
                     257093..257161,257211..257281,257331..257430,
                     257488..257761,257809..258053,258113..>258139)
                     /locus_tag="CNE00940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570831.2"
                     /db_xref="GeneID:3257783"
     CDS             join(255784..255927,255986..256090,256140..256284,
                     256335..256402,256451..256513,256566..256640,
                     256696..256784,256835..256903,256966..257038,
                     257093..257161,257211..257281,257331..257430,
                     257488..257761,257809..258053,258113..258139)
                     /locus_tag="CNE00940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570831.1"
                     /db_xref="GeneID:3257783"
                     /translation="MSNPGSMDRMEADYDVEKVDLARHDVLYVSDVAPVATGKQLDER
                     QNRNYDAAAIFFAELARRPDADELMAPWTPKEEEAVKRKLDLIVLPLVTISLLLGGTD
                     KVILSTAATFGLKTDLHLVGQQYSWASSIIFFGSMLTVLPQTWLCQRLPTGKIFATNV
                     FFFGVMTFAIMGAKNAASLQAIRFILGMFEGMNTSGAGLVINMWWPKEEQGWRTVLIF
                     NTFSSVLNGLFSYAVQFYTPTKLLSRWQLLYLITACISVAFGVVDWFCLPANATKAWW
                     LTDRQKYIAVQRLAKNQTGMVNTHFKWDHVKEALLDLRTYLYFLISITLNIPNGGLSG
                     FYSIVIQGLNFNTKQLSLLNIPTGVIGWIAALFWVFLAKYTRQPLLCAMGSVLVCLAG
                     TIVLKVVPKSNIGGSLAALYIVYMYWAPYMVFGQLLMYANVGGTSKKVAVFTISYLGY
                     CVGNLVGPQSFLSREAPGYPTAYTVMLAGYCVSIGLMSLYGFLCWRDNKKKVAQGTEW
                     QKSVTSQDTTVPEEWKDLTDKQNPKFRYTF"
     mRNA            join(<256046..256090,256140..256284,256335..256402,
                     256451..256513,256566..256640,256696..256784,
                     256835..256903,256966..257038,257093..257161,
                     257211..257281,257331..257430,257488..257761,
                     257809..258053,258113..>258139)
                     /locus_tag="CNE00940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657164.1"
                     /db_xref="GeneID:3257783"
     CDS             join(256046..256090,256140..256284,256335..256402,
                     256451..256513,256566..256640,256696..256784,
                     256835..256903,256966..257038,257093..257161,
                     257211..257281,257331..257430,257488..257761,
                     257809..258053,258113..258139)
                     /locus_tag="CNE00940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512858.1"
                     /db_xref="GeneID:3257783"
                     /translation="MAPWTPKEEEAVKRKLDLIVLPLVTISLLLGGTDKVILSTAATF
                     GLKTDLHLVGQQYSWASSIIFFGSMLTVLPQTWLCQRLPTGKIFATNVFFFGVMTFAI
                     MGAKNAASLQAIRFILGMFEGMNTSGAGLVINMWWPKEEQGWRTVLIFNTFSSVLNGL
                     FSYAVQFYTPTKLLSRWQLLYLITACISVAFGVVDWFCLPANATKAWWLTDRQKYIAV
                     QRLAKNQTGMVNTHFKWDHVKEALLDLRTYLYFLISITLNIPNGGLSGFYSIVIQGLN
                     FNTKQLSLLNIPTGVIGWIAALFWVFLAKYTRQPLLCAMGSVLVCLAGTIVLKVVPKS
                     NIGGSLAALYIVYMYWAPYMVFGQLLMYANVGGTSKKVAVFTISYLGYCVGNLVGPQS
                     FLSREAPGYPTAYTVMLAGYCVSIGLMSLYGFLCWRDNKKKVAQGTEWQKSVTSQDTT
                     VPEEWKDLTDKQNPKFRYTF"
     gene            258520..263861
                     /locus_tag="CNE00950"
                     /db_xref="GeneID:3257587"
     mRNA            join(258520..259006,259054..259121,259168..259342,
                     259394..259468,259517..259670,259718..260083,
                     260135..260226,260284..260554,260599..260890,
                     260940..261569,261617..261775,261821..262010,
                     262058..262421,262475..262817,262867..262991,
                     263039..263399,263451..263861)
                     /locus_tag="CNE00950"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657165.1"
                     /db_xref="GeneID:3257587"
     CDS             join(258947..259006,259054..259121,259168..259342,
                     259394..259468,259517..259670,259718..260083,
                     260135..260226,260284..260554,260599..260890,
                     260940..261569,261617..261775,261821..262010,
                     262058..262421,262475..262817,262867..262991,
                     263039..263399,263451..263655)
                     /locus_tag="CNE00950"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024512859.1"
                     /db_xref="GeneID:3257587"
                     /translation="MPAPVSDKVKICIDRGGTFCDIIALSESKGDHLVKLLSVDPDNY
                     ADAPTEGVRRVLEWFTGEKIPRNQPIDTSKIEYLRMGTTVATNALLERKGERCALLIN
                     KGHTDALEIAFQTRPFLFQLAVKKPDVLYSKVVEIDERIIPEWQEFVEEGRMVAENGD
                     RLIKTSSGVTVRELKPLDEEEVLNQLKDLFEEGYRSLAIVLAHSYLLPDDEQRIAQMA
                     WGMGFTNVSVSSSIEAKIGFIARGQSTTADAYLTPEVKRYLQGFVKGFKNRLEGSQCK
                     VSFMQSDGALADFKSFSGLRAILSGPAGGVVGYARTSYDPLEGSPVVGFDMGGTSTDV
                     SRYNGSYEHVFETTTAGIAIQVPQLDINTVAAGGGSILTYRNQIFNVGPESAGAHPGP
                     ACYRKGGPLTVTDANLFLGRLHIDSFPKIFGPSEDMPLDYDIVCQKFEELTTSINKEN
                     ESNLSPAEVALGFINVANSSMARPIRGLTEQRGFRTSAHNLSCFGGAGGQHATALAAL
                     LGMHYVIVHKYSSILSAYGMALAEVAVDVSEPFVQEFSMSAMPATEERLGALRARALK
                     KLSDQGVQERTVVYDDYLNLQYAGSDTTLMILRPADGDFARAFVEEHKREFAFTLDAP
                     IMIAAVRVRATSKTTSLDLSEQSPYVDELRQLEASKITPLKPQPFASNSVYFEELGKF
                     TDVPLYRLQDLVPGMKVAGPSIILDNTQTVVLHPQNTAKILKSHVFIDVGLGPRKAVD
                     LNSVDPIQLSIFSHRFMGIAEQMCRALQKTAVSVSIKERLDFSCALFDAGGELVANAP
                     NVPAHLGSMQYAVVYQANRRKGELRPGDLLVSNTPEAGGGHLPDITVIQPVFDDAGKD
                     IVFWVAARGHHTDIGGLGGNSHHPDQSVRAEEGVAFESTFAIRDGVFNEQEIVDIFMK
                     AGDYPGCKPTKRIDHNLSDLKAQCSACAVGTTQLHALFDEYGKDVVHFYMKAIRDNAE
                     ACTRDALKSYAGRTFRATDHFDDGTVVKLKIDIDENGTGTFDFTGTGPEVLANFNAPE
                     AITRSGLLYCLRTMSGTDIPMNAGVLAPLNIIIPQGSVLSASEDAAVSQGNGEVAQRV
                     ADIVFTAFNVMSGSHGSMNGTHLMYKKHTWAETTCGGASAGPTWDGQSAVHTNMTNTR
                     IGDLELLETRFPAILREFSIRRGTGGAGRYRGGDGICRIYEARVAMEASHDGQRRVIA
                     PHGSSGGLDGERGASYLKKKKLNGGYRVVKLKPAHQVQMQVGEQLIVHTAGAGGWGTP
                     VDLIEEGYNREGNNYNHVKSKEGSKPPPFTRGNGSVSQWGQAQAECD"
     STS             263426..264075
                     /standard_name="Sal8"
                     /db_xref="UniSTS:470792"
     gene            complement(264188..266058)
                     /locus_tag="CNE00960"
                     /db_xref="GeneID:3257846"
     mRNA            complement(join(264188..264507,264561..264819,
                     264876..265371,265423..266058))
                     /locus_tag="CNE00960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570837.1"
                     /db_xref="GeneID:3257846"
     CDS             complement(join(264349..264507,264561..264819,
                     264876..265371,265423..265861))
                     /locus_tag="CNE00960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570837.1"
                     /db_xref="GeneID:3257846"
                     /translation="MDTFVPIDCGFFLEDDPEAPPADATVHFRELLPKPGHPRILGIT
                     DHTSHTWCEHRRGLPAPAWLINKLDLKNLPRPYKGFSTDGHPDPTIFQYAEDEGAPVE
                     AAVAAVNKLLDHLPEELKNECIKGDVETDDEFRAWSNPEFYVNPGGVRLDETTPEIQD
                     LVHDVLKASLSPDGYQKAVGCTLTNHFLGELVGGLTVLNKHSYNFRLFLPPATKLPST
                     TEPWGFSFFGHHMCVNVVFCGKRMVIGPTFMGAEPDLIDVGPHAGLRLFSQEEVRALT
                     LMRDLSEENRKLAQLCEGMDLAHGIPEHRWAAFDERHLGGARQDNRIVPFEGVPISKL
                     TPLQREEVYAIVQAFNTYLPEKVLKAKMDRVRKFEDQTYFAWIGKYGLSDPYYFRVHS
                     PVTFCEFDFHCGIFLTNTSPAKCHIHTINRLPNCEDYGKALIWQWQKEQAAKKQQQEA
                     "
     gene            267125..272706
                     /locus_tag="CNE00970"
                     /db_xref="GeneID:3257970"
     mRNA            join(267125..268185,268232..268621,268675..268800,
                     268849..269085,269137..269281,269330..269613,
                     269663..269821,269871..270547,270595..271099,
                     271148..271257,271314..271552,271617..271828,
                     271884..271947,271990..272209,272262..272334,
                     272399..272706)
                     /locus_tag="CNE00970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571168.2"
                     /db_xref="GeneID:3257970"
     CDS             join(267190..268185,268232..268621,268675..268800,
                     268849..269085,269137..269281,269330..269613,
                     269663..269821,269871..270547,270595..271099,
                     271148..271257,271314..271552,271617..271828,
                     271884..271947,271990..272209,272262..272334,
                     272399..272584)
                     /locus_tag="CNE00970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571168.1"
                     /db_xref="GeneID:3257970"
                     /translation="MPPRRTTRAVSSSTAAPAPSTRTRRGRKAAASSAPSVDSDEDDG
                     ITVTQGSSDQEEAEEAQEETKPKARRGVSKAKPKAVPAPKRRNVGTSVALEKEDSEDE
                     LGLSPPRPKVKKAVPAPNSRVKEQMVTSEDEDEAEEELQNALRARRASTATLAASEPP
                     TPTPQAHEEDDRSATPRASSGAPEIRIERADSDDNDEVSTVGQKTPTKPPRSSSEKPV
                     TPLRSPHTSAPAPAPRPAQSGPKSRLTIHKLVLVNFKSYAGRQEIGPFHKSFSAIVGP
                     NGSGKSNTIDALLFVFGYRASKMRQGKLSELIHNSAGKENLESCSVEVWFREIIDLPG
                     ANDFLLVPNSQIIVNRTAFRNNSSKYTINDRTSSFTEVTTLLKGKGIDLDHNRFLILQ
                     GEVESIAQMKAKAQNEHEDGLLEYLEDIIGTTKYKEPIEQASLEFEALNEERVEKMNR
                     LRVVEREKAALEGQKQEAEEYLRASNELTRMTSKQWQLWMYHLQNQTEITSKAIERLE
                     SQLAAEQERNAEHIATVDDLQKEYEERLASIAEVKAMLDKLHKEAKKYEKEQVGYAEK
                     KKHLETKMKKIKKSITEDGHAKSEALAAIESYTEQLESNRKKVADLEEKLESEQAELE
                     EVVDSLKDKTAVFTTQIEIKQRELEPWTAKISEKQSVMDVAKSERDLLAEKATGILKS
                     MQEAEEHLQSLRDGDGEKQEEYARLKKEASKIKKLTAEGEAKVDSMTTKWDQLRGKVS
                     ASRLKTDEARASLAADKSENAVLSSLNKLRDQGRIKGFHGRLGDLGVIDDKYDVAVTT
                     ACPTLNHLIVDSVKQGEACIDFLRKGNIGRANIMVLEKLPQKAPNPIQTPENVPRLFD
                     LIKPKDPRFAPAFYKGLGNTLVANDLEQAQRIGFGSSQRWRVVTLGGQLIDPSGTMSG
                     GGNRVARGGMSSKFKADKVAPEVVVKLEKESADAEAELQKLQEEKKAIESEVVSLKRR
                     LPEIEMEMEKIELDVSTATKRIVEAEKRLSELKSQSKPDAGDEKRIKTLDAEIASLTK
                     ETDKLREKSSSINDDIKSLQNKILEVGGVRLRAIQSKVSITKGLLDLANESITKAEVG
                     QAKAERDVEKLERSIANNNTTLEEVVEELELVESNLEGCTADLNKVIDSIQQVNDSSD
                     DINEDFEQSKQLLEEKQAGINAFRALEMDYKQQIEDNARKLKESQEKYQFYERKLAGL
                     ELVYIDEDDDEEDDEGAVDEEKKLNDAGEANEEDGAGGGHEDEEAAEAPSRKKKKQNS
                     MELEQYSPDELRATNETALKAYIAELEDDVKNSRPNLNILAEYRKREAEFLDRARDLE
                     TVTKARDAAKARYDELRKVRLDEFMAGFTAITAKLKEMYQMITMGGNAEIELIDSMDP
                     FSEGVVLSIMPPKKSWRAIANLSGGEKTLASLALVFALHVFKPTPLYFMDEIDAALDF
                     KNVSIVANYIQSKTQAAQFIVISLRNDMFELAHRLVGIYKTSNCTKSIAIDNKDLRLQ
                     ARPKRPPGVPPTPGTLRVPLTPTPRRRAESRVEEDTVPATPGTVNV"
     gene            complement(272674..274053)
                     /locus_tag="CNE00980"
                     /db_xref="GeneID:3257566"
     mRNA            complement(join(272674..272870,272920..273824,
                     273865..274053))
                     /locus_tag="CNE00980"
                     /product="coproporphyrinogen oxidase, putative"
                     /transcript_id="XM_024657166.1"
                     /db_xref="GeneID:3257566"
     CDS             complement(join(272759..272870,272920..273818))
                     /locus_tag="CNE00980"
                     /codon_start=1
                     /product="coproporphyrinogen oxidase, putative"
                     /protein_id="XP_024512975.1"
                     /db_xref="GeneID:3257566"
                     /translation="MRIRMATWVKSLQDHIVRTMEQIEAAAPPNEFAPSPAPPTFLRD
                     AWIRPEGGEGSSCVLADGRVFEKAGINVSVVHGKLPPKAQMAMLPDHPSLPEPTGTVP
                     FFATGLSIVIHPRNPHVPTVHLNYRYFEIEDPETGKPKAWWFGGGSDLTPSYLDEADA
                     VHFHKTLKHACDQHDERYWPDFKQQCDRYFTITHRGECRGLGGIFFDDLTTTSPVHAP
                     PDGAQGPSAEKIFEFVKSASAAFLPAYVPIVYKHMNDSWTPEEKRWQQLRRGRYVEFN
                     LVYDRGTKFGLNTPGARIESILMSLPETARWEYMSPLGREGSGTREEKLMEVLKNPRD
                     WV"
     gene            274268..276621
                     /locus_tag="CNE00990"
                     /db_xref="GeneID:3257769"
     mRNA            join(274268..274865,274921..274987,275041..275214,
                     275264..275811,275862..276134,276186..276621)
                     /locus_tag="CNE00990"
                     /product="ubiquinone biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_570839.2"
                     /db_xref="GeneID:3257769"
     CDS             join(274311..274865,274921..274987,275041..275214,
                     275264..275811,275862..276134,276186..276458)
                     /locus_tag="CNE00990"
                     /codon_start=1
                     /product="ubiquinone biosynthesis-related protein,
                     putative"
                     /protein_id="XP_570839.1"
                     /db_xref="GeneID:3257769"
                     /translation="MLSAALRVLARAAAIQRAEAAARTATAHSSPAGSLTALDRLIDA
                     APHHPPPPAPGTHPADKGHGISLPLSLKRGYRGPVKYVQPGPRPKPETVESVESVESV
                     RPIETVKSSPLTAIPLTKPLGPAEPAEPAEPAEPVEPTRPAETVNAATVDVDADTPPA
                     QPVPPIVKQLEAAAEAEAEAAEDDETPVILRASRVPASRLGRLFHYGSLAASLSWGAA
                     SESIRRSTGGNSSGSVFMSDANIRRLVSTLGRMRGAALKLGQFMSIQDNHMLPPEIEQ
                     VLHQVQAHANYMPDWQMDKVLRDELGADWQANLFTQFDRTPIASASIGQVHRAVLKDG
                     RQVAVKIQFPGVASSIESDLSNLSLLLRTSALLPKGLYLQNTIAVMRRELEDECDYIR
                     EAAAGKKFAHLLAGDPFFIVPHVVDEATTGKVLTTEWMDGKPLSRVKNLSQETRDLIG
                     THILRLCLCELFQFRFMQTDPNWANFLFTPASSSAPPHIQLIDFGASREYTKQFMDGW
                     YRLLKSALEGDREKMRVESLSLGYLTGQENDEMVQAHLDSMALVASPFAHHGPYPFAN
                     QTITDSIRALIPIMLKHRLTPPPQETYSLNRKLSGAFLMCAKMRANVDCRKLWEEQVG
                     GYKQG"
     gene            complement(276279..280583)
                     /locus_tag="CNE01000"
                     /db_xref="GeneID:3257762"
     mRNA            complement(join(276279..276757,276831..277867,
                     277928..278332,278382..279799,279851..279903,
                     279961..280257,280309..280347,280395..280583))
                     /locus_tag="CNE01000"
                     /product="GTPase activating protein, putative"
                     /transcript_id="XM_570841.2"
                     /db_xref="GeneID:3257762"
     CDS             complement(join(276674..276757,276831..277867,
                     277928..278332,278382..279799,279851..279903,
                     279961..280257,280309..280347,280395..280490))
                     /locus_tag="CNE01000"
                     /codon_start=1
                     /product="GTPase activating protein, putative"
                     /protein_id="XP_570841.1"
                     /db_xref="GeneID:3257762"
                     /translation="MAPVTLPPSFYNSFWSPDYRSGLEVLFKNLEQGCLENEDVTAFI
                     ESQVRGHHSLASTLLSPPLPSTSTESSSSLSHTLLSLRGASSARGEAHLALAQELEER
                     VLLAWKAWVDRHGIRIKEAKAEMLGKSGVVSVWEKDAHKLEQLKKAYLAKTRAADDAE
                     DDVKFAPATSRSPPPDNYTSSPKLPQVKLSGANLRRTGTVADRITEKLRAASVSSGSS
                     APGSSPSKHLNTISVDGKVLPPPPSPLKTEDLVGGGSLDSPGSPREECFIPPTDPHGK
                     PTLPGVESTTHELHSSPDPNVAPILLSGLSLTPRGLKEILQRLDTYLLTTVAPNAEPP
                     TTSSTKSNPALASRQRSTILGTYEKTVSGAEIVNWLADNVEAFGGDWERCADAADELH
                     KMGYFSRIGVGRGFDASDDTYFILKVNGHETVSHQPFALPTPLSPSNATNTIPSIFKQ
                     YHLYLPASLANSDEPPHVRLRRDAHKADEMYREGVWSAEEKRLEMEERIERGLRLWER
                     WERERLSAVKTVLKQYETTLAKLPSKLANLQKSTELSVEAFNPEADIKALIEGNRTGP
                     FRPQSHVYESVDTDVPDVNFGIDLRRWSGERGWKSLVHAPKREKGAIPEALEALLGAL
                     AEMYDSISEEERRRAWIYEVPLMETHMLRNAINNPKIPVDDLISIVKKFNAPVAAGTI
                     KLYLLELNPPVMGWEGWEDAKAVYPAVGADQDVDMTSAVASVLGRLPGSHIFALDAVI
                     KHFRTLIDTTKSAEPDEVYTTKLALSVGRTILRPQFETDLTIGDRTPSLFLADLIRHY
                     TALFPPLVEKLKAETDRPMPVRKRTALVDQRVSRSSLGKDVDPQHLLELQRAQMRATS
                     PAPRGGKDLPPIQSQQQAVPTTPSPAPALTATAGSATNPVSALGFGPAIEAKKMEEAG
                     SDEDEPFIPPSDTDPKSSTPPAASAAVHRSSVHSANSIRSSRSEGKTDLAPVIASPAA
                     AAAPSHETDPIPPTATTFLSKDTQQVQENEQAPTAAPADGGDVVISSGGSAAGLKRGV
                     SGESSRLRGPRAARGPRPAPGRAHGTSMSTSERPDSPQSIAGSVGQGEGLGRVKSRPT
                     SIHTGAGAGGGTSRPTTPSAGERPSSKYGAQGTSGHGTRGSVSAMAAKFEKREE"
     gene            281167..284757
                     /locus_tag="CNE01010"
                     /db_xref="GeneID:3257662"
     mRNA            join(281167..281739,281796..282699,282747..283240,
                     283292..283564,283617..284096,284143..284217,
                     284272..284757)
                     /locus_tag="CNE01010"
                     /product="importin beta-2 subunit, putative"
                     /transcript_id="XM_570843.2"
                     /db_xref="GeneID:3257662"
     CDS             join(281296..281739,281796..282699,282747..283240,
                     283292..283564,283617..284096,284143..284217,
                     284272..284376)
                     /locus_tag="CNE01010"
                     /codon_start=1
                     /product="importin beta-2 subunit, putative"
                     /protein_id="XP_570843.1"
                     /db_xref="GeneID:3257662"
                     /translation="MAWQPSEQGLQEVLGMLRDTSSVDSEVQRNVAQRLEQLRFVPDF
                     LAYLAHVLIHCTGEQDSHRAVAGLLLKNSLNQRSGPTTNENDARAMAYVKNTVLTGLA
                     DPDQIVRQTVGTVIMCLISNEDVGAWPEALDALTKGMGSTDPNVVEGSFNTLQKICED
                     APHKLDFQVQGRDLLDHLVPQFIEFTNHNVNKVRLYALQILQSLLSIGIAAVTANIDN
                     YIRALFNKASDPSPDIRKSVCASLGLILGSRPDKLVPEMGNVVDYIVFCTQDDDETVA
                     LEASEFWLTFAEDASLKDQLRPYLPKVAPLLLNKMVYSDYDIAVLDMDEYDEDVADKE
                     TDIKPRNYSSKVHAAHESNDPSSSKGAGFSREAADRAFEEDDEEEDEEDDDFFDDEDG
                     TGEWNIRKCSAATLDVLAVSFGAELLEILLPHLRDKIFDAEWQQRESGVLALGAIAEG
                     CIAGLEPHLPQLVPFLLRSLEDKKALVRSITCWSLGRYASWIVQVNPEDKTQYFIPTM
                     EGLLRMVLDHNKRVQEAGCSAFATLEEEAGTEMAPFLEPVLRNLTYAFSKYQQKNLLI
                     LYDAIGTLADSVGDALGQPGYLEILMPPLIDRWQRLGDNDPDLVPLLECLSSVSIAAS
                     QSFTTYTPPVYQRCLNIIHTTLQQYSAFEQDPDNVDEPDRTFIVVALDLLSGLVQGMG
                     EAIHPLILEGQPPLLHLLALCLTHYEPPVRQSAHALLGDMAISCFPILKPVVPQILPS
                     VIEQIVVEPPADCISVCNNAAWAVGEVALQFNNDSAALEPFMPALVQRLIPILLSSKS
                     PKSLSENAAVTIGRLGLVCPALVAPELPNFAQAWCTALWEIKDNDEKDSAFRGLCMMI
                     SANPEGIQSSFVWFCNAICKWQHPSAQLDEMFRTILQGFKNGLGAQWDAQMSNFPPVI
                     RQRLAERYGV"
     gene            284881..287898
                     /locus_tag="CNE01020"
                     /db_xref="GeneID:3257622"
     mRNA            join(284881..285150,285215..285309,285371..285707,
                     285763..285966,286015..286353,286408..287898)
                     /locus_tag="CNE01020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570844.2"
                     /db_xref="GeneID:3257622"
     CDS             join(284914..285150,285215..285309,285371..285707,
                     285763..285966,286015..286353,286408..287853)
                     /locus_tag="CNE01020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570844.1"
                     /db_xref="GeneID:3257622"
                     /translation="MSFFAKLQGSDSESSSGSESEESILSGSEGERQDKKLAAQKKQQ
                     KSKASMFLNSEESESEEESSDEDEEEMSDSDDERQAVANKFLNDAASSDEESEEEDKI
                     IVLSAKDKRFAEMEAAIHSIQNAVKNTDWVLASSELDKLFRFIARHLVTIVASPIPAE
                     GHIPPRFLETLVSLEADVAKTLAAEKSAPKKMAPAKAKAVNGIRQTLKKKSKEFDGVL
                     KTYNEDPEAYTAAYEKANAAPAAPKPKKAAVTTPGEGEDDEFMTIGKGGKTLNLTADG
                     VFKTLREIFEARGRKNTDRAETIKILTKLLEVSETTYQKIRVLLALVPARLDYSQHLV
                     SIPQESWVTALQEFDQLISILIAEPDYLVQETVGEYDDLVERTPEVVDGKKQKVLIAG
                     SLISLLESLDSELTKTLQHTDAHEKGDEYIDRLKHEAPLYTTIVKAQTLFEREQLSDN
                     IARTVIRRLEHIYAKPDIIIEHFESKATQAAAGLKSEITPFDVKRDASGVIHDLAVFI
                     YQSDAPVLRARAILYHIFNQALHGRYHQARDLLLMSHLQDTISHADVTTQILYNRAVM
                     QVGLAAFRLGFIPECQTILSEMFSTLRQKELLAQSVQRYNIQLSPEQELLEKRRLLPF
                     HMHLNVELLEAAYLTSCMLVEIPLLASVDTEEQRRRVTSKTFKRLLDMADRQAFMGPP
                     ENTRDHIIKASQALQAGEWEKARDLIVSIKVWSLLDNAAEVKDILAKKIQEEGLRTSL
                     FTYAAYYDSLSLSHLASTFNLPVGRITSIISRMIYTDELAASLDQIDGVVIFHRVEQS
                     EVQRLAQQLAERTASMLEQNEKTLDVKLGNQGQGQDRDTRAVGGEGGRQQGERRGGRG
                     TYRGRGGRGGRGGFNQGLGTTMGRRVTAQ"
     gene            290340..292869
                     /locus_tag="CNE01030"
                     /db_xref="GeneID:3257623"
     mRNA            join(290340..290763,290832..291055,291108..291343,
                     291408..291553,291607..292122,292176..292276,
                     292334..292442,292498..292869)
                     /locus_tag="CNE01030"
                     /product="choline transporter, putative"
                     /transcript_id="XM_570845.2"
                     /db_xref="GeneID:3257623"
     CDS             join(290571..290763,290832..291055,291108..291343,
                     291408..291553,291607..292122,292176..292276,
                     292334..292442,292498..292703)
                     /locus_tag="CNE01030"
                     /codon_start=1
                     /product="choline transporter, putative"
                     /protein_id="XP_570845.1"
                     /db_xref="GeneID:3257623"
                     /translation="MSDPNSAQSYPLKGPYSQQAVTESIQREQVGLGPYPSRPQGGHV
                     TREGEEEVVDPHKNFHLMSLVGLAYAILNSWTAMATSLSVALPSGGPSAVIWGIVPSF
                     IGNLSMAASMAEICHVYPTAGGQYHWSAILSPAKMAPAVSWVCGWFAASGWVALAATA
                     GSLAGQLITGVIGLMHPNYDPERWHIFLIYTAYTLGACFLNIFGLRLLPMINQTAIFW
                     SLTGAVIIIIVCLSCASPNFQDGDFVFREFINTTGWPDGVAWILGLLQSSFGLTGYDA
                     VSHMVEEMPLPHINAPKTMILAVCIGASSSFVFLICLLFSISDVDSVNSSAAGALLES
                     MYQATNSKAGAVCLQIFPIIAMVFTAQGLMTASSRMVYAFARDGGLPFSRVFAIMNSN
                     GVPIPAVLFTTVLVIIFGCIYLGSSAALNAILSSSVVFLNISYSIPIFLVLIRGRSIL
                     RPPSLPEPTFTLGPILGPICNVVGLCFTALTTVFFLFPPELPVTGTNMNYAVVVLGII
                     FIISVITWIVDGRKNFIGPRDLGALLELARSEVDATKVNVHHHGHSHPNEHQSSVQEK
                     GSVTKDVDSL"
     gene            complement(293127..293214)
                     /locus_tag="CNE01040"
                     /db_xref="GeneID:3257515"
     tRNA            complement(293127..293214)
                     /locus_tag="CNE01040"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:3257515"
     gene            293342..295815
                     /locus_tag="CNE01050"
                     /db_xref="GeneID:3257564"
     mRNA            join(293342..294442,294496..295815)
                     /locus_tag="CNE01050"
                     /product="transporter, putative"
                     /transcript_id="XM_570848.2"
                     /db_xref="GeneID:3257564"
     CDS             join(293354..294442,294496..295635)
                     /locus_tag="CNE01050"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_570848.1"
                     /db_xref="GeneID:3257564"
                     /translation="MSSNHTAIPSNGTQGSASVIPSFPPTSSNQSSFKTPLNPNIPQD
                     IAVIMELVANNEVVGALPPVDMSAAEKRKQVEENLKNKEHGGKESSTDSDSSSEFESS
                     SEEESEGEKAVDKKPMTAEEHQNLKAQLDAFIGENNGDPNVEFEYDSDPESDDSEDYN
                     FSLDKMGFEFMEDDEDIGPADPGPVLSRNEVPLPAVQPPPISKLPEGERLSLAGDVVS
                     WMPEKKLEAWLEKKAGEMEDGEKKSAVDVEKKTDEGPLSGVEESEAKEVEKELAIDPQ
                     PESVDDSTATGVAVKQQTTKKYAEAGTEQVTSVTGGPTKKISKAEPTFTSAGTVVVRA
                     MQSRPGDFDDGWLEEGSILCWEDGRVLGTVYETFGPLTSPFYTVRLPPPPFPYPTPGS
                     LATGTRLFYPFNPSYRSFVNMIAVRDPRYKGTDASNIYDEEVPEEEMEWSDDEAEAAA
                     KRERKQKKKGNKQSSVAGTPRGGRTSLPSRQHWDHQPNDETMSETGSLYGGGDDNRWE
                     AGSDTGSTASGRGRPMPVSYGDLDDLSSQSTGGRGGGGRGGGRGRGNQGRDRGRGRGG
                     RSSYPLPPRPMQDQPYSNQWQPQQPFMPAYPAYGQSYPQTVPSYPQQPQNASAQHAPY
                     EPHQPYAGMGATAHTYTPQGQQGVPGMYSPQPQQQQGMYSPYPQEPYGGTIPMYPTQP
                     QQQGGVAINPRFAAQYQMMMGMAQMQARQQGGQGTPYGYGQQQEQQNHQGQEQGQEQP
                     KY"
     gene            complement(295708..301921)
                     /locus_tag="CNE01060"
                     /db_xref="GeneID:3257779"
     mRNA            complement(join(295708..295961,296009..296094,
                     296151..296223,296280..296330,296382..296551,
                     296611..296696,296751..296997,297053..297111,
                     297163..297250,297307..297324,297378..297479,
                     297537..297586,297642..297910,297967..298090,
                     298148..298447,298506..298819,298876..299092,
                     299156..299165,299224..299430,299495..299514,
                     299572..299664,299735..299847,299897..300070,
                     300123..300225,300277..300380,300436..300529,
                     300587..300893,300943..301199,301251..301348,
                     301412..301428,301488..301921))
                     /locus_tag="CNE01060"
                     /product="expressed protein"
                     /transcript_id="XM_024657167.1"
                     /db_xref="GeneID:3257779"
     CDS             complement(join(295822..295961,296009..296094,
                     296151..296223,296280..296330,296382..296551,
                     296611..296696,296751..296997,297053..297111,
                     297163..297250,297307..297324,297378..297479,
                     297537..297586,297642..297910,297967..298090,
                     298148..298447,298506..298819,298876..299092,
                     299156..299165,299224..299430,299495..299514,
                     299572..299664,299735..299847,299897..300070,
                     300123..300225,300277..300380,300436..300529,
                     300587..300893,300943..301199,301251..301348,
                     301412..301428,301488..301828))
                     /locus_tag="CNE01060"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512862.1"
                     /db_xref="GeneID:3257779"
                     /translation="MPTSPAPSPKNNPSSSPLPSTDNMPTAYSPPSSYHVPPPKHSPL
                     SQTFSSDRQPHSRRVSLATPDISGARPSSGMSSRVNDQAQKSKVLGLQDRLRKEVDGV
                     VKRRSGGVLGRGYILKTDHFPTGRAMDLDLNIQGAPNFRAPNEESLNVFGVAQPTSTG
                     LKSILTLLGCQPAFLRRPNRRGSAAANTPPLSLGDRRVSRTESPIRSTNLERFNSIDE
                     REPQGKAIWFSTREETLVYCNGRPYVLRDASTPYQTLALSDRASNLEDIERRLKLDIL
                     DEARKYGGMILTHDEITGGTIIPTWVSVDEESIQTPKEMWDDMKRQGWRVDYWRIPIA
                     PDTPIEHNYLDAYMSVLKNTDPQTTALVFNCGMGVVRTTFAMCAAMLVRRKQLLLLGL
                     EDPFASVTSSGFCTPSAMIPQAAQFKMQATAQQALNKSLLKVTRVLNRNLPSKHPSTA
                     IDLLTTQPTLLDQLCRAHMGSYQIVLSLLSSLDQGKPMKQLVDAVIDSCDAVINLREN
                     VMEERIKYSVAAMEDRKRQTHLEKALRSLEQYFDLIVFAAYVDDENAGTTGVSFSTFL
                     KSRPEIWNQIKVLRRRGGNRLFAFAPVNDLSIISRSSEMDDKFVIHREVDLQGGKVLG
                     DEWAEHVVTNRNGIMLRANTLLKSDLWLTEAASSNEGVRGAIGFRQIKGSTIYATGQP
                     TQDAISTILSTVHERWPNIESVIWVCLREEPLVMINGSPYCLRRDSTALRNMRDYSGV
                     SSSRLEMLEQRLKSDVITEIEQFQGRVLLHTETADGQVMPVWESVDKQDVASLREVMD
                     NAAAASKDVYLNFVRIPVTSESSPDFHDITELLNLCTRRNLSSSAIILNDQLGRGRSS
                     TTAVIVLLIQRWLKEGRNQKTQTPRTPSRSRPPMLRKLTTAGGSARTSWQIINSCLRV
                     IRNGLDVKQVVDEAIDATATQFNVRKAIEDLYVEAQEATEPDRKRKLTELGLHHLKRY
                     YHLLLFAAYLDDRAPEEEDPYSFESFVKHRPVFKTLEKELEAGGLESLAPIEKMELAD
                     GMALPDEVTQVVANRSGAILSAQTILKSDFFSGLQKQSLPERVEGAANYRRLPLICEP
                     HHEEDGHASPHYVYGTGMPSCEGLRNALKKMDAGPDGSRKVVWTSLREEPVLYINSRP
                     HVLRLVDKPLTNVETTGVTAAVVERMEVAMKQDALKELRHSEGRLLLHDEVETKPGCY
                     EIIPIWETCQESDIMTPRELYESVISEGYKVDYMRVAITDEQAPLPVTFQVVVDRVAE
                     GLKQGTDFVFNCQMGRGRTTTGMTVASLIATIASNDSPFDGGFITDEEEEEEEEEAVA
                     EANQYLNGEYKTILQLVTVMSHGKEAKRITDRAINLMEGVQNLRKAVYDFKLQVDAAE
                     PGSAKHKAQTTRAINYLYRYGALVVLANFLLEMKEEGIPLEKTDFPAWFDKHREIRTA
                     LSRSTLE"
     gene            302311..303789
                     /locus_tag="CNE01070"
                     /db_xref="GeneID:3257803"
     mRNA            join(302311..302466,302540..303591,303645..303789)
                     /locus_tag="CNE01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657168.1"
                     /db_xref="GeneID:3257803"
     CDS             join(302418..302466,302540..303591)
                     /locus_tag="CNE01070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512864.1"
                     /db_xref="GeneID:3257803"
                     /translation="MPDLEFPLPPDIRDAAGNGHLLPTSSHINPTHAKKVPRVVHPLY
                     PRKHPGDILLITEDNVGFYVSLPFITRHCGFLEGYESLKKEITGEQKPSLKEHEEKEE
                     CQAERRELPSAMSWGLRLVLDTLGVIESMTLAIDSFSSTAQSLSSSAVLDPQTFNDRW
                     PLDVVFQYLAPAVRLADAYDIPEFIAYMGMILPDDPWHRYMMAALSENETLAKETSTE
                     TVKYHISDMPPPVVSILYKSASSYLWRLRKLHTKKMESYPGLKMAWGCAFPMYDKNED
                     FGSRCQKGKYGVPMCITYENFEGDFARLRAVAAERAFGILKREKSDEKVKKAIKDDIG
                     RWISCFRCRRRLLKTFLIIWDNWVTQWRPQTI"
     gene            complement(303323..306578)
                     /locus_tag="CNE01080"
                     /db_xref="GeneID:3257645"
     mRNA            complement(join(303323..303583,303630..303907,
                     303964..304641,304696..304998,305054..305120,
                     305174..305326,305387..305520,305570..305758,
                     305811..305915,305971..306196,306259..306578))
                     /locus_tag="CNE01080"
                     /product="endopolyphosphatase, putative"
                     /transcript_id="XM_024657169.1"
                     /db_xref="GeneID:3257645"
     CDS             complement(join(303883..303907,303964..304641,
                     304696..304998,305054..305120,305174..305326,
                     305387..305520,305570..305758,305811..305915,
                     305971..306196,306259..306415))
                     /locus_tag="CNE01080"
                     /codon_start=1
                     /product="endopolyphosphatase, putative"
                     /protein_id="XP_024512865.1"
                     /db_xref="GeneID:3257645"
                     /translation="MRSPLLASLFALALSIASSEAAISSTEQVPLSGSVPQLDHSELQ
                     NVRINKKRPLKGRFLHITDIHPDPHYKTGSTFDSGCHRKPKKDGKSEGKKATENERGN
                     EDLDDKEFDTLIKNEDLAGKWGTAVSDCDCPMSLVNITFDWLKEEWANEVDFVVWTGD
                     NARHDIDRRIPRTPKEIFDSNRMIVDRMLDAFGRDMPIVPSIGNNDIYPHNVLAAGPS
                     RITEEFLLIWKHFIPSEAAHVFERGAYFSVEVIPDRLAVISLNTLFWYDANTLVDGCR
                     DHSNDPGALEMDWLEVQLNNFRQRGMQVWLTGHVPPHMNHYYDNCYLRYGDLALRYQD
                     TIVGHLFGHMNVDHFFFIDVDELEATSELTSTSSNTTLSDLPLLHGPRLPRPGPGKYT
                     AMGRSGARKLEEELRKDFGQMPGPGILKLKDYAVMNVAPSVIPTYYPGIRIFSYNISD
                     EEDSFDQGHSYQGADELLDDEDEGDELEELELPSDNGFFGGLDERENEDIEILKGSGG
                     HRHDVPKGDCSLPSNEDKPHCTFKRKPRHYSKRSPSRTNRALSPLGYTQFYLPSMMKQ
                     KKRPKWEVEYTTYKVKTLVPSSPENTTQPLPVPLHLLPRYDPSIFSKPKNKTEEKEVA
                     KKTAKFYKAVKAVTPYRMKDLTIGSWVKLARMLVLEKKRWKKFAELMLVSTETD"
     gene            306794..308289
                     /locus_tag="CNE01090"
                     /db_xref="GeneID:3257909"
     mRNA            join(306794..307007,307059..307251,307373..307482,
                     307538..307997,308054..308289)
                     /locus_tag="CNE01090"
                     /product="rRNA primary transcript binding protein,
                     putative"
                     /transcript_id="XM_571230.2"
                     /db_xref="GeneID:3257909"
     CDS             join(307005..307007,307059..307251,307373..307482,
                     307538..307997,308054..308154)
                     /locus_tag="CNE01090"
                     /codon_start=1
                     /product="rRNA primary transcript binding protein,
                     putative"
                     /protein_id="XP_571230.1"
                     /db_xref="GeneID:3257909"
                     /translation="MLRRQTRERREYIFKKSQESQERAIYERKQKIKDLLAQGKPLPT
                     ELRNEVRELGGKDLVLDEAQQDPRSHIDDEYAKVGTYDPKIVITTSRSPSSRLLQFSK
                     ELRLVFPNSYRLNRGNTVVKDLVSACNAQGVTDLVVVHEHRGVPDALIVSHLPHGPTL
                     SMTLHNVTLRHDVSSNSSTVSEQYPHLIFDGFSTKLGERVTGILKALFPVPKDDAKRV
                     MTFKNENDFISFRHHVFANTGHKDVQLAEVGPRFEAKPFEIRQGTVDQTEADVEWLLR
                     PYLRTAKKRNQF"
     gene            complement(308292..311145)
                     /locus_tag="CNE01100"
                     /db_xref="GeneID:3257561"
     mRNA            complement(join(308292..308473,308533..308770,
                     308828..308859,308911..309006,309060..309190,
                     309247..309330,309380..309520,309572..309800,
                     309857..309930,309986..310134,310203..310323,
                     310374..310439,310486..310736,310841..310926,
                     310986..311145))
                     /locus_tag="CNE01100"
                     /product="long-chain-fatty-acid--CoA ligase, putative"
                     /transcript_id="XM_024657170.1"
                     /db_xref="GeneID:3257561"
     CDS             complement(join(308364..308473,308533..308770,
                     308828..308859,308911..309006,309060..309190,
                     309247..309330,309380..309520,309572..309800,
                     309857..309930,309986..310134,310203..310323,
                     310374..310439,310486..310736,310841..310926,
                     310986..311013))
                     /locus_tag="CNE01100"
                     /codon_start=1
                     /product="long-chain-fatty-acid--CoA ligase, putative"
                     /protein_id="XP_024512867.1"
                     /db_xref="GeneID:3257561"
                     /translation="MEKQLSIAECDRILTGPGSPMETEEKVIFGRRLTVWKHLPSTFR
                     DFLIFNLQKYSQREFISSPLPLREPFKSSETLTDKVDPREHLTFGDVLDRSLKLAAWM
                     RSRGIKMGDRVVIGGKNCTGWIVSFIAVHLIGAVTVCLNCWVPREQMVYSIKMVEPSL
                     ALLDEERAEILGPFTHVKENGLPPMFCWAESGHLPSVVEIYSTPNNQRTKEVLDGVGL
                     DGLGPESDAVIFYSSGTSGFPKAVLSTQRMALSNAISGMVATARAVLRAGLPLPQPPK
                     PTDPQRVVLLSIPLFHVTGCLSWLLRAITNGSKFVTSRKWDVKEAVRLIVEEGVHTVG
                     GVPAIASQILQSPDLPDNTTLDSIFYGGAPPSKHMANEVRKRWPKAAVIHGYGLTETN
                     AVACAVCGADYLSRPDSTGPPVPICEIRIVNPDTRKALPTGQQGLILIKGAQVMKCYY
                     GNEQATKQAIDEEGWLDTGDAGYLDEEGFLFIKDRLKDLIIRGGENIASVDVENALTS
                     HPHIDEVAAIALPHPILGEVVGAAVTLRESAKARGVKVTEESILGHVRSKLPKHAVPA
                     MVMIWEGSLPKNVNGKTMKKEIKSVAIKEWERRQGANSRGAKAKL"
     STS             310807..311606
                     /standard_name="Eco24"
                     /db_xref="UniSTS:470793"
     gene            complement(311353..312979)
                     /locus_tag="CNE01110"
                     /db_xref="GeneID:3257685"
     mRNA            complement(join(311353..312261,312325..312354,
                     312417..312457,312525..312595,312655..312684,
                     312770..312979))
                     /locus_tag="CNE01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657171.1"
                     /db_xref="GeneID:3257685"
     CDS             complement(join(311966..312261,312325..312354,
                     312417..312457,312525..312595,312655..312684,
                     312770..312829))
                     /locus_tag="CNE01110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512868.1"
                     /db_xref="GeneID:3257685"
                     /translation="MAQSASSAEKSRRAAQAQRAYEIQLAGGLQGALRWTVYGAVACL
                     IGHYTWPTFRRQTLGLKAFITSSATICGLVIGADSHLLKHEHGFREAENEIRRKARNS
                     LALEGKIASESEIRKWREKYEKEMSQAKEKETELLGLGSESASVDQGANKEGAVLQAL
                     QGEGQLSSSPREKKA"
     gene            313132..314224
                     /locus_tag="CNE01120"
                     /db_xref="GeneID:3257497"
     mRNA            join(313132..313352,313428..313456,313514..313688,
                     313771..313852,313920..314021,314079..314224)
                     /locus_tag="CNE01120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657172.1"
                     /db_xref="GeneID:3257497"
     CDS             join(313219..313352,313428..313456,313514..313688,
                     313771..313852,313920..314021,314079..314120)
                     /locus_tag="CNE01120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512992.1"
                     /db_xref="GeneID:3257497"
                     /translation="MSLRALTYSSSVLYKPFALRSVRGLATKAADVPPLPPFNDETAH
                     KKVKAAQDKWNTKNPSLISPAYTPTSIWRNRDEFFSGTAAIEDFLTRKWEKEKNYRLR
                     KELFAFNGNKIAVEFWYEYSETDDPSSQWYRTYGLEHWVFAEDGRMKSRQMSGNTVKI
                     ANEERWFKDGVDVNEGQIPPGHISSEK"
     gene            314465..316684
                     /locus_tag="CNE01130"
                     /db_xref="GeneID:3257958"
     mRNA            join(314465..314705,314756..314873,314926..315315,
                     315367..315822,315869..316394,316444..316684)
                     /locus_tag="CNE01130"
                     /product="phosphoacetylglucosamine mutase, putative"
                     /transcript_id="XM_570701.2"
                     /db_xref="GeneID:3257958"
     CDS             join(314578..314705,314756..314873,314926..315315,
                     315367..315822,315869..316394,316444..316496)
                     /locus_tag="CNE01130"
                     /codon_start=1
                     /product="phosphoacetylglucosamine mutase, putative"
                     /protein_id="XP_570701.1"
                     /db_xref="GeneID:3257958"
                     /translation="MSDPQQAAHNHALLMEAITKAARKYPKPEDVNYTYGTAGFRTLA
                     TKLPSVVLRVALLAVLRSKRLEGATVGVMVTASHNPEPDNGVKLVDPSGEMLDATWEA
                     HATALANCPSTESLLSTFTTLVTHLRVDLSQPASVVYARDTRPSGPELIAALEEGLKA
                     FGEGVNISDIGVTTTPILHYVVKATNVKDGAYGKPSIEGYMEKMSSAFKTLIGNKTLS
                     PLYVDCANGVGAQALVQLEKHIGDIFTVNPINTDTTTPGALNHQCGADFVKTRQALPP
                     SVQKAGFLSKPGTRACSFDGDADRIVYYYVDEHKGTFRLLDGDKIAVMVAMFLGDLVK
                     KAKLGEDNELTVGVVQTAYANGSSTKYLTSRNIPVACVSTGVKHLHHAAQRFDIGVYF
                     EANGHGTVLFSPSTITTLQSFQPSSPDTANAVKHLLALYDLINQAVGDALSDMLLVET
                     VLAHRGWGAIEWDAGYEDLPNRLVKVEVPDRTIFVATDAERRLESPPGLQAKIEAAMG
                     KYEMGRSFVRPSGTEDCVRVYAEAALSPETDALASTVTDLVRQASGMV"
     gene            316902..318558
                     /locus_tag="CNE01140"
                     /db_xref="GeneID:3257788"
     mRNA            join(316902..316966,317020..317063,317131..317305,
                     317384..317496,317552..317663,317716..317853,
                     317908..318178,318229..318558)
                     /locus_tag="CNE01140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570702.2"
                     /db_xref="GeneID:3257788"
     CDS             join(316959..316966,317020..317063,317131..317305,
                     317384..317496,317552..317663,317716..317853,
                     317908..318178,318229..318408)
                     /locus_tag="CNE01140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570702.1"
                     /db_xref="GeneID:3257788"
                     /translation="MSGVREATHAGSWYTSSRPGLHKQLSQNLSAVKPISTLDYDPPV
                     SNAKAIIAPHAGYSYSGPAAAWAYAAVPTEKIKRVFLLGPSHHAYLPGVALSKFEAYE
                     TPLGDIPLDTDTINELRDTGIFSDMKSSTDEDEHSLEMHLPYIRLIFQGRDDLKLVPI
                     LVGHPSASTSAKLSEALAKYWQDGETFFVISSDFCHWGSRFSCTPYYPNIPPLANPVP
                     PVKSSTSATPGTLTQPPELVKKFSSASSNPDVPIWKSIEYMDHEGMDLLRKPGEDGAV
                     EKWHGYLERTKNTICGRNPITVLLNLVQFVYKNQPVKPEFVFVRYEQSSKCVNGKDSS
                     VSYVSGVLRLPQ"
     gene            complement(318522..319160)
                     /locus_tag="CNE01150"
                     /db_xref="GeneID:3257806"
     mRNA            complement(join(318522..318605,318759..318928,
                     319040..319160))
                     /locus_tag="CNE01150"
                     /product="NADH-ubiquinone oxidoreductase 12 kda subunit,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_570703.2"
                     /db_xref="GeneID:3257806"
     CDS             complement(join(318570..318605,318759..318928,
                     319040..319073))
                     /locus_tag="CNE01150"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 12 kda subunit,
                     mitochondrial precursor, putative"
                     /protein_id="XP_570703.1"
                     /db_xref="GeneID:3257806"
                     /translation="MATTPSMDDYRERIKAREEHVRESWIKAMEARIVRDELQKCYRG
                     EGVNQLQNCKVLAEKYAAMIRDNKVKGYKQVDPDM"
     gene            319304..320506
                     /locus_tag="CNE01160"
                     /db_xref="GeneID:3257745"
     mRNA            join(319304..319541,319591..319621,319678..319717,
                     319768..319850,319900..320003,320055..320345,
                     320415..320506)
                     /locus_tag="CNE01160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657173.1"
                     /db_xref="GeneID:3257745"
     CDS             join(319372..319541,319591..319621,319678..319717,
                     319768..319850,319900..320003,320055..320280)
                     /locus_tag="CNE01160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512993.1"
                     /db_xref="GeneID:3257745"
                     /translation="MSCSHEAHDHDHGHDGHSHDVPLESSPLDSLYTQIDLPNVMALN
                     AEGGGEAGRKVIKSWDMKEDDTIWLESEIDDELIIKIPFTSSVSLRSITLKSGPGGHT
                     PSEMHLFRDNPGLDFSDASSSSPTQSFDVVPRKEGVEYQVKAAKFNGLTSLTIFFPGN
                     TADDDEETTKVYYIGLRGSWKPLPNRPGVIIYESSANPADHKVPGVNAGGATHRPGY"
     gene            complement(320482..322482)
                     /locus_tag="CNE01165"
                     /db_xref="GeneID:36392854"
     mRNA            complement(join(320482..320746,320801..321274,
                     321330..322027,322080..322482))
                     /locus_tag="CNE01165"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658513.1"
                     /db_xref="GeneID:36392854"
     CDS             complement(join(320666..320746,320801..321274,
                     321330..322027,322080..322116))
                     /locus_tag="CNE01165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514364.1"
                     /db_xref="GeneID:36392854"
                     /translation="MGFRGFLATLFCVSVVRIDTGYTPRTKDFFSSHTTTISPNSSTS
                     TSQSNKRIQKFSDKASARTRVLQEFITSEMTYVNLLQEFDHVYIHTAYEPLTSNFGSK
                     ASPEVTLGTILTAEERKTMFRGLQEILKLHSQHILPQLIVATKSVQQSDGLEGDRSTE
                     AAMNICKVICEFSEWFKLYSSYSSTCDNATTKLTQWISGAGITKQDKARVQAYLAKCK
                     ANRRHSQLDMTGYLLLPVQRLTRYKMLLEQLEKFTPPAPAGTHDYVSEALARISIVLV
                     YVNDYKRSLDSRSRLCHWADHISVVGPSSLVQPHRVLVREGPVNFIARGALIKAPQGI
                     RKPSKHMSRDIATVDKMCMAVLCHDLLVLADSATERYKGKLGLVDVVRLSAMGEARVE
                     WRNVVVFEAYDVSYYLQVDNQTVAEGWVQAINHCRRK"
     gene            322685..325713
                     /locus_tag="CNE01170"
                     /db_xref="GeneID:3257885"
     mRNA            join(322685..322846,322917..323268,323318..323558,
                     323610..323801,323860..324149,324206..324218,
                     324267..324549,324599..324744,324794..324948,
                     325001..325340,325401..325713)
                     /locus_tag="CNE01170"
                     /product="cation-transporting ATPase, putative"
                     /transcript_id="XM_571124.2"
                     /db_xref="GeneID:3257885"
     CDS             join(322754..322846,322917..323268,323318..323558,
                     323610..323801,323860..324149,324206..324218,
                     324267..324549,324599..324744,324794..324948,
                     325001..325340,325401..325638)
                     /locus_tag="CNE01170"
                     /codon_start=1
                     /product="cation-transporting ATPase, putative"
                     /protein_id="XP_571124.1"
                     /db_xref="GeneID:3257885"
                     /translation="MRLPRLFSVVLACIAGLSVVRGQEVKTFKYESDITRLRSLVIHS
                     LYSHKDVFLRELLSNANDALEKLRLTALTDRSVMSAGEGNITIEVVLDEGSAGKTGQI
                     IIKDTGIGMTEHELEKNLGTIARSGTSEFLKRADAGGVDGNLIGQFGLGFYSCFLVSS
                     TVRVSSLPPATKENPNPVQHTFVSSSSGDSFEIFPDPRGNTLGRGTEIVLTIEEEEKE
                     WLSVTKLKGLIEKHSAFSTTFPIYIKEKKTSQVPIESEDEFDDEDAIVDENEQKFETV
                     TEEQWVRVNDKPPIWMREPKEVEETEYRDFFTALAKDPQAETLGWSHFKGDTGDGVSF
                     RAIMYIPSQLPKDFWQKITSGINNVRLMVKRVFITDDLGEEFMPRWLSFLKVVVDADD
                     LPLNVSRETLQNTRFLSQLQRILVRKAIDLFTRIATEQPKKYEEISQLYGNALRLGVL
                     ESKKDHVKLAKLLRFESTRTNYTSLEEYVENRKEGQTQIYYMAGVGEKIDDLKRSPFV
                     EKLIARGYEVLLLNLPSDEPMMGALGNFMGMRTQDVSKKGLKYGDENEHEAEKKELEA
                     QKIAFKPLVDWLKKDLKGQISDVVLTNRLVTSPCTVVVDHMGWSANMQRIMAAQAEAH
                     DDPMFQVMKNLPKVLEINPKSPLIEGLLEKVLELPTTDEEDEDALKKSDEEEELTETV
                     RVLLDTTLVRSGFSVADPTSYFERVEALLRKSLGVSLSAQPQVDVRPAPPTAMGPLDE
                     DGVPSDDFDYDNGMAQEAMGGADEWLDWADMKKQMGHDEL"
     gene            complement(322895..327072)
                     /locus_tag="CNE01180"
                     /db_xref="GeneID:3257998"
     mRNA            complement(join(322895..324926,324991..326052,
                     326107..326290,326353..326430,326484..326563,
                     326622..326664,326735..326799,326865..327072))
                     /locus_tag="CNE01180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657174.1"
                     /db_xref="GeneID:3257998"
     CDS             complement(join(325955..326052,326107..326290,
                     326353..326430,326484..326563,326622..326664,
                     326735..326799,326865..326922))
                     /locus_tag="CNE01180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512815.1"
                     /db_xref="GeneID:3257998"
                     /translation="MAINPRKTLMLICDVQERFRSAIYGFDAMTSSICKLVKATRVLE
                     VPTFVTEQNPKALGSTVEEITSLLDRKDLNQGVIAKTKFSMVTEDTIEAIDFSKYNCF
                     ILTGIESHICVLQTALDLLQYRTKPKVYLAADAVSSCNKEEVPIALRYLQQQGVEVTS
                     SESLIYRLLGDAKEPTFKYIAKLTKEEKENTTHNLQVLQPF"
     gene            327477..329412
                     /locus_tag="CNE01185"
                     /db_xref="GeneID:36392855"
     mRNA            join(327477..327633,327694..327934,327989..328320,
                     328378..328380,328448..328517,328566..328685,
                     328750..329412)
                     /locus_tag="CNE01185"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658514.1"
                     /db_xref="GeneID:36392855"
     CDS             join(327509..327633,327694..327934,327989..328320,
                     328378..328380,328448..328517,328566..328685,
                     328750..329058)
                     /locus_tag="CNE01185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514365.1"
                     /db_xref="GeneID:36392855"
                     /translation="MPPQASSSLPSLNSKLSLQEWLKVLSSRGVDMRVAMGLAAKIYK
                     THSTIELLSKMTPAKVAGLIDDKETRKVINNAIKGLASGEPISKKRGRDSDLLQPLKK
                     DEAEEDTPIDISFQFMTEREQLQGIRVITNRAPVKTAWAYTICMRLGFSHLESLSLAQ
                     AYVHINSLKHALMLGNILGEEETKEARRELEDLPDGDQGSWNKKRGRRLGKDQVTATV
                     AVGSSQPWVGILGSKVPIIERSDGTCRAIQKGVSVRPSQAYLYIRKNFKDHTPHVMGA
                     FKLIADSYEPEELNRIGVHMYNEFKPDVVEWGQRGALELDNVLEFIKDGENNVKERDN
                     QGSSVANPAVSSTALVLSPIGATQQLPQEASDDEPASKKPRRDMTVEEYEAMLDAEYL
                     QGDLPDF"
     gene            complement(330090..330187)
                     /locus_tag="CNE01190"
                     /db_xref="GeneID:3257492"
     tRNA            complement(330090..330187)
                     /locus_tag="CNE01190"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3257492"
     gene            complement(330317..335261)
                     /locus_tag="CNE01200"
                     /db_xref="GeneID:3257674"
     mRNA            complement(join(330317..330560,330610..330826,
                     330875..331028,331083..332195,332246..333113,
                     333165..334759,334815..334837,334889..335261))
                     /locus_tag="CNE01200"
                     /product="rRNA processing-related protein, putative"
                     /transcript_id="XM_570705.2"
                     /db_xref="GeneID:3257674"
     CDS             complement(join(330410..330560,330610..330826,
                     330875..331028,331083..332195,332246..333113,
                     333165..334759,334815..334837,334889..335222))
                     /locus_tag="CNE01200"
                     /codon_start=1
                     /product="rRNA processing-related protein, putative"
                     /protein_id="XP_570705.1"
                     /db_xref="GeneID:3257674"
                     /translation="MAQKKDSQVSKDKSSKKTQNESSSTAPRPAPAFTSTLQNDETDF
                     PRGGGSSLTAFEFKQVREEGRREAENEAKHQASKGEKRKRQMSDRQAKRLKKNEDAKK
                     KEERDKDNIRVEILNYKRLVPGTHVLARVHTILPLHLILSLPNNLLAHVPITEISNTL
                     TQLLTAEEAMAVDEGEEESDDESSAPDLAQLFVPGQYVHAKVLTLYPTASQSFISQYP
                     ITETTKLASRVELTLIPEKVNSEVAKKDLETGYFLVGEVKSEEDKGWIVGVGLNTQGG
                     SSVEGFVSKDEVAKFVPAQALIPGQLLPATISSIAAGGRVAHLSLNQQDITRSQISEV
                     STVGSIVPGHSVNALITAVVPSGLNVKVAGFFDGTIDLAHLPLGEDDIENKYKIGKKI
                     RARVIYDNLAANPHSFALSALPHVLNFTSPTQEGDNTPLELAIPIGKVYQSVKVTRVL
                     NDWGVMVRTQDGLEGFVHISHLADERIPVLSNATPQFKAGTLHRARVIGHSPMDGVLL
                     LSFEQSVLSQLFMQVDELKVGQQLKGTIRRLTDKMLFVNVHGNVDGIVHPTHYADIRL
                     KHPQKRFKPEGSVKARVLYLEPTRNRVVLTLKKTFLESDLAVPQGFEDLKVGEVTLGS
                     VLKIVDKGVIVELFAGLKAFMPHSECSQTHIKNLSEAFYIGKPLTVRVITVDASASRI
                     VVSAKQAAPTAPATAAEKLEVGEAVSGTVSQVHTEQVVVKLDGNGLTALLSLSNLSNQ
                     RHTGIEELRRSLKEGEKIDDLVVVSKNPVSGLIIVNIKKTITAKKEKAKKEDKAPSGI
                     SAHVKAIDAIEVGQIITGTVQEQTSQGYMVQLPNNLRGRVHPCDSSDDLALAAGHGPL
                     TVGEEVKCYVLDVNRSKRAIDLSTRLSRVQGKENVVDREINTVDDLKEGESVRGLVKN
                     IAGHGVFVSLGRNVTARIMIKELFDEYVKDWKSRFEINQLVSGKILSINPGSNSIEMT
                     LRKNPSKSAKKTALLSLSDFEEGQKVVAVVRKVEAYGMFLKIEGSNVSGLCHKSEITD
                     NRKADVAQALKGFREGDQVKAKIVSIDTEKGKISFGIKASYFGEEFEGGEKSEDEDDE
                     VDEENDERFNEGDQEMESDAGESGEGQEHEDEEALEIDGGEEEATSDEEDNAPQNFKP
                     APKTALNLGAGFDWTGEAPAAAPESDDESDSDEEAVAPAKSKGKSKAVDLTATAPSSR
                     PSSTGEYERALLASPNSSFLWIQYMSFHLQLHEIEKARKIGRQALEKISYREEEEKLN
                     VWMALINLEIAFGTVSATEKVFEEAAQYNDKRTVYMRYAEALQVAGKDEALEELFKKI
                     VKKFSAYPESWTRFAEFYLNKGDVEAARALLPRSMKSLDKSKHVETIEKMALLEFKQG
                     DAERGKTLFEGLVDRFPKRLDLWGVYIDQVAKVGDIQGVRGLMDRALEQKLTSKKAKF
                     LFKKWLTIEQRIGDAAGQDKAKTRAREWVEANAKKPAQDEEEDSNDEE"
     gene            335430..337668
                     /locus_tag="CNE01210"
                     /db_xref="GeneID:3257982"
     mRNA            join(335430..335642,335692..335741,335792..336001,
                     336054..336270,336320..336868,336926..337293,
                     337353..337668)
                     /locus_tag="CNE01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657175.1"
                     /db_xref="GeneID:3257982"
     CDS             join(335514..335642,335692..335741,335792..336001,
                     336054..336270,336320..336868,336926..337293,
                     337353..337611)
                     /locus_tag="CNE01210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512816.1"
                     /db_xref="GeneID:3257982"
                     /translation="MSSTGAHPESNISYTTPTKRAVFTSSAEAGPSRPRPSGASPAYS
                     SRRHSLYGIEDRVILDLGSRIWKVGFSGEPEPRAVFFSQDPDDKHSATEAWDLDMESV
                     HGIHGSRSEGGRLIGVRIVQKLRETFIKHLLADSKQRKVVIAENTFLPTYIKEYIAHT
                     LFDNLRVPSVAFTPSSLLALAACGRITGLVVDVGWLETTITPVYSSRPLFPLSRSTPL
                     AGRRLHTRLRSLLSRHAIYIAPPKLLGDLSREKRRGIPLDLLTDTLVEKVVTEGLLVG
                     GVFTEPERDADMEREVESNDYTQTSVPGGKRNLESPRLIDSLESRFASSSSSKDMTFP
                     IHTVEGSSQMGYGTIIVPGWIRERAAEVLFEDDEENEGESIVTVLLNTVLKLPIDLRP
                     SILSSILITGGSASLPGFIPRLRISLLQSLLPPSQSSDDTPVPPSPLNTPASRKEQAL
                     LWKKRIREPYRELYGLVDKVAILNDPAPVDGEVDGGKGGKAPRWVPGLMTWVGGSLAG
                     VLRTGGPELTRENYDTLLSTSLARGDAYRQELEEAYHDVAASIGINVEELKAGEAVRD
                     GRGLGRRRGWKDGKGVVGDWSRAVKAG"
     gene            338141..339751
                     /locus_tag="CNE01220"
                     /db_xref="GeneID:3257884"
     mRNA            join(338141..338236,338330..338458,338520..338607,
                     338661..339466,339523..339751)
                     /locus_tag="CNE01220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570708.1"
                     /db_xref="GeneID:3257884"
     CDS             join(338147..338236,338330..338458,338520..338607,
                     338661..339466,339523..339588)
                     /locus_tag="CNE01220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570708.1"
                     /db_xref="GeneID:3257884"
                     /translation="MSLLAESLAGAKYMVATNDDRESSTNGAAEFLRRKRWPEILLKE
                     LVGSAVFCLKPTLILGSRQYQNGEAWSWKIIYSSPSVYEMLGQRPADLEGRDFFDLVL
                     VDDRPQLQSFFNSLLAPPLLNVEPTLLSSEGPDTLGGSRTTYIRMLSAAPGPSRSDSS
                     SRSSSGQRSLPQSNYGTPVGRILGPVVWEIRAHATGIGEDLGEAAGNGETLRMAADGT
                     VVSAIREGDGKHKAIWLMARQVGEGMNEDQKSLEAFLEVKLENERLLAELQELEEEVG
                     MTVEDSINNNQSASTPSSHSSTDTPPGGDKNKNKAGRPPKTNTQVSASGHKRQKSGTG
                     GPAGASEGETMHVCVTCGRTDSPEWRKGPLGPKTLCNACGLRWAKRNSTHIPKKDKQS
                     "
     gene            340243..340954
                     /locus_tag="CNE01230"
                     /db_xref="GeneID:3257549"
     mRNA            join(340243..340404,340463..340592,340687..340954)
                     /locus_tag="CNE01230"
                     /product="copper chaperone, putative"
                     /transcript_id="XM_571118.2"
                     /db_xref="GeneID:3257549"
     CDS             join(340396..340404,340463..340592,340687..340856)
                     /locus_tag="CNE01230"
                     /codon_start=1
                     /product="copper chaperone, putative"
                     /protein_id="XP_571118.1"
                     /db_xref="GeneID:3257549"
                     /translation="MAAPGTIITSTPGAVPAGPAYQYSVKMTCTGCSGAINRVLGKNI
                     TAPNAYHISLPKQLVLVWGPSLPPFETVTEKIAKTGKTINAKEVIEDASTLPPLEAAA
                     "
     gene            complement(340865..342318)
                     /locus_tag="CNE01240"
                     /db_xref="GeneID:3257951"
     mRNA            complement(join(340865..341456,341524..341643,
                     341710..341770,341821..342318))
                     /locus_tag="CNE01240"
                     /product="thiol oxidase, putative"
                     /transcript_id="XM_570710.2"
                     /db_xref="GeneID:3257951"
     CDS             complement(join(340983..341456,341524..341643,
                     341710..341770,341821..342137))
                     /locus_tag="CNE01240"
                     /codon_start=1
                     /product="thiol oxidase, putative"
                     /protein_id="XP_570710.1"
                     /db_xref="GeneID:3257951"
                     /translation="MLGPLVHIPRILRLALLCAFIVIVPTLYLLYPSEERLPAPGEWQ
                     AGGIDSEHWREPVKPDFARYEHEEGRAWGEELLTQKDASVAMDDDVIHGGVIMPKLGN
                     ATAKAELGRAAWRVLHLMTLRYPDEPTEDDRLALKSYFHLFSRLYPCGECAQEFQKLL
                     KEYPPQTSSRKSASLWLCHVHNQVNARLGKPEFDCLTLDETYDCGCGDDADTSSSVSI
                     ASSPSSAATDFSDANDVNVVKAMTEAVDDPTILSRGGAALQGEFEVVASGEGVGLSAE
                     EVDEERLLEKEEREIISQEQVGVHEWRKSQIVKEEEWEKEKANHGLD"
     gene            342715..346266
                     /locus_tag="CNE01250"
                     /db_xref="GeneID:3257915"
     mRNA            join(342715..342854,342914..344608,344661..346266)
                     /locus_tag="CNE01250"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_571120.2"
                     /db_xref="GeneID:3257915"
     gene            complement(342809..347723)
                     /locus_tag="CNE01260"
                     /db_xref="GeneID:3257693"
     mRNA            complement(join(342809..346432,346487..346632,
                     346691..346796,346849..347072,347126..347287,
                     347342..347521,347588..347723))
                     /locus_tag="CNE01260"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657176.1"
                     /db_xref="GeneID:3257693"
     CDS             join(342943..344608,344661..346075)
                     /locus_tag="CNE01250"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_571120.1"
                     /db_xref="GeneID:3257915"
                     /translation="MVPQPEPVFSTSSSPESSNLPSSDSHPSVYSLQSHYTETGEGTE
                     VSDGDSPPAENLSNEEEKGNNSIGGKKAPEIFVDEGEDEVETGTLQDEYRAKPSYPPP
                     KKPLTPYQLARIAGTFGIVVPSLPHPPPTPVSSAPCEVSLSPSTSQIERQSPLRSSYH
                     AQRHSPFLLSVIPPLMLLPTAAVALTPLEIRKRERKWRRGTLMPLQPTLGGMLLCIAR
                     EYGLPSTSGIHVYLVLNSLGSLPRSSDPPTFSDRGEESDDEPDGPRVSSQTWSTLFST
                     YLVQSSAASNTSRAPTPYQTPVKNGEREVPFFTSPLGQRGNFAKAAPKGHKQSLSLST
                     LAPVSHKTGHSMDSTVTDIPLASTPLMPLTPSTPSMSPFTNPIVGTIEFDIDLEEATW
                     YESWKKKGGGRRWKKSLREEEALESGKKELGLVKKMEATENEQEQKPQFLKELEAARV
                     PSPAPSNEPVSEYMFLEEDESQSTSTGQESDTVLEHDAEISNVVKLLDAQGVKREDLL
                     QSPIQLGWSNERSPDIGPSPVVRRVQEVLDKRWSGLVMSEQLDDLEKIMRRLSPREIH
                     LTSPRYMTPRTAQRIASHDINEDLPKMSNARDLGRSPLAPVAELRTPSMDVNSDSGSD
                     YGDEETHETYETRESMSSRDEEMEDGRPTPQNRQDAWPTLPRHSPASLNDSNLSSFFH
                     HPNFSAPRTNQSPSSETLKRMEEANEPSKPAESREWVPRRPARPPSPRLEQNGTLSHA
                     LPDEYVDILKSPRSPPPTGRASPSTRSFMSPGQEDGRKRSGVGALKGLRHQMSAVNLK
                     WRSESSQGQMTSPAAPSGAGLTSPAEFGILSEDADHLSPENESRSSSLPLPPKVASKF
                     ASRILHPTFAFRRNEDSSSSKPGHGRRHPSHDGPIQISEISSPIPSTFRHTRSGSLAS
                     TLPESAILPSHSIQAVHSRQGSLPHATPRQPSHFPHQPQTPTTPASPASPRSVRRKPV
                     PSMSNSGSTTKDATLSVNMGGPGEGIKSSLSLGSVASFVLEDPPKGKRGLGLAM"
     CDS             complement(join(346310..346432,346487..346632,
                     346691..346796,346849..347072,347126..347287,
                     347342..347521,347588..347609))
                     /locus_tag="CNE01260"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024512818.1"
                     /db_xref="GeneID:3257693"
                     /translation="MPKMRFADIAVNLTDPMFQGKYGGRKKHEADVKAVIERAKAKGV
                     EKILITGTSLKESKDALEMAKEFDLQCSAGVHPTSTCEMDKHPCGAEGYLKELTDLID
                     QDLGEGGSKRIISIGEIGLDYDRLHYSPQKTQLAHLPELLLLQKKYRLPLFLHSRTSG
                     SHTDLMRIMKEIGWTTEWGGGVAHSFTGTAEEMTELVNMGLHIGVNGCSLKTADNLEV
                     IKQIPLDRLLLETDAPWCTPTASHASAAYVPPKDSHLAVQKVSKADKWKEGLGVKGRM
                     EPAEIGIIAHVVASVKGIPIEELAEQIWQNTIKLFYPHEINRSR"
     gene            347851..354554
                     /locus_tag="CNE01270"
                     /db_xref="GeneID:3257736"
     mRNA            join(347851..348641,348687..349407,349466..349643,
                     349694..349750,349800..350267,350318..350405,
                     350455..350973,351024..351814,351868..351940,
                     351995..352072,352130..352228,352277..352334,
                     352382..352470,352521..352662,352724..352795,
                     352854..353366,353418..353896,353947..354554)
                     /locus_tag="CNE01270"
                     /product="ABC transporter ABCC.6, putative"
                     /transcript_id="XM_024657177.1"
                     /db_xref="GeneID:3257736"
     CDS             join(348381..348641,348687..349407,349466..349643,
                     349694..349750,349800..350267,350318..350405,
                     350455..350973,351024..351814,351868..351940,
                     351995..352072,352130..352228,352277..352334,
                     352382..352470,352521..352662,352724..352795,
                     352854..353366,353418..353896,353947..354156)
                     /locus_tag="CNE01270"
                     /codon_start=1
                     /product="ABC transporter ABCC.6, putative"
                     /protein_id="XP_024512819.1"
                     /db_xref="GeneID:3257736"
                     /translation="MGPHTLPAWPVMVDTTCVAVVLATVLISSLQIIVTWIKSKRGGH
                     IQLSESFEPKTKKELFETNLLFHVARETPEDGEPVEVAGFWKSTIFAKVSLLLVTLSN
                     LAIQAVDTIVTSPYRGQSWLPLLTLMTVALTNIYLVALSTHYLFTRNLARHASLTKHI
                     CTISSILLFHWYFQTLGQYLWRSINVDIPWTGYASLGLAFLQTVMSGLIPVGPKLWVD
                     ITAVYTKAVRAKVEDNAVFTFGGNLIEEISCSVFGKLMFTFVYPMIVKTAKMHQVDIQ
                     DLPAVQAEMRTQNMYHEFMGPKATEDIRWKRHPTLSLLWTVWRPQRRAVVKALIFMFA
                     LCPLWYLPHICLQQILGILDDHTAVRLSAVAFAALMILAKVGNTIISMQQYNITMSYV
                     GPRINAHTSFLLYQKLLTRKLFAIPENKEGDKAVHTKADILNLISSDASSVQRVGWTF
                     TNLFRSALEMALGCSYVWILLGPSGLWGLSTLILTCPPAYLLTKWEYSVFEKRLAIRD
                     ERVSLMQEAVQAISMIKMMATERFWYRRINSVREREFKKLIQAQVLGYISGLLYSAAP
                     TVIVIVAFAHYTLVAKKELTATIAFTSIAVFNELRPALLDLPSSVAELLQEILGARRI
                     ANFLTTGDVEYFNDTSFNSSDITTPEEGPLYIVGTVAWDVPKIYVAPASNHSTDTSSD
                     SSENNKVGFRLMDLDIKFPRGKLTLVAGKFGSGKSLLLLALLGEARLIEGKISYTVSP
                     IMDPQIIDKNDWSLLKNGVAYAPQTPWLLSQSIRDNILFGLPLDMERYRSVCFATGLL
                     PDLELLEDADLTEIGERGKLLSGGQKARVSLARAIYSRASVLLLDDVISAVDAQTSQH
                     IITHCFNSSLMSDRTVILASHAVETLAPLATHAVYLDDGRCLWQGWGRQLLETEHMAH
                     LKTESRSPSRLPSRLPSSENLKSEAKSDRKDKKKGEKPVSLDVQAMKEKFEIGEAIPK
                     TPKQLVIEEERAVGAVDLIHWKNLLKFNGNGVYWTVAFTLMMAAVLAPVCERMALSLW
                     TSTEGERSVDHSVVFWISLYAAISLTRVFLDTVYGLFCFWGSMRAMKIIHGQMLESML
                     HAKMLFFTKTRAGSIIQRFGKDLNDILDCSNLLTEMTGGGMNIIISLISVSVYGGWIF
                     CVVTILLLAAAWTPGKWYRASSRQVRRLQAVLPGPINAIYGETVAGTTVIRAFGAQSV
                     FIDDLLRWTNMKITATIWTVAIARWLLLSLQVMDVIVRITALTLLLARASTTGAVAGF
                     VLTFAGSISTYVNWMLIHLRNFELKGVSLERTSEYRTLSREDGTKLLADDTRYATDGL
                     ELDEEEDQRLGSWPEHGELKVEGLCARYGPDMPEILHDVTFRVKGGERIGIVGATGSG
                     KSTLAKAFFSFVDVTKGKIEIDGQDISTIPLGAVRSKLGIIAQDPVLLSGSLRLNLDI
                     EGKYSDEQLYTALRQVQLLKRSDFCPDLLSNDLTSLTIETSSHKQLQQQENIFSNLDF
                     EVKGGGENLSAGQKQLVVLARALLKRHRVLILDEATASIDSATDAEISRVVHEEFTNA
                     TVLIIAHRLRTIIPCANILVMDKGHLIQHGSPLELIHRKGRFQDLCMAAGEEEYSHLI
                     GLAEQHDPLNKDELIGSPFVQ"
     gene            complement(354200..357512)
                     /locus_tag="CNE01280"
                     /db_xref="GeneID:3257716"
     mRNA            complement(join(354200..354715,354771..355349,
                     355402..355959,356016..356263,356313..356437,
                     356488..356596,356653..357512))
                     /locus_tag="CNE01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_570714.2"
                     /db_xref="GeneID:3257716"
     CDS             complement(join(354638..354715,354771..355349,
                     355402..355959,356016..356263,356313..356437,
                     356488..356596,356653..357418))
                     /locus_tag="CNE01280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570714.1"
                     /db_xref="GeneID:3257716"
                     /translation="MFVKRARPRPSLRARDSDIPDPASTSSPLAKSSITASDAQNSDE
                     SIEIDSNEGSGNILGRKKGLKKEKTKDRLSKKASTLSFGGAADEDEGVAFKPRKSLLS
                     QQLKLPPTPSTSEAIGTPSATKNSGVYSREYLSELKAATPTRAPRGVTDTIEDDNDDV
                     DSSGLSRLAREKYASSFAQDTTAGIPDATTIAAAKMKRQAGMGGNGAATASAENEEDY
                     ISLGSGGGKIAIYDAQQGPHPESRLMREEDEEGEGDEDLADYTGAKDKLFLGKTANKA
                     AARRLRGEIGELIADREAEDEDDEETLEWERAQAQRSGLWEEKEPEKVVKKGYTPAPI
                     PLSRPLPTVLSAQSRLTKALSDLEITKSHNDHNLDVVVQELADLEKQERELRIEVEKV
                     EGKREYMEEFRRWVEMLGNFLEEKFPRLEEIEADALHIIQERSQSTNKRRADDDSDDL
                     ALCIGVAAPKEGEQEIDELGRVKDATREMGASSGVRRARREQRESRRSKRIARKANSP
                     TAEDEGYSTDSTLADADAEDYAAAQNRLAHRTHALLDDVKAEDFRDPEMGLAKRFGGW
                     RKRDEEEYVNAFGGLALVQAWEFWARGEMVGWEPLRGSAFLDSFRWFHSLHHYCHPRR
                     PRADEDEDMDEEPPLSPEGDLVASMVSTAVIPLLTKIFEAGAYDPYSAPQTRRAVDLT
                     DVVADLTGKDSRKFVTLLKAILEVFHSHLLELSSAIAAVTASNAIPPPAFNPASRSAL
                     SRFIHRRIKLLKNILMWKRQAPQEVRGLVVRLVGEILRPVLSGTWDSGGKELAQEILP
                     AATGSLSPDLVGFLQQGPSSRW"
     gene            357639..357721
                     /locus_tag="CNE01290"
                     /db_xref="GeneID:3257657"
     tRNA            357639..357721
                     /locus_tag="CNE01290"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3257657"
     gene            complement(357788..359220)
                     /locus_tag="CNE01300"
                     /db_xref="GeneID:3257823"
     mRNA            complement(join(357788..357975,358022..358205,
                     358272..358349,358410..358489,358555..358597,
                     358675..358739,358804..358976,359036..359220))
                     /locus_tag="CNE01300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657178.1"
                     /db_xref="GeneID:3257823"
     CDS             complement(join(357884..357975,358022..358205,
                     358272..358349,358410..358489,358555..358597,
                     358675..358739,358804..358858))
                     /locus_tag="CNE01300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512954.1"
                     /db_xref="GeneID:3257823"
                     /translation="MSAAPRTLLLVCDLQERKRQDIWEFDAMSSMISKMVRAAKILEI
                     ATLTTEQNSKALGTIEEVGQHLQQLEHNNLGIYKKNRLSMQTKGTRRGVDFQKYDTFI
                     VTGIEAHVCILQTALDLLRLESKPTVFIPADCISSGNKQEIPIALRRMERDGAVITTS
                     ESVLFELLGDADHPKFEALVDLIKGEAENTRNALAALL"
     gene            complement(359441..362816)
                     /locus_tag="CNE01310"
                     /db_xref="GeneID:3257860"
     mRNA            complement(join(359441..359845,359903..360620,
                     360668..360746,360796..361949,361998..362816))
                     /locus_tag="CNE01310"
                     /product="spliceosome complex protein, putative"
                     /transcript_id="XM_570716.1"
                     /db_xref="GeneID:3257860"
     CDS             complement(join(359490..359845,359903..360620,
                     360668..360746,360796..361949,361998..362786))
                     /locus_tag="CNE01310"
                     /codon_start=1
                     /product="spliceosome complex protein, putative"
                     /protein_id="XP_570716.1"
                     /db_xref="GeneID:3257860"
                     /translation="MASTSLVDSLTSHFPLTLPIPTPITHPHLIPSADLPVEEDLLHN
                     PENLRSWLSYIHNVKEKIAADEPAKGGVLSPEEEILGPLASKNARDGLQRLVSIYERA
                     IAVFPTSYKLWKAYYLTRQSYVLGELTNDAKEARSQQAKRGAAYKTNVRELLDGAEEA
                     HEWTGGLDPVVGYAEWRSLVATGERMIMCLPNLPIPWLLHLGVLLHPKCPSVFKNGSY
                     ARRAFDRALRTLPPSLHGRVWGLYLRWAEIVGGDAGERVWRRYLKVDPSLTERHITYL
                     LEAEEPRPLAAAKYLLSIARRAQQNLYSSLEGKSPYQLFVDFLELVEKYADQIGMDEE
                     GTLELQRTKRAVEEKVDGEQPQVEGQEQQPQEEPASINGRLMRIAGPPVPLEQGKLFK
                     PVNAASAQAPTQLTYDEDTDPSNPRLLDVEGIVERDGLQVYKDQAGRLWTGLATYWIK
                     RGEFERATATFERGLAAVVTIRDFTQIFDAYAEFSETMISTLMDALADEDNLEDEDFD
                     AEETEQELDERMKSFEELMDRRPFLVNDVLLRRNPNEVVEWEKRIALHGDDDAKVVEA
                     YVKALDTINPRKATGPLYPLYVNFAKFYEEGGSKDDNGEPRNEPDLEQARKIFERATK
                     VPFKAVDELAEVWCEWAEMELRNENYEEAIRLMQRATTVPKNTKINYYDDNIPPQSRL
                     FKSLKLWSYYSDLEESIGTVESTKAVYDKIMELKIANAQVIVNYATFLEENKYFEESF
                     KVYERGIELFHFPIAFEIWNIYLSKFVKRYGGKKLERARDLFEQALENCPEKFCKPLY
                     LMYAKLEEEHGLAKRAMGIYDRAASTVQDSDKFEMYTIYIAKATANFGLPATRPIYER
                     ALESLPDKQTAEMCRRFARMERKLGEIDRARAIYAHASQFCDPRIEPEFWQEWNDFEI
                     ETGSEDTFREMLRIKRAVQASFNTETSFIAAQAAAASKGTEKPTDTSAQEAQDAADPM
                     AAMERELSAAGADGARKGGAPAFVASTLNKTNANGIDEGGEETGEMANPDAIVMDEDE
                     F"
     gene            362958..363884
                     /locus_tag="CNE01320"
                     /db_xref="GeneID:3257668"
     mRNA            362958..363884
                     /locus_tag="CNE01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_570718.2"
                     /db_xref="GeneID:3257668"
     CDS             362973..363845
                     /locus_tag="CNE01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570718.2"
                     /db_xref="GeneID:3257668"
                     /translation="MAPRRMPIARASLQAAIEHISSTPGSFSLVDADDGWPFPRDSRS
                     GIHLAILDSSFNPPTFAHQAIISSSYPVQANPYTARLLLYTPKNAAKTPTASDATPLQ
                     RLEMMSLLSSSLRSLQASQTQQESIATALIHAPTFVAKASILRSYLVNELNLGQRGEE
                     AELSFLVGMDTLLRIFDPKYYPKGEMRTKLEGFFLPPPRGAGANLVSARRGTTLADRE
                     FEENLLKRDDVKPWVENGKVRVLGDGRDGWENVSSTLVRECVRKSDWESVNKLLGEGM
                     SMYIQKEGLYFASN"
     gene            complement(363831..366715)
                     /locus_tag="CNE01330"
                     /db_xref="GeneID:3257632"
     mRNA            complement(join(363831..366576,366624..366715))
                     /locus_tag="CNE01330"
                     /product="expressed protein"
                     /transcript_id="XM_570720.2"
                     /db_xref="GeneID:3257632"
     CDS             complement(363912..366575)
                     /locus_tag="CNE01330"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570720.1"
                     /db_xref="GeneID:3257632"
                     /translation="MLRRIRIRLSLAHSPRRTSSSAAFAHTLEEQHTIPYGVAYGAGP
                     SRIPYQPPSYSFMGRAQGHEAARFLREKLSSLSHGSYAAPQAFAASLVRSIEGAAEKT
                     QIRTNELVPSLSRLELHTIVHHLIREKKGNLASAIVLQALQSAPRMARRRIVSPKTLR
                     ILFGNRSIFHMSKASSKRRAIAPNLQPTVAEQRSPPPASRLQTLLDILDILQDVRYSR
                     TPELYELIISSCCDEGQPHLAAKIYTGLVEEWVTEGRVAEGANPEEFHPGGGPPRGWK
                     KGDGGRWWTGVRTWRWPGEVLSPHDRLDLWHPQQLALPEKMRNFPVPLATSPPSVVPA
                     PHSSLLNNIVNSLQLDPSKTSPHEFASSMRALAILANTVLSRTLPILALGPLLKACHT
                     APFKPDVYPESMQDKPEKDEWAYTAFTQMHVMLMSLLWSPPISAESMRLIAAAQTAEK
                     ARTPGLPMPESKETAVAVTPIPTLPLDSPYKLPPLTLSSCSILLSYAFRILKAPNLLN
                     ALMLYMKSVFKLGKSSPSNWNIILGGASRLRENKLADDAGKMLFGSLGNVDRVDKREF
                     FSKSKGETVGNKVQFDLALSNEDGEEQGASPEANESSLLALISHLTASSQFSRLTSLV
                     YTLIPYLAHSRGPATVPSSDDRGSQGIEIGENGRPRSVRLTPHVWVALLRGMEKAGKT
                     GLGQRLYNVGLYEEGVAWKEMVEEHPELSVLPSTLRLPQEFFTTVLLLFSQHSFFPSS
                     GKASVIKGLRLPRGSERLAPDLAVGLLGIKVHETVKGRWEDGWVDESEMEGIKGQKYF
                     EALIKCSWKRWGLDMPEKALREGVGKEIVGVIKDMEAWGVQVPEVLVARFKGKRVDVR
                     DGFWGIEEMKWCGKTESKEEAAKLLKKIMGE"
     gene            366891..369357
                     /locus_tag="CNE01340"
                     /db_xref="GeneID:3257721"
     mRNA            join(366891..367081,367131..368076,368126..369357)
                     /locus_tag="CNE01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_570724.2"
                     /db_xref="GeneID:3257721"
     CDS             join(367065..367081,367131..368076,368126..368602)
                     /locus_tag="CNE01340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570724.1"
                     /db_xref="GeneID:3257721"
                     /translation="MSTLSDMPLRPTLPAPRQSHRSHVALSQPKAAAPPPSSRPVTPS
                     RPRGDIPRKSSQPPSSSRPYSPAGDMSDKPPMTPSPRPQRRRRGGNKPSAQRAQASAP
                     AVMAVDGEAVDRESGNSGEDYAQEDEDALFDLLGVVSPPKSVEPPAQLENRPGLIVLP
                     KGEGPNAVKRPRKTRKSKKTVGQDSELLVKGNDGLARPSAQQDGLPVDPARKSKSKKL
                     TKPHLAARASAPPAPVQTTANPPTLDQLLASTIPTAPSPKPHAKGVQRDRDDGTFEMS
                     SLSQNLPSDMEDSGNGQQKKGKSKKKEDAGAVWDMPDAIGGGELTWQQKLTQTETPTR
                     TTRKSFQSERKGKSKLSTLYDPNRAADNNGFLSHAKHLSYDSIPTQLAQPISTAQQRL
                     PISAFDGHIPFHTGFNVHRPPQTPAKSVASVHGNLLMGEGALPVIPGDFPRINGAGGV
                     PVGGPKYAGPTFHNSPHAATLSKPDLEDF"
     gene            complement(369382..370120)
                     /locus_tag="CNE01350"
                     /db_xref="GeneID:3257895"
     mRNA            complement(join(369382..369631,369691..369984,
                     370035..370120))
                     /locus_tag="CNE01350"
                     /product="expressed protein"
                     /transcript_id="XM_570726.2"
                     /db_xref="GeneID:3257895"
     CDS             complement(join(369448..369631,369691..369984,
                     370035..370075))
                     /locus_tag="CNE01350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570726.1"
                     /db_xref="GeneID:3257895"
                     /translation="MSLTNVLPEGTKLTVSTTLPGSSKKHLLSPSSSSGENPPWSSTA
                     PSSLQLSFPAPVAATHVAFTFQGGFVGTSVSVWVAEEKDAEKEGVIRLGLELGGKVYP
                     EDRNKRQIFEIPFPPSGALPSELEAEGVAGDNSSGLPLLKELKFEFDKSSDQYGRITL
                     YSVEILGSSPSA"
     gene            370255..371412
                     /locus_tag="CNE01360"
                     /db_xref="GeneID:3257516"
     mRNA            join(370255..370527,370602..370756,370810..370908,
                     370970..371412)
                     /locus_tag="CNE01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_570728.2"
                     /db_xref="GeneID:3257516"
     CDS             join(370287..370527,370602..370756,370810..370908,
                     370970..371374)
                     /locus_tag="CNE01360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570728.1"
                     /db_xref="GeneID:3257516"
                     /translation="MSRPALLRPFASIPRQSFAVRAPAAAGIRFINSKVGSTRGAGAV
                     DYRVLEGMDGFLPKENFDRLKEWQLGLWERLQAEVQNNPGLVEVKQKWDRSGLDITDL
                     LSTTAKDRSLGLAYNYGALLANNSFFLESLNAGEPIEPSKVFTPVLEKLEGYAEGIIG
                     GGWLWIARTGDHEAQIDIIPTFGSGTLLVSGRAQRSGAVFEEPLASSPEPPVVTSDMT
                     GPSPVSAIPETTAPPSVASQGSNLKRGSSIYPAPLAVLNLFELAWLGDKYGVWAKRQY
                     VRDWIKSVDWKKVEERNSQVTAK"
     gene            371563..373766
                     /locus_tag="CNE01370"
                     /db_xref="GeneID:3257850"
     mRNA            join(371563..371693,371752..371832,371883..372110,
                     372165..372862,372910..373392,373452..373766)
                     /locus_tag="CNE01370"
                     /product="expressed protein"
                     /transcript_id="XM_024657179.1"
                     /db_xref="GeneID:3257850"
     CDS             join(372074..372110,372165..372862,372910..373392,
                     373452..373541)
                     /locus_tag="CNE01370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512822.1"
                     /db_xref="GeneID:3257850"
                     /translation="MGFRRFLASLLCVSKAQADTDSILPITKDFITSSSSISSASTAS
                     TRTSNRSQEILDKASGRTMVLQEFISSEETYVNLLEEFDDIYIQSACAPLIFHTGGKL
                     SRQVTFYTALTLEERRTMFNGLQEILSLHRTLVLPKLFAATQVLLTQGDDHDGLRSTH
                     TAFEVCQVICKFADWFKMYSAYSVTCDNATARLTQWTNGINMVRQDKNRVQAYLTKCK
                     VNKNHSQINMTGYLLLPVQRLTRYKMLLEQLEKYTPAPPSGARDYIGEALSRISTILV
                     YVNDYKRDLDARSRLCHWADQISSVGPSPLVQPHRTLIREGPIKFIARGALPQNTSKT
                     LKHRHVDESKRSIGTVNKMCMAILCQDLLVLVDNVANKQKGKLELVDVVRLSAMGNAR
                     VEWGNVVVFEAYNNTEQVSYYLRADDQEIAQGWVDAINQSKRS"
     gene            373864..376657
                     /locus_tag="CNE01380"
                     /db_xref="GeneID:3257870"
     mRNA            join(373864..374108,374157..374284,374336..374726,
                     374782..376287,376340..376657)
                     /locus_tag="CNE01380"
                     /product="expressed protein"
                     /transcript_id="XM_024657180.1"
                     /db_xref="GeneID:3257870"
     CDS             join(373940..374108,374157..374284,374336..374726,
                     374782..376287,376340..376584)
                     /locus_tag="CNE01380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512823.1"
                     /db_xref="GeneID:3257870"
                     /translation="MFSQIPSALYESLFHAAAIDLVIPEVSTFNPNPSDDDLPTWWAA
                     LEQASARNTAFFDENLDYFVAMTLPDESLAGLPGTTVVDAKEPPSEMLRFLGRLDLTM
                     SASFVPKLPAMEVRRPPVTSISNGNLSAPQTSATLAPPMLSHSQAGAARANPSPTNPP
                     ITPNPFPAMSSEEEQYANVDGVVVWEGKVEESKAGNQRESKNENWHSWGRRISRRNGA
                     WEVIWKGEIPVVFVRTNVENPVLSLTASVTLRDQNSHSKAHRKGFSLDAISIRSGTET
                     IRTDGTEFEDYESDDDESWAGMEEIDLLGGLAGKENMMPASRLPAPIRNDLFIPDGPL
                     PSSLPLSAMTPNSAPPIVTPSTASTGAHHERGPLPTTTVATLSTTLRKSFRRILAIAP
                     GIRVKMNTVTLPQLLPLTPSSNGDDEDHQGETRVAIVIHLENSIEPSILHGFEISRID
                     ITIGGKSSGITTKLLYQTEGSSGHDIFPIRLGSTEQYNLFYVVDFVGERTNDPLQESI
                     ARNLGASEQVRPVSIHVIGRPYRLKSLDSDEYDYPTKTFDSSWNTSIDLTNFYASRPP
                     SARLSLQNPPLAGNAHRPTSLNLSNPVLGDKRYNMASLVSAEQGRERDSVQTRNRPMM
                     PSQMVQNRRVVSGVRVPSMNGPPRDYGLLMSVKILPQSSSSTPSDTIKPLVPFSIEVF
                     VHNRTDQVRRFRLIVPGREDGIRWEARVREVLERGMKKGGDLMGVGDEAFLRTSLASY
                     ISASTPLIPLEDNIRCGPLLPGASLSARIRFLPLREGIHQIERLRVVGVGDEVDFMMS
                     PVMDVVVGNGIDGI"
     gene            complement(376643..378896)
                     /locus_tag="CNE01390"
                     /db_xref="GeneID:3257919"
     mRNA            complement(join(376643..376832,376887..377372,
                     377423..377504,377553..377875,377929..378255,
                     378302..378687,378735..378896))
                     /locus_tag="CNE01390"
                     /product="asparagine-tRNA ligase, putative"
                     /transcript_id="XM_570734.2"
                     /db_xref="GeneID:3257919"
     CDS             complement(join(376740..376832,376887..377372,
                     377423..377504,377553..377875,377929..378255,
                     378302..378687,378735..378840))
                     /locus_tag="CNE01390"
                     /codon_start=1
                     /product="asparagine-tRNA ligase, putative"
                     /protein_id="XP_570734.1"
                     /db_xref="GeneID:3257919"
                     /translation="MSEQKSSVVEQAQDVASKLANAVTDTLKLSEDQKSDLPVVYIDE
                     KAGSDTEGTGAELSPFASPLAAYQSFKPSPESDANPSSVATFMVRKVDSVERNDWIEL
                     SASAKKKLVKSIGGWRKAEAKLAAEGERLEKQKKEQAEKDRLRREEAKNVVLVDDPSK
                     ESKSAKIWAVPELVGKRVRLQGWVHRFRPQKTNFFVVLRDGSGFLQCILTGDCIRTVD
                     ALDLSLECTIEVVGIVEKVKEGQTAPGGVELAVDYWKIIGRAPTGAEALESRLQPDTE
                     ASIRADLRHLELRGEIASSVMRFRALLLRAFRESFNKRRITEVTPPCMVQTSVEGGST
                     LFEFDYYGSKAYLTQSSQLYLETVLPSLGDVYCIQESFRAEKSLTRRHLSEYTHLEAE
                     LVFIKFKDLLDHLEDMICEVIDVLLADPVASEIIKTLNPEFVPPQRPFVRLDYRDAIT
                     YLNEHGIKREDGEDHVVGDDIAEAAERKMTDQINKPIMLIHFPKSLKSFYMKSLDDAP
                     DFTESVDVLVPGVGEVVGGSMRISDLEELMAGYKREGIPADPYYWFTDQRKYGTTEHG
                     GYGLGVERLLAWILKRYTVRECSLYPRFMGRATP"
     gene            379128..382617
                     /locus_tag="CNE01400"
                     /db_xref="GeneID:3257798"
     mRNA            join(379128..379618,379677..379858,379912..380116,
                     380182..380300,380350..380618,380669..380779,
                     380831..380909,380968..381000,381059..381264,
                     381319..382201,382257..382617)
                     /locus_tag="CNE01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_570736.2"
                     /db_xref="GeneID:3257798"
     CDS             join(379279..379618,379677..379858,379912..380116,
                     380182..380300,380350..380618,380669..380779,
                     380831..380909,380968..381000,381059..381264,
                     381319..382201,382257..382505)
                     /locus_tag="CNE01400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570736.2"
                     /db_xref="GeneID:3257798"
                     /translation="MNRLIITDTVPTCSFSPSEYILPQPTMTGFGTPSVAVAATPTVI
                     STFFSHILAHRRRKNASKKSLEAGGPGGGPEDQLTYEEGLQVVRRFLDFASHHGVEEV
                     QAFTAMWVPTPRWVKRDVMAIPDENIKEAEDILAKHLSTYGPQGAEGGGLQLVGGDKW
                     WRVRRRTLEGEWIEMQQDYLKRTAKKAAAEPSPAATLTSPTSLTASSRSDMRYMPHKR
                     ATTGSVIDNAGGEVLDDRVIMYIHGGAFFFSSLETHRYQVQRHVRKAGARAFCPAYRL
                     SPQYPFPCGLLDCLAAYLYLISPPPSAPHQPILPTNIILSGDSAGAGMVISLLVLIRE
                     MGLPMPAGASLISPWVDLTHSMPSIGGWDGGDFIPSYGFHYRPSCAWPPLPGDGIDVT
                     MPDGSTNRYDEQIQMYCPNNLLTHPLVSPVNQGSLGGLCPLLIVGGGGELLRDEITYT
                     AYKAADPVKYPPSSITLSQYPDQASKVAKYKPTKVHLQLYEGGCHVVPTLSWTKSAKY
                     MYRACANFNIWAFTAARKALEKKLQHKESSSSLRKQRSVPSLKQYKATQLPNGLTALS
                     MSDSLTNGMALSSLSLTAPGVINASWAPSSVSTSSPTSRQSTIDFTQPVITSGAAVAA
                     NTKPISFGEVQSEAESDEDDMSVTSESTAAEEERGDPVPTKGIVTVHGTEPLYGNVNL
                     VSERVSVHGNIRPFEPIEAVPALQPSLREHIGQVHGDGAIRKWLARRHEWDRKYSKDL
                     AKWRDIKQKDRARAEAEGFLTRNLQGERPPLCSVAGIWDKGLARDVAKSVDEVTSRSM
                     GMGWWTKWGSKADEEHADRRKTREKAAREEEQNKLHSAKDQGIPDAIPPGPMATSDPP
                     TDGAAGTEQLFDEPEAILFEDAEGERNDVETARGV"
     gene            382735..385622
                     /locus_tag="CNE01405"
                     /db_xref="GeneID:36392856"
     mRNA            join(382735..382887,382943..383085,383137..385622)
                     /locus_tag="CNE01405"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658515.1"
                     /db_xref="GeneID:36392856"
     CDS             join(382778..382887,382943..383027)
                     /locus_tag="CNE01405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514366.1"
                     /db_xref="GeneID:36392856"
                     /translation="MSAPQYLGPASAQSAPSLTTVLKDQITNPAYREGNLNILKAVSI
                     FVVGIAFARSGLSSALVPVF"
     gene            complement(383179..385472)
                     /locus_tag="CNE01410"
                     /db_xref="GeneID:3257977"
     mRNA            complement(join(383179..383476,383527..383670,
                     383724..383827,383884..383998,384058..384282,
                     384339..384478,384528..385312,385379..385472))
                     /locus_tag="CNE01410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570739.2"
                     /db_xref="GeneID:3257977"
     CDS             complement(join(383317..383476,383527..383670,
                     383724..383827,383884..383998,384058..384282,
                     384339..384478,384528..385312,385379..385412))
                     /locus_tag="CNE01410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570739.1"
                     /db_xref="GeneID:3257977"
                     /translation="MHDDGAGRCGTRTEHCLLRPGRSITTTNEIDPVLVITRYPQLGI
                     FSFHPEIFPVTSKYLSPAQLPQRTLLYILPLFSWTTLLALPSHLTSTSTTQTAMYGQQ
                     NNYGTPPPQQWGQAPPQGYQPGYQNGPPAATYGAHPSQQQQWGAPPGPPQHQPYGAPP
                     ANQYGAPPQHQQGYGGHSPQPPFGAPSPAPAGYGVPPIAPPQGQYGASSPYPQQPPQQ
                     GFGGPQQGYGSQPQGQGPMMYLGVPIPAPPPAVPVSTLAGYDARFDAERIRKATKGFG
                     TDERTIIDTLSPLDAFQMDVLSRTYEQTVGRSLKTTLEKELSSWLEYTLVLLSLGPLG
                     GDVYLLHRACKGMGTHEDLLNEVLLGRTNQEIFLLKEAYRRTYNKDLVQIVQGELSMK
                     TERMFNMALSGQRDESPYLNHQLVQQDVETLYRAGPGKIGTDEIAICGILISRSKEHL
                     KAIAQAFPARHRVSLSQMIKSEFSGHMCDALFFIARGVEADGDGVVRDCELLHAAMAG
                     MGTKDERMIYRLVRNHWNRARFNAIKNQYQVLYRNSLRRAVEGETTGKYEKALVGIIE
                     QN"
     gene            385624..386273
                     /locus_tag="CNE01420"
                     /db_xref="GeneID:3257822"
     mRNA            join(385624..385912,385978..386273)
                     /locus_tag="CNE01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658516.1"
                     /db_xref="GeneID:3257822"
     CDS             join(385669..385912,385978..386138)
                     /locus_tag="CNE01420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514367.1"
                     /db_xref="GeneID:3257822"
                     /translation="MPSPPTPQPSHLSNSRPDRRAANPPPRRPTPRAAPTSSAPANEP
                     VASATGSGWAATRTVLARGRTPIPEHVKSRSLWQSYLSLSGNARIAFGLALGAVGIAG
                     ILWDRQVAEDEPKGELEQKPLINVRMVDRPGK"
     gene            complement(386229..388512)
                     /locus_tag="CNE01430"
                     /db_xref="GeneID:3257558"
     mRNA            complement(join(386229..386797,386847..387355,
                     387405..388158,388217..388512))
                     /locus_tag="CNE01430"
                     /product="expressed protein"
                     /transcript_id="XM_570742.2"
                     /db_xref="GeneID:3257558"
     CDS             complement(join(386353..386797,386847..387355,
                     387405..388158,388217..388335))
                     /locus_tag="CNE01430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570742.1"
                     /db_xref="GeneID:3257558"
                     /translation="MSNSVQVTPRKRKAGTSINDAAKAAAAPTPRTARTSKRSVPANS
                     APVPFPTPPATRHRTFDLETRPALTSAPVETPKAGVPNLPPHLETLLGIQKAFNLALS
                     LYIATHHPVLPPHSPTATSVKLPNLTNYLAIKETVERTCGRRFGTQELGRLAWIWSWD
                     GKSLSDEKSISEKSKETGKKAMLDEDNPFFVPSSPALGSGEVSGMSYLITSTRTLDPS
                     NGRRVYTHGVGIELELRKGETRQLLSNSDGGLGNRGQGGGTGAIGRWNANGETREDEF
                     REKLEKWVELHGGYEPPEATVLPTPTTSETSTRSTIPPIPILPLPQLPSNSALPSTNL
                     MAQFTSPSSASMTMTPKKNHLPPAFSSPKTAGLSDPFEIAEPENNGQIKGKIVRNGSV
                     EERRKAMMERLKARSGANKAVLATLGSATGGFKRPGVNLSALSAGGQQEELKRRSTLS
                     RLESVAEAVWMMFSAPSPGPSTLPTAPRGRRKAIPMFEVAEVIVKSSKTPISTAEAQT
                     SLQMLTELCPFFLTNKTIGRQEWLEMPMTALSAAPTSPTTSTLTSSPSSGATMVARQT
                     SSSPSTPSRLKAELVGPASPGRVRRQGGLREVRERIRRELGE"
     gene            388687..389295
                     /locus_tag="CNE01440"
                     /db_xref="GeneID:3257652"
     mRNA            join(388687..388969,389019..389124,389178..389295)
                     /locus_tag="CNE01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_570746.2"
                     /db_xref="GeneID:3257652"
     CDS             join(388725..388969,389019..389124,389178..389210)
                     /locus_tag="CNE01440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570746.1"
                     /db_xref="GeneID:3257652"
                     /translation="MSAEPSSSAQASAPTVVSVAPSKNGRTPGKAHKSAKTALRRSYI
                     SPSVKTPFEKRMEKEKAQQAAKQLEKELKEEKENERQRKVNIIKERRARKEEKQREEE
                     LRAKMSAKKLQRMKKREGRSKKING"
     gene            393389..399202
                     /locus_tag="CNE01450"
                     /db_xref="GeneID:3257713"
     mRNA            join(393389..394147,394231..394312,394815..394935,
                     395847..397125,397176..398361,398413..399202)
                     /locus_tag="CNE01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657181.1"
                     /db_xref="GeneID:3257713"
     CDS             join(395864..397125,397176..398361,398413..398811)
                     /locus_tag="CNE01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512827.1"
                     /db_xref="GeneID:3257713"
                     /translation="MVYTEPAPISTPPLISPAKEPQAWRKAHNSTNVDDLDANMASAP
                     IHTIPRRSSSSSSSPQRTIPHIPRHHSAGRHSFVISKPLEGLPRRSGNSPRPSISGLP
                     PAGEGSALGIKLHGSPNKSPLSPGPKDLGSPSTDGNDASSFKGQVSHGDSSSHVISFD
                     PNFQPPKRDSPTRNPLSTSPRPGAPQRNSGPGHVRGGQGATGSLQIPFPSSASTSELP
                     SGPSSLSTVRPSAAMIRKKSGEIVKPSLKPRSLSTPDLMRQGQESPTDTSPNSFGTER
                     SKSVRFADTSQGDAKALESVVLFLREQKVTAVGKAADPDNAQLTETETENDTDASDFV
                     QFRTRKNAAARAADEANQIQLSGASRVPRKRTDFSPDARGSLAGENVILERVELQSST
                     GLTLRGSVIVRNVAFRKWVAVRFTLDQWQTVSEIAGTHVCHIPASTTGDEGWDRFSFS
                     IKLEDYKRKIDERQLVLCVHYSVENKDWWDSNDGMNYSFTFKKSAPRRASRNSGPTSL
                     GGSYFDDGDFTSSLPGLRKGNTLPPSSQIKKVFGSKDSKASAGSSHWTFPRLFPNFNK
                     HDAPPRSDSPVQSPPPNSAYEPPAPPTVHAHLSLSKYCAPSPPQSPSKEQPTQSLTFH
                     DPHHPPQRSSMDVVAGNYATITSDLQPPVCERRSSWNGEASSWDCSRATDNPDGKRPD
                     GDKTPVAVASRSPVISPNVRSPDLSPHKPLTLKRSTGNLRKLVEDAEDENGLMTPPSS
                     KGSSPPTPVHANLPPDLIYTSPASTGDTSSVNTLSTESTPDSASLSIDTEPHVEERGR
                     TGHPNDHKFFSANSYQEFLDKFCFFQSPRMTPNELEPMSRPSHIPISGSNSPNGFPFF
                     GHSNASHSPRSTPTPTRHYNSAQEAFGFSAPSEDVTPTKRESLMPHMAHPQPVQDSSV
                     SQIVSGYHANPADTMAWAQQIHSNSVSPSLAAAK"
     gene            complement(399114..400907)
                     /locus_tag="CNE01460"
                     /db_xref="GeneID:3257608"
     mRNA            complement(join(399114..399874,399932..400110,
                     400163..400318,400389..400452,400525..400692,
                     400779..400907))
                     /locus_tag="CNE01460"
                     /product="expressed protein"
                     /transcript_id="XM_571122.2"
                     /db_xref="GeneID:3257608"
     CDS             complement(join(399322..399874,399932..400110,
                     400163..400318,400389..400452,400525..400692,
                     400779..400810))
                     /locus_tag="CNE01460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571122.1"
                     /db_xref="GeneID:3257608"
                     /translation="MVFGLLCRWACNICSYLYPAYASYKALSIHPESSPEAMAQVERW
                     LMYWAVVGTWTAVEAIIGWTITWMPFYSLIKTFVFLSLSLPQFEASTYIYRSHLSPFF
                     QEHEQDIDAFLASSRSRAGFALVESVGWIWQKAKVQLNITLPDEQLQAAAMLAQNQGQ
                     GRPNEGGYPAQDVHQPPTLSDPASGALQTALHFVSNYAGRYMPVALTALSAAAASAKG
                     QAGESQGGASSSITPQSRATQMPQQMTMPVPVPTPPVHQQQSDPSLRSRAFMHASSNN
                     SAGQYPSLNNLKQQQQYQALSSARSPPQGFSGRSASGPAGPARMSQSSSRSSDESLGS
                     RYEGYEQIGKDELQEMNNSRSRMQGKKNWFGWGGPAGMNDDRDDRDKID"
     gene            complement(401116..402606)
                     /locus_tag="CNE01470"
                     /db_xref="GeneID:3257740"
     mRNA            complement(join(401116..401473,401535..401621,
                     401664..401871,401935..402190,402252..402361,
                     402424..402606))
                     /locus_tag="CNE01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_570751.2"
                     /db_xref="GeneID:3257740"
     CDS             complement(join(401235..401473,401535..401621,
                     401664..401871,401935..402190,402252..402361,
                     402424..402456))
                     /locus_tag="CNE01470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570751.1"
                     /db_xref="GeneID:3257740"
                     /translation="MPDKKEEIRSVTKIILDEMLDDLILTTTISAHREVKRGRVICGT
                     CGTRCRSHLPLLPNNVASCSKSLHTSADASGSSSRAQTPQCISEAGGRSSGYAVGPEK
                     GTGGSTGVGSGSGKIDSSGNAFFDCLVCSRPIASNRYAPHLAKCMGLNGSIRRVAARS
                     AAVKARLGTGHDRSSPSPYLATGSENGDWGSDADSVGSNKKKKTQNNSTRRNGSPNKS
                     VAKGKKAKRGSSAGTPTPQFPRQTLPPSKLGRPPTNRQTTQSSPVSSPEKSVISVASS
                     GTGVTGSKTLPGARNTLPEIVLGDESSEDADDDY"
     gene            complement(402841..407237)
                     /locus_tag="CNE01480"
                     /db_xref="GeneID:3258006"
     mRNA            complement(join(402841..403032,403082..403183,
                     403253..403321,403376..403584,403636..403725,
                     403775..403895,403950..404041,404102..404112,
                     404168..404415,404467..404535,404590..404605,
                     404658..404722,404770..404820,404878..404884,
                     404940..405021,405070..405113,405176,405229..405288,
                     405339..405396,405455..405547,405600..405694,
                     405748..405791,405845..405938,405991..406045,
                     406098..406297,406354..406414,406469..406507,
                     406562..406663,406712..406753,406803..406846,
                     406901..407237))
                     /locus_tag="CNE01480"
                     /product="phospholipase D, putative"
                     /transcript_id="XM_024657182.1"
                     /db_xref="GeneID:3258006"
     CDS             complement(join(402964..403032,403082..403183,
                     403253..403321,403376..403584,403636..403725,
                     403775..403895,403950..404041,404102..404112,
                     404168..404415,404467..404535,404590..404605,
                     404658..404722,404770..404820,404878..404884,
                     404940..405021,405070..405113,405176,405229..405288,
                     405339..405396,405455..405547,405600..405694,
                     405748..405791,405845..405938,405991..406045,
                     406098..406297,406354..406414,406469..406507,
                     406562..406663,406712..406753,406803..406846,
                     406901..407186))
                     /locus_tag="CNE01480"
                     /codon_start=1
                     /product="phospholipase D, putative"
                     /protein_id="XP_024512829.1"
                     /db_xref="GeneID:3258006"
                     /translation="MSMPVSDPHGTVDPEKQVRHHRHFTKLRNKVDSLQSDISRLGIA
                     ISTTWNPNHRHDEEWEKEVDSKMEAIRDSHRFRSFSGERDGNIVKWHVDGHDYFWALS
                     EVIDSAKECIMILDWWLSPELQLRRPAALFPEWRLDRLLKKKAEQGVRVYVQVYKEVD
                     ISMSLSSKHTKHALEDLHENICVMRHPDHSGGELVYYFSHHEKLCVVDNTIACMGGLD
                     ACFGRWDTRNHPLADVHPTEFWRTLFPGQDYNNSRVMDFQTVDKYVSNALAVQDTARM
                     PWHDVSLSMIGPSVVDLVQHFCERWNFVKKFKYKHNHRMEWLSLPGPWDEVRSREGEK
                     KLIEDNEFRLNHPHLSEWKEAGRQFFHPYHFPPSEAPRATEPIPHGTSRVQVVRSAAD
                     WSHGILLENSIQQAYIGLIREANHCIYIENQFFISSCKDDQPVKNLIALALAQRIISA
                     AQEGRKFKVFILIPAVPAFPGDIQSQSGIKAIMEAQYRTINRGGASIFEMVREAGFEP
                     TDYISFWNLRSYDRINTPWSRIKAMEKKSGITFHQAQVALAKIYAGSEDISGGGADEV
                     VNIEQPHDQTTGVDEIGKKDTVQNAVRLPKTMDEAKDIIKRFQQAAQNDDKHVSDNVC
                     QHALQDTTTLFDEKWDGTEEEELSCFVSELCYIHSKIMIVDDRRVICGSANINDRSMN
                     GDHDSEIALVIEDSDMVESMMDGKKYMASAYATTLRRTLMREHIGLLPSQPAFDEKDQ
                     PTASMHPVPTPHMYDFGSEEDKAVEDVLSDEFTDLWIGTGRRNREAFENVFRPVPSDG
                     IRNWEDYKEYLKPHAGVSTGHVIDKSLTLQQVKEELGKIKGHLVDMPINFCIDLKWMT
                     EGDWLSVNPYTLALYV"
     gene            407443..411694
                     /locus_tag="CNE01490"
                     /db_xref="GeneID:3257565"
     mRNA            join(407443..407607,407656..407784,407833..408273,
                     408326..408780,408831..409262,409314..409676,
                     409739..410080,410168..410868,410932..411520,
                     411605..411694)
                     /locus_tag="CNE01490"
                     /product="cell division control protein 45, putative"
                     /transcript_id="XM_024657183.1"
                     /db_xref="GeneID:3257565"
     CDS             join(407464..407607,407656..407784,407833..408273,
                     408326..408780,408831..409262,409314..409676,
                     409739..409880)
                     /locus_tag="CNE01490"
                     /codon_start=1
                     /product="cell division control protein 45, putative"
                     /protein_id="XP_024512830.1"
                     /db_xref="GeneID:3257565"
                     /translation="MPVVQPPADDLRPSDLTYIHAYNSIVSRVRRTAGAASGGVVILA
                     GVDVDGLLGARILCSLFKNDDIPYRLIPVGGLTELEEKSDEALASEEIHTLILLSLGS
                     LLTLTDFFNLPKKIHLHVIDSHRPWNLGNLFDIDLDDEDDEDAHGKVWIWGDGDEFSE
                     NMDQLRKSFEALQFLPQKDSDEDSDSDEESEAEEEEPEEEDEDEEGDDDAKDEDGWSR
                     KRRREDSVAARRKRRRDDDRPRKLPKAIKEAHQERIAKYYNHGTYYGQSVALTIYLLA
                     TVLERADNDILWYSILGVTHQYITSHIDREKYEEYHAIFLDEVVRLNHEPDPVALRTP
                     NPDNRNISKSEELRFMLFRHWDLYNAMLHSGYVAGRLGIWKEKGRSKLRGLLAKMGYS
                     IQQCNQAWSHMDMELKRQLPEVLERVGPEYGLVELSYPSFTRAYGFQLSSLSAADAVE
                     VISSLLDIAVGVRLEVDREGGKGGGEWFGGTTRWSVGTREAEMGIAASEPGERAEGIE
                     GEESEEKKDQDWHVTNFWIAYDACDDISLLRRSLPLAMALHRAIIRAGSDLLDKSIIR
                     TLRNFRLTILSEGPDLRLFCHPSPLSRLALWLVDATRDRWVEKIARQNAHSGGKVKSL
                     PFVVACLNEEKGTFSVVGVTGAPEFGDVRKNKFGLAFQQAASFSNATASLDMFDTSVV
                     EVGREDLQSFIEHLHLHSV"
     gene            complement(409921..411707)
                     /locus_tag="CNE01500"
                     /db_xref="GeneID:3258012"
     mRNA            complement(join(409921..411477,411536..411707))
                     /locus_tag="CNE01500"
                     /product="expressed protein"
                     /transcript_id="XM_570759.1"
                     /db_xref="GeneID:3258012"
     CDS             complement(join(410163..411477,411536..411546))
                     /locus_tag="CNE01500"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570759.1"
                     /db_xref="GeneID:3258012"
                     /translation="MAVQYLKRTRTRNSLPYDLLHIIINLLISTDSLGTLAALQRCSQ
                     AYYDLITPLLYTHVHIHSDDQLQRFLTLPSESRTRRKSKGFSLLSSKAMKRARSGSLQ
                     TPEKKLQALTLVKSLTLDVYPSRTSLKLASKLPQVIPAKFLTFTPSAVLSLHAKLLRS
                     QAPRILATFWAGHLPSLIQPQQVTINYSSLDVRTLLQGDKKENWWDTFGGLSVALQHW
                     EKLEKIELRGEVWGLIVPSPGVEMEMVHTTFVPNEDVVDEAIMFEEGDESDGNNDIPQ
                     DGIHSSTPVQIPNPNIAVLPQAANNNDNADDTLTPRQKLLKDRKEALLLGLLANYQVV
                     QHTQHQALATHPNHLTSYVPQHFITNGRRSRMLWKLKGFFPPPDGDVDEDGIEWKSDD
                     EKREELENDRKEVASWLMNELDQQCPELARDYGRMIDGRRELDCLQWIS"
     gene            complement(412129..414636)
                     /locus_tag="CNE01510"
                     /db_xref="GeneID:3257512"
     mRNA            complement(join(412129..412399,412457..412589,
                     412649..413231,413285..413343,413396..413708,
                     413774..414015,414144..414455,414539..414636))
                     /locus_tag="CNE01510"
                     /product="nuclear segregation protein Bfr1, putative"
                     /transcript_id="XM_024657184.1"
                     /db_xref="GeneID:3257512"
     CDS             complement(join(412251..412399,412457..412589,
                     412649..413231,413285..413343,413396..413708,
                     413774..414015,414144..414326))
                     /locus_tag="CNE01510"
                     /codon_start=1
                     /product="nuclear segregation protein Bfr1, putative"
                     /protein_id="XP_024512831.1"
                     /db_xref="GeneID:3257512"
                     /translation="MPPPTSSLKPTAAKSATDAGSGAKATGDKKSSGQLAKPDQSKYN
                     AEQDEINKEIAAVKEKIEAVRSRIALSQAPTSNDRRSAIKAELDSLRSEQAKFKGDRN
                     KLFEEMKRLQEGVQKKIKDVQGQRNKSGFKSVADIDARIESLDKQVESGSMKLVDEKK
                     ALQEITTLRRSRKTLEASGSIDESIAADKAKIDELKKQLDDPEAKKVNDRFDELKKEM
                     DGLREEGNKAFEERGKLFDERNKLSAEMDELYDRKRKSAQKWREDNDKYYAKVQADRQ
                     ARQERFKVEKAREDAERREQEIARLREEARAPAFASETDDCGVLINWFKGKYGSGEVP
                     STHAGGKPDSATVVEGVKALEIRKVDDEAFKGMTLKKKDDELGGFFGGSGKSKKKGKK
                     GNSGTATPANQEGGNSTKEAVNLPMSLLSTLLSLGISPPSGKDDVQRTVDDLETKKAW
                     FEANSAAKTKAEIERVEKLVAKMQKKNGATTEPESENDTSDEAQVKSGVHEPYHTVAV
                     SGEATGPEEVQEDGDQLPQEDDEEGEAEVKKVDSALDEIREKEGL"
     gene            414879..415861
                     /locus_tag="CNE01520"
                     /db_xref="GeneID:3257635"
     mRNA            join(414879..414979,415044..415160,415427..415515,
                     415570..415597,415690..415705,415761..415861)
                     /locus_tag="CNE01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_570763.2"
                     /db_xref="GeneID:3257635"
     CDS             join(414970..414979,415044..415160,415427..415515,
                     415570..415597,415690..415705,415761..415809)
                     /locus_tag="CNE01520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570763.1"
                     /db_xref="GeneID:3257635"
                     /translation="MPIDFTSSLSTSDTLSTPLTGTSEEICGDKRPLRLGQNLRGTGT
                     SPIPELSPLCSNRRRRSLPKGSTLTHIDRLSSPMVPSGNETFLHECSPQRRRLKHWPR
                     "
     gene            416485..421878
                     /locus_tag="CNE01530"
                     /db_xref="GeneID:3257886"
     mRNA            join(416485..417541,417594..417762,417819..417996,
                     418056..418492,418550..418669,418722..418786,
                     418834..419054,419106..419307,419361..419516,
                     419572..419754,419809..420093,420149..420264,
                     420320..420430,420481..420579,420631..420736,
                     420783..421268,421323..421394,421443..421684,
                     421735..421878)
                     /locus_tag="CNE01530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657185.1"
                     /db_xref="GeneID:3257886"
     CDS             join(416517..417541,417594..417762,417819..417996,
                     418056..418492,418550..418669,418722..418786,
                     418834..419054,419106..419307,419361..419516,
                     419572..419754,419809..420093,420149..420264,
                     420320..420430,420481..420579,420631..420736,
                     420783..421268,421323..421394,421443..421684,
                     421735..421841)
                     /locus_tag="CNE01530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512833.1"
                     /db_xref="GeneID:3257886"
                     /translation="MPSPPPPLTIPILLHPTLPSQARHALPLRPTHIAHWTVNSNHGQ
                     SAYTALATQDNTIWVVADQPAPPLDDHDLLQEETSTHIPSIYTSSPISPRRARPAPAR
                     PHTPSQRPGATSTASTAGSSSQRRTSAFSPPLSAHQLPTATLSSATASAAPPDQHVHR
                     SSLSGRMELMGQLREHNGGRENTGIGAGLGIGRRGLTGLHGQAEQDSGTTSPKSSMSL
                     STETTSTVGMFSFWQKGSQSDAEEKGREIDEIMQEINVDREMENERRESEKESEDLKV
                     VEAAIERSPSSGQGYNLPGSHAKSHGCEWGNKKVWRIVLRRVDRGKIVSLTAFEELGI
                     LCVLRDEGLLEIFSLTTLQCVDYLELEGPNSRHLQKDPSNSNTAIVKLGQVWSWSGIH
                     MARNDTSHILVAHGLPWPCETPSPNGEVTRVIILLFNQDQQPLLDPIAKLELPGEGDV
                     GLCQDGDTNYLIHATPTSLTSYPIIYSQHKASPSSSLQLHPGHSSAAYPSRSHTPNLE
                     SSDASSSLLRKSVSSSRLLDPHQSHPHEKEHSFARFLARRTDWSKKKDEEHGDQPIIH
                     PALGEGKEVERDGYGHWTRIKLHENGEGVGWADDGIDEFQCDGKSLWIKGTISWTKRV
                     SAREVVFSKGWKKIVILRADGKLAVYAPQGNEVPKEGSRLKFEQKSIDDDVNAICLTE
                     SGKLLLSNVSAVQKGDIDSPVISFKKYLTLEEPPEEENGSFSHVVPYGVENVLVADRQ
                     GNVYLRKLDRVIHQDNIDPTTDDKPSVDRLDAAVTCMKIVRGPEENDKKYLVAGDEDG
                     VIRIWTVEEFQFCGSWTLFAWPVSDFVLLDMPQAGPLHGTLLCTSQAGTVGIISLSEM
                     EQLFLIPAARSPLRHIYLANTDILLAYANGKARVWNTETQEFRRSTGLDAAEDMLQAG
                     NWTRVDLTKRHTQTPLTACVAQPYAASQLGRLLNLDLRELGRWLHSSKNNPHHSPLPA
                     LRSLLSILFTFGVSDKVDETCIRNLGVHKPEKPIMVGYGSADTHEIVYAQGVDSWRIS
                     ERITGVRQLAIITVLRPFLDSPDLEQWAAEVIAFYTASLPPNIIEPDLEFFASYYMDP
                     SYDVHQAARLLFAARVGRLSGSEIDTVARTREHELPILQPEERKFCGSAANALTVLGG
                     IALQKYQCMGPAALKALAESVALYLHEPNCDYISLAVELCSKGFTIWQSYVDPSDLLR
                     RLFHLATNKEPPSMSSHSSTSIAAQARLAILLVASSNPPLFMSTLSMDILDAKSAESR
                     SSIMKLCVFMARKKPAVLENGLPRIAEAVVKSLDPNVGKMRDDVWQAATVILNELVLA
                     FSTIDFHSRTQRLAVGTHEGAVIMYDLKTASRLYVLEPHKAPASAVCFSPDGRRLVTV
                     SIEEGSVTVWKVGSSLSGFFNVGGPPRQGGEKGEPFKRIEFKRADDRPLDSTSALSDV
                     QITWLGARQARVTIKETALTFET"
     gene            complement(420830..424912)
                     /locus_tag="CNE01540"
                     /db_xref="GeneID:3258015"
     mRNA            complement(join(420830..423517,423570..423843,
                     423898..424199,424251..424431,424487..424577,
                     424626..424700,424753..424912))
                     /locus_tag="CNE01540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657186.1"
                     /db_xref="GeneID:3258015"
     CDS             complement(join(421915..423517,423570..423843,
                     423898..424199,424251..424431,424487..424577,
                     424626..424700,424753..424833))
                     /locus_tag="CNE01540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512834.1"
                     /db_xref="GeneID:3258015"
                     /translation="MTSRLKHKLELDQVNLNSAYLNESFVQIGTPLPALADTKKDKLE
                     YVPEWKQEVKDEQGRRRFHGAFTGGWSAGYFNTAGSKEGWAPSTFKSSRSSRASKVQR
                     AEDFMDEEDLQQMRDDRQLENTDIFRNEAFAGTREPLADKNLPSVLESLIAPAQSSIG
                     EKLLQKLGWRPGQGIGPRVTLRKLRIQEGKLGKARLGMDDGGHDDAEAGKHTFAPRDV
                     RLLVYESKEDKQGLGFEKGKGMSRLPPAMAPRPLDIEDDDPYAVGPSTSSRPFAFDHN
                     DDEDDVIVMGGSARPGLGMGSTDVQGGKKAVDAEDHWHDGRPVLVGFMLDPEGVPQDK
                     WFPMPEIPIDWRPRPARVWGTTRKWDEEPGKKVEENEVIRGAPGKPLTYEQRGAALGE
                     ETRMSKAKSVYEYITEKDRERLASVSDSAQIAPPLKLSFVPEPSESAEHTRTPATEVQ
                     IPPLSPRTASAALKGFIPYGDDPAKQERYRSYLISQTYNTKDPNPALLPSSSFDEINA
                     ELEAFASSARIFKPLSFAMSNRFTSGSSSLAASDLKQAKPGLHIYDAEKAKAEMEKPK
                     GVDEIKMDKQLTPKEQAAMNGMYGKMTRETRQFYPVKLLCKRFGVADPHPEGKLSDSE
                     AAPGPSAPSVEGLPIPANDASWESKFIYQAPTESSKPTSIPQSTQAVTDERAPTSIAE
                     VGMAEDINQGRDTLTYTKPSIDIFKAIFASDDESDEEDADDDEKQVEQPGKVAGPTQV
                     YRDPFPPKKIEDEKPVDLTTFKPVFTLKKEDNRAKDDKEKKKDKKSKKRKIMLSFDIG
                     EGEEEDEPKQQVKDKKKRKRDEQDNERHGDEQRNVKHKNEKEENDFEGEWVEKPAIIP
                     RLVGRKGAEDFM"
     gene            425157..426977
                     /locus_tag="CNE01550"
                     /db_xref="GeneID:3257811"
     mRNA            join(425157..425418,425472..425506,425566..425613,
                     425670..425726,425779..425861,425914..426143,
                     426196..426763,426861..426977)
                     /locus_tag="CNE01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657187.1"
                     /db_xref="GeneID:3257811"
     CDS             join(425295..425418,425472..425506,425566..425613,
                     425670..425726,425779..425861,425914..426143,
                     426196..426539)
                     /locus_tag="CNE01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512835.1"
                     /db_xref="GeneID:3257811"
                     /translation="MSYLLSVPAGRAFRRENSKWVDPQPEKGLIQMKLEDDLMQLSWK
                     SRETNRVEDELIIFPGEATFEKVSQDPTGRTHILKFSSSNQKYFFWFQRLSREGDLRA
                     QVDINELLQDPSYQPGSADLPAQQLERDWPPTPGAPRLTNPQPAPAANADANADANAD
                     AGSSSNPETSRKNMARLLAEWARGGALGQPEDDARLTDVLSPSNISALISSDPALIST
                     ITPLLPPGLSLPENPTAEDITPILSAPQFTDAIASLDNALRSGGLPGGMMRELGLPES
                     AGSSVKGFLDGLVALGNKEAEDQDDKMEED"
     STS             426699..427496
                     /standard_name="Xba15"
                     /db_xref="UniSTS:470794"
     gene            426999..429370
                     /locus_tag="CNE01560"
                     /db_xref="GeneID:3257612"
     mRNA            join(426999..427263,427319..427364,427442..427521,
                     427584..427597,427669..427678,427731..427880,
                     427932..428314,428364..428751,428807..428894,
                     428953..429091,429144..429203,429260..429370)
                     /locus_tag="CNE01560"
                     /product="glutathione-disulfide reductase, putative"
                     /transcript_id="XM_570771.1"
                     /db_xref="GeneID:3257612"
     CDS             join(427220..427263,427319..427364,427442..427521,
                     427584..427597,427669..427678,427731..427880,
                     427932..428314,428364..428751,428807..428894,
                     428953..429091,429144..429203,429260..429297)
                     /locus_tag="CNE01560"
                     /codon_start=1
                     /product="glutathione-disulfide reductase, putative"
                     /protein_id="XP_570771.1"
                     /db_xref="GeneID:3257612"
                     /translation="MPPINKAQAEQVGEYDYFVIGGGSGGLASARRAGSYGAKVGLVE
                     VSPRLGGTCVNVGCVPKKIMWYTADVAENLRKSAQYGFGKEGEGYKLAADFNWTELKH
                     KRDAYIHRLNGIYESNLEKDHVDHHQGWASFVDANTVAIEPPNGDKYTVKAKNIVIAV
                     GGRPTVPSEKDIPGASYGITSDEFFELETQPKRVAVIGAGYIAVELAGVFNTLGSETH
                     LVIRHNQLLRTFDPMMSEVLVPCMEKAGMKIHKKTHVKKVEKTSSGSLLVHLDSSSEP
                     IEVDCLLWAIGRHADTAKLGLDKAGVKYDKKGDVIVDDYQNTNVPGIYAVGDVGGRML
                     LTPVAIAAGRRLSNRLFGPEKYKNDKLSYDNIPSVVFSHPTIGSIGLSEPEAREKFGD
                     DNIKIYKTSFRAMSFAMLDEDHKQPTAYKLICTGPDEKVVGLHIIGEGSDEMLQGFGV
                     AIKMGATKEDFDACVAIHPTSSEELVTLR"
     gene            complement(429331..433939)
                     /locus_tag="CNE01570"
                     /db_xref="GeneID:3257680"
     mRNA            complement(join(429331..429693,429742..429790,
                     429839..430462,430512..433269,433320..433939))
                     /locus_tag="CNE01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657188.1"
                     /db_xref="GeneID:3257680"
     CDS             complement(join(429509..429693,429742..429790,
                     429839..430462,430512..433269,433320..433699))
                     /locus_tag="CNE01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512836.1"
                     /db_xref="GeneID:3257680"
                     /translation="MRLVKRRSKASLQDASQLDSSKTGQSSPSILSTQSKAAAGSSSS
                     FTTTSYSPSSTRASSPVEKRNALGKKKRDKTGENRYPPSSFAQGHGWNFGRMRSFKGR
                     NRTSSKEVTSESEAELDVSLKCPCSFLDSAESTSSGSPLPPQCGSTHQHVPPAVFPWD
                     TSSPVAVSQTPSTYFSDTDELQSADSSVGLALSTDDLPTESPSCLSSATISPVLSRNA
                     HLPLSPMLDVKDDNDLSTRPLQEGPLKRLAKRRPASMIHDQQATTKSQDVVTTRKTRQ
                     PRSSSISSATYSKPSPPAPALSSGVHMETTPSIPPFPPLSPTRNTSLPDGAAPANQYY
                     FSSLNRNPSTATSHASTSSAACPSTEESAQSALLTTPSDLPGRELLNDHVWSRMGVEM
                     TKIPLESEEALLGGTSLVDQQVLEDQGIVQEETKALLDSPVSKAASSKTSTPDKSGRV
                     LRIKTSNFDFGSVSHREMGSSETPTRNDMLRSPVEGFTPINNNGSPEDHSFFSPVRDS
                     TPNRHNAFLLSPSIASESVYSVGEIGTATPAVVSQAQEVPFPAPERQNMIRPDEKRWD
                     ETENKKPQKDLRKSPEDVKHVLDAGREPMRHSSRMASSENSIKAAAQTPRLHEFPYRP
                     APPPPHLSKTVPAQSSWTSRHMSLSSSEKRPDPSELNPCQSLRIATSRDINLPPLPPE
                     PLSPAKGHEIPMERSLSFGGMLRRISMGKSPGKKKQKQRSIQEPSNGHETDKDVTDLG
                     LSGVPHLNSTEGCNCKPALKERESVYRSSPEIFPSMCAERNIDGNTGQVLSATPSLPG
                     QRLQDVFNASGTAGRSKSMPPQKRSPPANSIDHVLGGSYTTSPQGTAPSSPVSNDIGP
                     SASATTRSSTDNTPKDPFPPSDSLHTWRTLLGPYTPPELLSLPSYFQPPRPYSPSAPS
                     SPRHRSRNLAFDESERHSHEVRRRYRQSLVHIKDDNQFAYMLEEFSKIENDPRARMAL
                     GGGISIASSSGRNETNHSAGEEEEDYDERLTMRGKSKDVLEKKAKQQSIAAWFVTREI
                     VQGESRHAKLLAKGLRIAKAAAASKSKDKDGTSTPASPFSRTSTGPTSEPPELPPAPS
                     RLRSHYRTGSVPSLLRKHRSSLGEHQSQAPLGPMSSMASSPTAPQHVDPALILPATKS
                     QLPARIPTSMALATLLSRLPSLLDLSLNLSSAFLHDVSPYGVAQAFLEMEETLIREVG
                     QWAGEVGNVVVSGVTESLNKVMEDERKKRGKGLIDEEDDQSDERLAYLDIILMPVQRA
                     SRYKLLFQELSTKIPPASTTHHKILAAIEASRRLAAKCDECQVMDLELLRRHVKKSKK
                     LRPVSVGPGHK"
     gene            434567..435571
                     /locus_tag="CNE01575"
                     /db_xref="GeneID:36392857"
     mRNA            join(434567..435071,435176..435298,435360..435416,
                     435464..435571)
                     /locus_tag="CNE01575"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658517.1"
                     /db_xref="GeneID:36392857"
     STS             434596..435134
                     /locus_tag="CNE01575"
                     /standard_name="D1S3690"
                     /db_xref="UniSTS:474268"
     CDS             join(434918..435071,435176..435298,435360..435416,
                     435464..435525)
                     /locus_tag="CNE01575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514368.1"
                     /db_xref="GeneID:36392857"
                     /translation="MMRGFFGSSNKTAKKKEKEHNSSGTDPTSSLTTSGTETSNYSAS
                     SSSNRSEISITSSSSASEESSGTSTSYSSSSDSSPETDSLSSSSDSNSSGETSSREST
                     SPENTSRAGITRFFSRQMQNVADALTGKR"
     gene            complement(435050..437767)
                     /locus_tag="CNE01580"
                     /db_xref="GeneID:3257595"
     mRNA            complement(join(435050..435980,436041..436197,
                     436255..436651,436715..436958,437019..437767))
                     /locus_tag="CNE01580"
                     /product="expressed protein"
                     /transcript_id="XM_024657189.1"
                     /db_xref="GeneID:3257595"
     CDS             complement(join(435582..435980,436041..436197,
                     436255..436651,436715..436958,437019..437597))
                     /locus_tag="CNE01580"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512838.1"
                     /db_xref="GeneID:3257595"
                     /translation="MAQSKNDTVAVLSAFITLLRSPSPITLSNRTLLGAITHFFSSLS
                     PTPLKEFILELISSQSLWDTPTISTADVRDAIRLSVSAVVDRINEEKKDVYFSHYRTT
                     AKARSWLAHVLTSVLSSSNDSSRPLHILVGVLEGLDDVQMVDWGHSRVKLEEEVILRL
                     AGCIDKNLDDNLLLFCTAIPHLDAKRAGVLDILSLNAELEKHFYTLIDQSQRDSPNGV
                     DNLAITSRALARSFVILDSGGPSSRGHLWDALSRFCLTIRDIGGQLEKQLSEQTVDAT
                     PTLEHHKSVFSSFLLPASAIIDILVARVTSSENESPAVDRAVELLLALASFAYLTDDS
                     KGSFENYHRILFGSLDIVSGKGGVQAAERLFALLGQEDPLSDGRAAFLLLLGDELVHQ
                     LGRRSIDILLPLAEEHSYRYQHRPSFEAAHTFFLSLLRASAATFGTSASQSDFFDILL
                     PNYLTILIKQINSGNISDNQFKDAYPMITSYAALRGPSSVSLCRLYMSRLSPSRASRQ
                     VAIRLAPYIPTCDLPAYLDSISTAIQETPRGSEDRLILMEEAFKMVTQDLRDEHRRLG
                     MEWWLQWKAKLDDKEGKMGFWKARL"
     gene            437903..439840
                     /locus_tag="CNE01590"
                     /db_xref="GeneID:3257973"
     mRNA            join(437903..438545,438603..438677,438743..439150,
                     439211..439840)
                     /locus_tag="CNE01590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570777.2"
                     /db_xref="GeneID:3257973"
     CDS             join(438031..438545,438603..438677,438743..439150,
                     439211..439538)
                     /locus_tag="CNE01590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570777.1"
                     /db_xref="GeneID:3257973"
                     /translation="MATIHPSRMRLVPGAAQQRLPPPSSAELPSREDELKKSLMERRS
                     RDDGAGSRSDMERGNRDDRDRAYERDRKDSGYDRDRRDRRDGNDGRQRDEPPHQERRA
                     SPSYQPYHSHDMTGSAPAPSGPPGAGHGYGYGRRDDIPRGPPGSGGAAPVFRGSWQNP
                     PPRFNGPIDFERRRQERNDSTFSIWPASPKGPHRDEDEIEAERKKSKSKSSRKSKSKR
                     SKRSKYSDSDSTDSEEERRRRRRRREKEREKDRGKDRERERRHDSDDEERERRKRRRS
                     EKTDDDQWVEKGHERQSKGKEVIPAPVKEQVVENDDDDVEVGPQLPKEINEKRGRSAF
                     ANMLPGEGEAIMAYAESGQRIPRRGEIGLDSEQIAVYESSGYVMSGSRHQRMNAVRMR
                     KENQVINEAEKRAILKLQREERMKKEGAIVSQFKEMIDENLRKQGLDGQ"
     gene            439844..442995
                     /locus_tag="CNE01600"
                     /db_xref="GeneID:3257819"
     mRNA            join(439844..441379,441437..441597,441647..441841,
                     441898..442995)
                     /locus_tag="CNE01600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657190.1"
                     /db_xref="GeneID:3257819"
     CDS             join(440222..441379,441437..441597,441647..441841,
                     441898..442741)
                     /locus_tag="CNE01600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512839.1"
                     /db_xref="GeneID:3257819"
                     /translation="MSAFRKFVGNKNAGISASEGDQDPTDASLLPRANADEERLWGIE
                     NFSNSCFCNSVLQALYACSTFRDFVEAYPDILPPRRPIGPSQVEKRYPSVEWDGPVPG
                     WDPSIRLNKEHRAFIALQEANTSMTPGGKEKRNWMGRKMSSAQSAPTLATLQASQPEP
                     LPSLPNPFPNFDDPLLVRTPASDNDPPLTLFQTFQTLFYYFSHSPPHMPIKGKGQTKD
                     SEGALIEYTEEEKVDDSGVEVPEKASSSNQGQPAQSTSASSQQTQSQGQNAQSSGPSK
                     LASLPPPSTFRETGAWRAGQLGWGVVQPNDVMDAVKRSAPSFNNDDQHDAHEFFSVVV
                     NTLAKEVDAVNEKLRAQGKEVAKMTAPWAKTFVEALFQGITTSETKCLSCETISSRDE
                     EFIDLSVDIEQHCSITSCLRQFSSDEMMSGREKFSCESCSGHQEAKRSIRIKRLPPIL
                     AVHLKRFAHNESYRAIKLFYRVNHPTTLIPPNTTDNCENPDQIYDLVAIMVHIGNGPV
                     QGHYVTVKRTPSGRWVMCDDDNIEAIEENQLEYWLGNRTQGQGYVLFYQARGITAEHL
                     GLKVEKRKPNGVFEPVGEGVRYADGYGQAPAMAPVASATLNNVRTVNGVREEEEEEVA
                     SSSGSISVSVPGLKPLSLASPVSSPSATPSSVGSRVDRQLGFNTPANGVAHESTARPP
                     LKKELSDKKWFRRMSMSGISSSAKDKEKTSNSKDKPVNGLSNGGTTPLAECRTDTSSS
                     ADVTSLTTGQPTSIPKSQKRSLNSAIPSARSWMGRAEKTHGKISR"
     gene            complement(442938..444414)
                     /locus_tag="CNE01610"
                     /db_xref="GeneID:3257528"
     mRNA            complement(join(442938..443029,443109..443287,
                     443359..443692,443749..443995,444062..444414))
                     /locus_tag="CNE01610"
                     /product="expressed protein"
                     /transcript_id="XM_024657191.1"
                     /db_xref="GeneID:3257528"
     CDS             complement(join(443378..443692,443749..443995,
                     444062..444342))
                     /locus_tag="CNE01610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512959.1"
                     /db_xref="GeneID:3257528"
                     /translation="MSSISRTVECSFRTATRSTPRIRPTFASSCRCLTRSNNIAADIQ
                     SRTFFSLPDLTKIASLVPGQGQEDTSENARAQGVEVDGEVQRYHARKILPYSQAQLYS
                     LVSDVPSYASFIPFCKSSTVLAPSSPGFSSTREWVGWKPEDKPFEVLAELAVGFGGLE
                     ERYVSKVVGRPYESVVATASNQTPMFKTLTTSWTFSPASSISPHPSFGNPSSDSSNSR
                     IPNSASPADPTHGPSLLTIDLAFSFLNPLHRIASQAVLPKVAEKMVEAFEERCLKVWG
                     QGKQ"
     gene            complement(445056..450241)
                     /locus_tag="CNE01620"
                     /db_xref="GeneID:3257571"
     mRNA            complement(join(445056..445993,446048..446967,
                     447018..449464,449526..450241))
                     /locus_tag="CNE01620"
                     /product="expressed protein"
                     /transcript_id="XM_024657192.1"
                     /db_xref="GeneID:3257571"
     CDS             complement(join(445205..445993,446048..446967,
                     447018..449464,449526..449884))
                     /locus_tag="CNE01620"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512841.1"
                     /db_xref="GeneID:3257571"
                     /translation="MTTLTSQPQAVGSQLHQSLSATHDYEYDPPESPLSSSSFIQGDA
                     EMDQDHANFYYQQQQQAILYQQHHQENGLEPGAARMAARHARLGADGDSDDGFSDEES
                     DSDSMPDESIDFSLTYALHTFLATVEGQASVVKGDSLVLLDDANSYWWLVRVLKTEDV
                     GYIPAENIETPYERLARLNKHRNIDLAAATLTEKQLGEMQSREKLKGAIAAKGRSARQ
                     GSSEGSEESGARRVVFAPPTYVDHPGVTWSSDEESSEGEHEPDEAEGQEDGHEDQIED
                     EKFAQEVMDVDQSMDEMEPDDGIEWADDAAERERQKALDQRVQAQVQQNSVQPKSNNP
                     FAPPQVKSNTPADTVSIDRPGDSTTSLVTSNGNPTLDPAVAASDTRRVTATPAVANSP
                     LLPSAVVQQSQRKVSNQSTSSVYSAISASSSVRSSTPNSITSPEDNMKKSKKARKGKD
                     EEGGEKKKKGLLGGLFSRNKSNKPKGISSGDTRSSEESTVEEFSQGIVYGRDTSTGSL
                     TPQQQAEHPQSGVSTHSLKLQQQDQARMQSYTNKYLRSPSSGLHSPSNAEAAAAVAQS
                     AAAMRLTASMNGTANGRSARPSSIIVSPNPDGPPLLNVIRIFAGTRVQSEASFKTALV
                     NETTSAGDLIRQAVQRFHLISPAGEDPVKNYFITVKDFDGSELELSPTEKPLVQFQNA
                     VARWTSGETEADELGKILHERLGAITPTVNRESVSSISSVLSLSNHPAIKKLGMDWED
                     DSAVKLYLNRRVPGGQEETQQEMRGLVEASQKGVSEAQSEFSSYSTGLSTVHESPDAP
                     GGVLFPAMSQNESKNPHLTISTSYQGPAERYLSPSAKFTLQLLLHPSDLPDGVAFDPS
                     SESLVPRPHMPSPSVEEPRMKLFTVPRNANVVDVIEQGLERFGVQEGVVDGGDEVEDK
                     VGKRRSMTRVRYCLGVIIDGKERQLPTSSKILEAYPSPPMFKPMEKSTPESRRRSRDL
                     SSHLGSMGDIRESDPIFVLRKVGPRGLAGAMIDGLKAPALATPLTSATLSTTSSGPRS
                     PAEIIAAQRAASRSRQLSILSKTNKSEGVDVVLPSSQGTFRSTKQVDEKGSRVMRYSY
                     IDEGGEMYDISELLEQEWGKGKVKAIEEEGEKEEFGMSLVGNGKNGPPGLLRQMTDTS
                     NYYTAPSTPQPGADLDIDEVEILDDSRPRSLERSEEDLLQTAVQRASQDGQSAGLEEA
                     LKRVLSRVKEGSSKGSTGPEDVVRSQNGTPNGRVTPQQTMVVDPQATPRASGHQYQQN
                     SHALDQSRSNSRQTNREYDDTATSVNRIISRHRQHPSIASIMSDIESNSGSLRSREYS
                     AEPRSISDVDENTDTDLEGSGSGYEANFNDRSSTPATATSSTHPTPPFSGGAFVYTRA
                     VNTSSPSLRLPISYQDDFGMKDMMAVIKTRAREYRRPLVKPKSKETRMRSSLSSKASS
                     RSDERPGANWQDDELVDEVDRHFIGEKIDWDEVHPEIRGCFQGVQERLDKFDRELDEL
                     LAEVGALGAL"
     STS             448998..449792
                     /standard_name="Eco10"
                     /db_xref="UniSTS:470795"
     gene            450489..455131
                     /locus_tag="CNE01630"
                     /db_xref="GeneID:3257555"
     mRNA            join(450489..451137,451226..451768,451818..452134,
                     452191..452440,452504..452524,452572..452694,
                     452743..452850,452900..452970,453022..455131)
                     /locus_tag="CNE01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_570782.1"
                     /db_xref="GeneID:3257555"
     CDS             join(451352..451768,451818..452134,452191..452440,
                     452504..452524,452572..452694,452743..452850,
                     452900..452970,453022..455011)
                     /locus_tag="CNE01630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570782.1"
                     /db_xref="GeneID:3257555"
                     /translation="MTTAIYRAKIPTLFVSSFHSAADHSSSHNYAVSYHHPPSFQQSA
                     AVSKMTLVDVASVDAQNETAAGLAEEACPTEKASDDIKKPSSIHKAEETYRTQDHPTI
                     PKLQASTSEASTKINHYVAKLEDFQLIRVLGKGCAGRVLLVKHAQTHTIHAMKAISKR
                     SVFTHDEFDHTMTEVSILRRIAIQEPHNRFVSKLHFSFTDQENFYFVMEFYPGGDLAT
                     QMEIYGILGDHRTRFYASDITQGLEDLHRHGIIVRDLKPENILLNAKGHAVLADFGLS
                     KEFDYRGDPKPIHAVTYPGQAELPAWAGKGAGSYRSQPGGGKKLVIDKAYSFVGTSEY
                     LSPEVVKRGDYSYAVDWWALGCIVFEGLMGRVPFRKGDEDPPMVLWNKILYDPWDDYF
                     KDPKLARYAPDQTTYKFIDALLQKDPMRRITEPCVKQHEYFSMIDWGTVQRGEYQDPH
                     GLHIHPTAEYNTRYFPKLCLQEDPSVDMSTHDLRDYEVGGGKRTPMNDDALYKLELVR
                     YQKELEGFTWSKDWGTIWDGEEESEMESGVESFIEESVTELGGEAQDKVDRLTEQPVD
                     HEENASDQNLTPAVSGCLSAQVDCPDPSKSSSLLVPPTDSPENTPVAPKLSLPSTASE
                     FDAATSSPAATFGVPTPAAEGLFNPILSGQLQTNEEDRQNEVKTPFMELTLKQLESQG
                     IEITIATEDKTPMARDTEVMSKGARDAQVKQLEDLSTDMESATVFQDDFNGTDITEKP
                     LSPFRSLPSLTSSNEELIPLVPPPPVPTSLIPPPVPAQPVSIPDPLPSQTMANPHPLS
                     IAVFETLNLPTDLPLSGLSVSDVISVPSLCVGHASPRLVRRHLRRESEVSIPLARLSV
                     ELHGTITRLEDEEWEELVSNKEDIPTAPNGGPGAPYFFRSFTGLRRKPSTLVSSSLRR
                     PYGPDSDTSSRGSSGSLNKSNRRDLKERRLFGGKRSIESTKRALRGLKTFPRLKSLAQ
                     EWGKDRIGAAGPVSPLISLPSSAPHRSSLRVSNEGSSSDALGRKVQITRPDDARHHTE
                     SGWIGRHLKRTKPSSAPALQSRVISSSTFNTGNRSDSDEQRGAVGMAEGKGTAPRLEL
                     EESEPVVWGL"
     gene            456460..457957
                     /locus_tag="CNE01635"
                     /db_xref="GeneID:36392858"
     mRNA            join(456460..456783,456852..457114,457211..457957)
                     /locus_tag="CNE01635"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658518.1"
                     /db_xref="GeneID:36392858"
     CDS             join(456688..456783,456852..457114,457211..457844)
                     /locus_tag="CNE01635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514369.1"
                     /db_xref="GeneID:36392858"
                     /translation="MMQVENTTPICDGTFVAINNLSPQNANTSSLEPQVLLILVGLPG
                     SGKTTFAEALVRASSMYITPPEGTGKVQPSVIRRPWMRASQDDAPSKRRQECESRVRW
                     GLKNGYNVLVDRVGFDPVQRSHFVAIADDQLPRPLVYCLILSVSQDTLQSRLLGRESH
                     PTIHGGEEGMRVLSQMSRLFQPPTIYGGEGLDRMYVLDEINQPSAAEGWSDQRVLEIV
                     DRVGNDGRREVGERKNYRPAPRIHDDNASPRGASNNFRGGRRGMWGGSRIRGSWDGRG
                     SWRSRGGYKGPSSGWSSREGSRGTGGGTGFPPASLSSHNPYNRSFGNQGAPGGA"
     gene            458155..460663
                     /locus_tag="CNE01640"
                     /db_xref="GeneID:3257882"
     mRNA            join(458155..458413,458470..458546,458599..458671,
                     458735..459043,459095..459253,459310..459674,
                     459721..460663)
                     /locus_tag="CNE01640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657193.1"
                     /db_xref="GeneID:3257882"
     CDS             join(458355..458413,458470..458546,458599..458671,
                     458735..459043,459095..459253,459310..459674,
                     459721..460274)
                     /locus_tag="CNE01640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512958.1"
                     /db_xref="GeneID:3257882"
                     /translation="MSPANGGDMRAFAMPRVGNSSSYTLVVRQQPERARLCSYKEENE
                     TIDRRPVDPPPVVELRVGSGREVTPEQLLESTSFFIRATTVTSDPLTPASPTSFNPSL
                     FSSKPLTHAGPTYAPVKTPLGADATTGEVIQTPEKLRLLDGRMAALCTFAKISVRVPG
                     IFRLKFTLFETTERGILELAHTISEPFEVFSPKLFKGMHESTPLTRHLAAQGLKVKLR
                     TDTTVGRQSVRRRRASANPTTPSTPSIIKEDVSASTNIPPASSPHFLPAKSRRSPSLS
                     AQAPPSHPEVPSPSSKVARRTVSDSPRNLVWRHAAYEFMRPHAADNRVSGPGGRPFTD
                     DGAFISPNPVDWRVSAPSSDLSAFSLSRPHRVDPFRPPSVPNDTTNLASPQSYTPSSY
                     PSSQVSSTQSLPTTPSPVTSSHSSIQSTLPISRRSLGIDDGVPILPLPSSFNSPGHAE
                     FVPPSVNQVLNPLRRSSISSGLGLPEGHGSSSQSVAGPIIARNRYLDAPISGSSSLRR
                     PSPLTLPPLRPPPQQEETSYERH"
     gene            complement(460521..461682)
                     /locus_tag="CNE01645"
                     /db_xref="GeneID:36392859"
     mRNA            complement(join(460521..461420,461469..461682))
                     /locus_tag="CNE01645"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658519.1"
                     /db_xref="GeneID:36392859"
     CDS             complement(join(460594..461420,461469..461604))
                     /locus_tag="CNE01645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514370.1"
                     /db_xref="GeneID:36392859"
                     /translation="MSQQQPPIPDDVDIVRAFDPSKDEHMVKMLVGQGVMEGLARANN
                     KIITSPLALLVVFLLGMGINHISSFSVNSNPLSYISPLIGPCLAFLPLMGIVEYIHRP
                     LFTARMRKIIGAIDMIRPSTYYAEGKSGIWVFQHKGEVVGVVCLDVTKNAGKQLGSVL
                     GEEEGQLNEKDGHDVFASSKEDEENNNAPDLRRRIAGKETKPASRIAHIRHLDVDQPY
                     RRNGVGSELVLTALDHAFSISSGDLSPPVDRVIVRTNPLSPDGGKLFAKCGFKPITQA
                     EVGAATWEKNEKIGLLGWAGECLSVDRDTWNIKRRELLEQARVK"
     gene            461850..463813
                     /locus_tag="CNE01650"
                     /db_xref="GeneID:3257480"
     mRNA            join(461850..461914,461973..461987,462040..462125,
                     462177..462334,462384..462564,462622..462832,
                     462891..463006,463055..463170,463230..463353,
                     463405..463542,463599..463688,463740..463813)
                     /locus_tag="CNE01650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571227.2"
                     /db_xref="GeneID:3257480"
     CDS             join(461889..461914,461973..461987,462040..462125,
                     462177..462334,462384..462564,462622..462832,
                     462891..463006,463055..463170,463230..463353,
                     463405..463542,463599..463688,463740..463768)
                     /locus_tag="CNE01650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571227.1"
                     /db_xref="GeneID:3257480"
                     /translation="MPVPVSEKPMVEYDASSPQVMQLFYRRLFPYRPLYLWLNQEQIP
                     SKLFTHREFAFTLAGDVYLRYQSFNNVDEFKASIARHIPSRFEIGPQYSARPKDRKTL
                     ASGALQPQRRELVFDIDMTDYDEIRTCCTDKTICKRCWGFIAAAVKVLDHSLRETFGF
                     KHLLWVYSGRRGIHCWISDQSALDLTDDQRRALVTFLEVIKGGKEQSKKVNVRGPTGD
                     AALHPFLSEALDTLKPLFSSLCIYDQDCFKGEKGWEALLAILPTDRTVIGPLRAKWEK
                     NSDSSSEEKWRELMSEIAKHKKEEAIMTKFTKAVEDVVLQYTYPRIDAEVSKHRNHLL
                     KSPFCVHPGTGRVCVPINPSLIDEFDPDTVPTVGQLLNELDNVKAEDSEAAGRRMEDY
                     EHTSLGPYVEMFEKHVAAVLRDGRNAKRAAKAESLDF"
     gene            464008..464953
                     /locus_tag="CNE01655"
                     /db_xref="GeneID:36392860"
     mRNA            join(464008..464454,464509..464953)
                     /locus_tag="CNE01655"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658520.1"
                     /db_xref="GeneID:36392860"
     CDS             join(464133..464454,464509..464897)
                     /locus_tag="CNE01655"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514371.1"
                     /db_xref="GeneID:36392860"
                     /translation="MVRPIPIPIRHTTLEVGTAFEKHALSFLNKSMSMSLRHVGGARD
                     GGVDLRGWWWVPRIAMPATEFAAGENCGGVRRLRVLAQCKAEKKSVGPRAVRELEGVM
                     SQLEFRREQQSTAEAAIAILISQSGFTKNAMLHATQSRIPLMLLHLPGGQPTGLTLIS
                     SSPERDSGTFADQERIKVESAWWNRPLSHGILGGKMELRREVLVTGDGLGANTALWMD
                     GERLGRCVPSEEDELEGW"
     gene            complement(464935..466573)
                     /locus_tag="CNE01660"
                     /db_xref="GeneID:3257963"
     mRNA            complement(join(464935..465354,465408..465584,
                     465633..465827,465887..466573))
                     /locus_tag="CNE01660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570784.2"
                     /db_xref="GeneID:3257963"
     CDS             complement(join(465062..465354,465408..465584,
                     465633..465827,465887..466505))
                     /locus_tag="CNE01660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570784.1"
                     /db_xref="GeneID:3257963"
                     /translation="MPKRGRQSLSLFTSLPDDLRRSIRSKSGDTTQLTVQHPVDTPTV
                     PVDTLFSTQTLLPTQPYSNNEEEEEERCEKGVDLPGIKSTLVNGAGTIEESGEKDITL
                     MEVSQAQIQAESQSSPNQNESYQMEASASLSPTARRKSESYNVSWLGGTNKIVKPSTA
                     KARKQSKKRQRQAGTIVNPHIDHPWDCTGLVPRFTHVDHVPKQLQKYFRQRGLLFPEY
                     DRLPLLLDHTGWFSVTPQPIATHIAERCQCDVIVDAFCGVGGNAIAFAKTCERVIAID
                     NDITRLKLARHNALHHGVADRIEFILGDYTEFARSFAEKNPGDKIDVVFLSPPWGGID
                     YLNSPSATYSLSSILPIHGRDLFNLTSKLTPNIAYYLPRNMDMQEISELARELDYPDP
                     ERRGRVREWVEVEEETVRDKVKALTVYYGGLVADE"
     STS             466610..467637
                     /standard_name="ha2307"
                     /db_xref="UniSTS:515520"
     gene            466742..469158
                     /locus_tag="CNE01670"
                     /db_xref="GeneID:3257913"
     mRNA            join(466742..466927,466986..467272,467328..467429,
                     467484..468656,468708..469158)
                     /locus_tag="CNE01670"
                     /product="ribosomal large subunit assembly and
                     maintenance-related protein, putative"
                     /transcript_id="XM_024657194.1"
                     /db_xref="GeneID:3257913"
     CDS             join(466750..466927,466986..467272,467328..467429,
                     467484..467780)
                     /locus_tag="CNE01670"
                     /codon_start=1
                     /product="ribosomal large subunit assembly and
                     maintenance-related protein, putative"
                     /protein_id="XP_024512843.1"
                     /db_xref="GeneID:3257913"
                     /translation="MSKAVLAAAEKTKSKDKAGPSEGVKPRKDKVLMLSSRGVTQRMR
                     HLMRDLEALLPHVKRDSKLDTKSSLHLLNELADLHSCSNTLYFEARRHEDLYLWLSRS
                     PNGPSVKCHVQNLHTMDELKMTGNCLKGSRGLVCFDGSWEGEHWSLMKEMFTHAFSVP
                     KTSRKLKPFIDHILLFSLLDNKIWFRNYQIIEKDPLTPSGPPQSSLVEIGPRFVLTPI
                     KIFEGSFGGPTLFSNSEFITPAAMRASVKRIAGEKYRVRKEGEKDREERRKRVREDVE
                     EDELARKKVFA"
     gene            complement(467646..469647)
                     /locus_tag="CNE01680"
                     /db_xref="GeneID:3257482"
     mRNA            complement(join(467646..468064,468112..468639,
                     468686..469419,469482..469647))
                     /locus_tag="CNE01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657195.1"
                     /db_xref="GeneID:3257482"
     CDS             complement(join(467915..468064,468112..468639,
                     468686..469419,469482..469509))
                     /locus_tag="CNE01680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512844.1"
                     /db_xref="GeneID:3257482"
                     /translation="MTGCLALCNSSKQTLPPLSRTRPSPRSRNVVADSAFRVYQSATT
                     QSATSTTSSTSDGKLHANPVSRTYEDDPEQRVGILNDFQDSEKGYVEQLNQLRKIYIL
                     PMSQPIQMGPGGQHFFEIPEDERRTVFSDIRKIINYHTVDIYPTITMIIRQMKAMGHD
                     TDGVWSKRAIYEIAEVFNSRADELKGYYSAYGRSVWDAILTADLWVEPPGNPSGHELW
                     VEEFCHERKKHPEHELKSLAQYLELPLKRLTHYELFLKHLARQTPPQSQNDDALDIAY
                     KSMSSLGTRVSQARRFAQLRSQLRPDHSATFINQTLALDSPDLIMEGPFTLVRYLTRE
                     SISIVRDHFMIDNEELLFPGERRETLDTIYYQHNHTDLIGRNLLGVLLSDRLVLLADS
                     NEKDVDFCTFAILRMSEIKDNLKVCGLGKAYVRVVCGHSAYYLDTGSRDNAKQWLEKI
                     DILRQDHQAEAQVEHNSPRNGENGSVTSP"
     gene            469862..473286
                     /locus_tag="CNE01690"
                     /old_locus_tag="CNE01700"
                     /db_xref="GeneID:3257744"
     mRNA            join(469862..470636,470687..470697,470895..470899,
                     470949..471046,471097..471462,471515..471764,
                     471827..472159,472209..472654,472704..473286)
                     /locus_tag="CNE01690"
                     /old_locus_tag="CNE01700"
                     /product="expressed protein"
                     /transcript_id="XM_024657196.1"
                     /db_xref="GeneID:3257744"
     CDS             join(469990..470636,470687..470697,470895..470899,
                     470949..471046,471097..471462,471515..471764,
                     471827..472159,472209..472654,472704..473169)
                     /locus_tag="CNE01690"
                     /old_locus_tag="CNE01700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512846.1"
                     /db_xref="GeneID:3257744"
                     /translation="MSDSHDSPQTAGHAPHTEHSHPSPTPPSNHTSPPLSSQPPHEQH
                     NPPLHHPPQHAHIGDDEAAALAMEADMDASVMIDPALLGDEEGFDPTTLANLAALSRI
                     INDDDEDMQVDEMAPEPEPEDEPLETGSPREPLTREQVQEFMNQLAQRDKSKDQEEDK
                     DKDHEGNKDKDQDDARDKGDKEGDQEEEEVRSEKGDDEYEEQGKVKGKRKRNRTVLSC
                     TEHCDRNIPCSRCVKRGIPGLCRMEHPVLPRRKRRRPQEDEDLNYELGLRVQALESLL
                     RGTGSFIDADQAHAAAHETVRDATKAAKAGSQDATNALAQLSQGVEGMSRGAQSSLLL
                     DVLQQLTAASMGRPLSGSSSAASGDKKGLELWSSLPKASQETTVAIASAFEDDDAPNK
                     INICTPGYRDETGKLFVPPTVRYAEKQLNSESMVSREALPIEGHAPFLDAGVKFAYGG
                     DSHPYRHKRVAAVQAVSLTGALRLAGTFLSRFPTLPPTKTVFIPSPTTDEDVTALQDA
                     GLEIRSFRFLDLKTGGVDWESLREDLQDAPMKSIVLLHVSGSVPSGAELTTNQWRLLA
                     SLLQEREMIPLVIMAFQGLSSGDTNRDAQALRFMVHEGLPVVLVQNFDATMGLYADSP
                     SIVSIVTRNSEDKDRVESQLRAIGRGMWIHPSPWGAHIAHQILTDAKLHPSWLKEMRL
                     MSDRLRSARSKLYMQLVDKLKTPGDWAHIKKANGMYCTALLPSAQTEALTAKHHIHLL
                     PDGCFNLGSLNSSKIDALSRAIDSVVREGIREAEEAQAHRLAMELALAAAKEQAAREE
                     TQREEEREAAEMRAAREEDTLLMERSIANAIERQKREEEEERKREEQRKREDEQQRKQ
                     REREEIARQAEAILATI"
     gene            complement(473308..474280)
                     /locus_tag="CNE01710"
                     /db_xref="GeneID:3257858"
     mRNA            complement(join(473308..473509,473562..473618,
                     473672..473943,473997..474280))
                     /locus_tag="CNE01710"
                     /product="nucleolar protein family A member 2, putative"
                     /transcript_id="XM_570792.1"
                     /db_xref="GeneID:3257858"
     CDS             complement(join(473395..473509,473562..473618,
                     473672..473943,473997..474230))
                     /locus_tag="CNE01710"
                     /codon_start=1
                     /product="nucleolar protein family A member 2, putative"
                     /protein_id="XP_570792.1"
                     /db_xref="GeneID:3257858"
                     /translation="MAPESTPKKEKKDKKRKSDVADTSIAPEPVAPEEGTASAEAVAM
                     EVDGDRALKKQKKEKKEKRKSLAAEGAEEVEDKKAEFAVPADAISPIASPLAGKKLSK
                     KLHKTVKKASKARQLKRGVKEVVKALRKGEKGLLLLASNITPIDVISHLPLLAEEAAG
                     VEYCWVLSKEELGVYAGTKRATSCVLISTTPNKKATVSEEDRADVKATLEECMEEVKK
                     LETAIKY"
     gene            474518..476410
                     /locus_tag="CNE01720"
                     /db_xref="GeneID:3257621"
     mRNA            join(474518..474739,474789..474847,474908..475066,
                     475117..475535,475591..475767,475817..475918,
                     475972..476078,476129..476410)
                     /locus_tag="CNE01720"
                     /product="aldehyde dehydrogenase, putative"
                     /transcript_id="XM_570794.1"
                     /db_xref="GeneID:3257621"
     CDS             join(474563..474739,474789..474847,474908..475066,
                     475117..475535,475591..475767,475817..475918,
                     475972..476078,476129..476362)
                     /locus_tag="CNE01720"
                     /codon_start=1
                     /product="aldehyde dehydrogenase, putative"
                     /protein_id="XP_570794.1"
                     /db_xref="GeneID:3257621"
                     /translation="MSNVNIQTTISPYLQKPVCTRPLLAQPELDSVIAQSVKAHKSWK
                     KVPLEKRIQIAQKWLEEFEKIADVACEDISTQMGRPISQCTGETNGTLWRARHIIDIA
                     AECLKPVPQPKPPVEGVEKYFVKQPLGVVCVISPWNYPHLCLVNAVVAALISGNAVII
                     KPAPQTPSPAERWVSTWQAAGLPANVLQVVHLSQESTLKHLVADPRIDFVSFTGSVAA
                     GRAVQQAAGSGKGFKGTCLELGGNDPAYVRQDVNIKFAAEQLVDGVVYNSGQSCAAVE
                     RIYVHSAIYDEFVKEFVEVAKQLKLGDPSKPDTTLGPVVSVASGSRIRKQIKDAIAAG
                     AQVALDESFFPEAKEGTALVGPTVLTNVDHSMEIMTEETFGPVVGIMKVENDEEALAL
                     MNDSVYGLTASVWTNPSDPQSLAVFNQFAEELECGTVYLNKSDALDPSLPWSGWKNSG
                     RGVSLSSFIYDVVNHTKSVMKRVAVPQ"
     gene            476593..478013
                     /locus_tag="CNE01730"
                     /db_xref="GeneID:3257939"
     mRNA            join(476593..477105,477156..477249,477303..477524,
                     477578..478013)
                     /locus_tag="CNE01730"
                     /product="expressed protein"
                     /transcript_id="XM_570796.2"
                     /db_xref="GeneID:3257939"
     CDS             join(476650..477105,477156..477249,477303..477524,
                     477578..477930)
                     /locus_tag="CNE01730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570796.1"
                     /db_xref="GeneID:3257939"
                     /translation="MAHHHFVGINPAGLSFSHPTPPADHPAPPSSGSIHTPANFASIQ
                     EPITDPSAVAARRRGRPSTRGEAGVTPPPEIGWWEDRAPSWHKDAMQGGKSSMELLME
                     WSEEMKNQGHYYWMGVRDGGNLHQGASRFRDYLYAQHGPIRRSSKAIRNKVENIKQKF
                     FEAQEWLKDPNGDHTTMTIPDVEKKLNKICRNYRFWETIFVELPPVDHEAGQNAEGSS
                     SNQTLQSASQTAVRQGNGPLIRGIPVPEMGQAAADDAQRNVRRRLNDGSSATIPSDSS
                     LVGRVLPASYLERTREERDREKHELAKKQQALNREQYELEQKKDERDQKRFEWEQTKH
                     LVETALKIRELDIIPLEAAMIKARALYGQAREEDQAEATL"
     gene            complement(478050..481712)
                     /locus_tag="CNE01740"
                     /db_xref="GeneID:3257794"
     mRNA            complement(join(478050..478614,478677..478748,
                     478816..478845,478903..479078,479132..479163,
                     479212..479349,479401..479618,479671..479769,
                     479818..480049,480104..480282,480333..480367,
                     480415..480515,480576..480757,480809..480859,
                     480933..480979,481036..481058,481116..481207,
                     481264..481452,481513..481712))
                     /locus_tag="CNE01740"
                     /product="polyphosphoinositide phosphatase, putative"
                     /transcript_id="XM_570798.1"
                     /db_xref="GeneID:3257794"
     CDS             complement(join(478122..478614,478677..478748,
                     478816..478845,478903..479078,479132..479163,
                     479212..479349,479401..479618,479671..479769,
                     479818..480049,480104..480282,480333..480367,
                     480415..480515,480576..480757,480809..480859,
                     480933..480979,481036..481058,481116..481207,
                     481264..481452,481513..481607))
                     /locus_tag="CNE01740"
                     /codon_start=1
                     /product="polyphosphoinositide phosphatase, putative"
                     /protein_id="XP_570798.1"
                     /db_xref="GeneID:3257794"
                     /translation="MVSKGESRQTKEDATANALNSLSKFTLFRTKTRLYVIASTDNIH
                     RVLKIDRTDPNTLNVVEDTTSYDEIELQQLLRMVKDGNKSQGGLDKVMDFYGLVGFIR
                     FTTCWYMILMTKRSEVGLLGGHYIYHCDDTTLYPIGSKVEKSTLETKMVNTFNLVDLS
                     KNFYFSYSYDLTNTLQTNLTVSANNRRWNTRFMWNHHLLSPAFNLEEPRGRSRWIIPL
                     IHGFVDQAKIHVFSRTVYLTLIARRSRHYAGARFLTRGANEHGHVANEVETEQIVSEP
                     LSTSFGQHDSSRPEQPLSDFSAGYGGYTSFVQYRGSIPVMWHQESNQMTPRPPIEITI
                     KDPFYTPAAKHFDDLLGRYGAPIYILNLIKSRESVPRESKLLFEYGQCVKYLNQFLPE
                     GKKMDYIAWDMSQAAKSGQQDVIGVLEDICEESLQATNFFHGGPARNAVGAGPHRDHP
                     LLQHGILRVNCVDCLDRTNAAQFAIAKRAFGHQLYALGFLATPYLEFSCDAVDVLTEM
                     YHDHGDTLAWQYTGSALVNRVDTYRRTKATQWSSHSRDILENIRRFYNNSMLDGDKQS
                     AINLFLGVQPSVPTYDLTRPNYRQWYHPAHLEDPKADDLAPINQVYAEYYKPDKMSEF
                     SNMYAFNMNSTSRFHAKSRYDNVSSPFEPREQSSHNSVPNARRIARRWATVAETSGSP
                     HQPSSSPDRPVRLKTIQFESPPSAIELFIRSLYDPQDLPERILNYEFYTHYTESEGID
                     MVCEEQDLEMYRMVARMQEGGDEKELLHGTEMNMKLRMSDPPGDSGELAVESHQRLSK
                     DMSTKDKQIIERYINMLSVPLSTGGEYSL"
     gene            complement(481873..481955)
                     /locus_tag="CNE01750"
                     /db_xref="GeneID:3257861"
     tRNA            complement(481873..481955)
                     /locus_tag="CNE01750"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3257861"
     gene            482057..485192
                     /locus_tag="CNE01760"
                     /db_xref="GeneID:3257937"
     mRNA            join(482057..483166,483213..483269,483342..484307,
                     484360..484588,484642..484912,484968..485192)
                     /locus_tag="CNE01760"
                     /product="expressed protein"
                     /transcript_id="XM_571229.2"
                     /db_xref="GeneID:3257937"
     CDS             join(482175..483166,483213..483269,483342..484307,
                     484360..484588,484642..484912,484968..485071)
                     /locus_tag="CNE01760"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571229.1"
                     /db_xref="GeneID:3257937"
                     /translation="MLAEILLILSGHPSSFFIPYPSPPAVPFTCKASPSLTEYLHPGE
                     VASLNSLADLAFQYRKVKTWANDTIDCGRKAILAESLPPSRKGKEREVFMNDKGDSIK
                     LNQYLVTLAASIIEVLNGYELLIVETEAKVLSFDPAVVQDQQGYVPLASIVATFDRWR
                     APLTALSQIVDQLSSFDEREDSWSPGRLIDLILLKSQTGNPFLQNIFSNLAKSLQDLF
                     LTHLVSFILHGIAPSEPLMTSPSIGRTVGVDPLSPQHRVYALNVDMLPTSIGENTRES
                     TLYVGRVVATLKREGKSLPKGLVDSLRGELMAVKSLEVGGGLKEAVEKARAEVGEWLW
                     RHILTGPQVAESIEMFGSFFLLRKTDYCIAVIRGISQLRLDKLITSNPHSSSSIIREQ
                     DLDLILRRASVGTSAELDSQLDSLHYKMEKGPLRAMLPTVPVKTPKQTDIESKSDTVE
                     HRNSIRALFSSSLLGTPLILTTTVTWPLDLFISPQALSAYSDIQAYLTALRHTHLSVL
                     SCWTALSAAQRQRRKWTGVTEGGTDEEVEARRRLGRAAWGTIRLMLFFIDQLQSHFMT
                     DIIDVQHKRLLEQLGLETVLPAPVLGGSLRGSSLRGSISVRQTPTATKIRTAIPTPVT
                     ESGERREAGSPFSDTYSMPCDGQTLRSNRVPPTPNKAQGVYLDFLTLRQLHTLHLSFL
                     REGLLIADFNLATVIRDILDTCRRFTGLVERWGGDVLPELLMEGINGEEVGKMVKERA
                     QAVQQINDRLHELLTDFFGALLDTQNPGAADPDKSVADGGGSLSRTMRAAQISRMMSR
                     QANFTAAAMNAKKSAKSKMQMDKEERELEADTLMARHIEQLLLRLDFNGVLTAWRLKE
                     VDGDYSGGSVLIGRGL"
     gene            complement(485060..487718)
                     /locus_tag="CNE01770"
                     /db_xref="GeneID:3257695"
     mRNA            complement(join(485060..485164,485215..485363,
                     485411..486037,486089..486397,486456..486636,
                     486690..486794,486844..486921,486972..487111,
                     487179..487290,487336..487416,487467..487718))
                     /locus_tag="CNE01770"
                     /product="ATP binding protein, putative"
                     /transcript_id="XM_570800.2"
                     /db_xref="GeneID:3257695"
     CDS             complement(join(485111..485164,485215..485363,
                     485411..486037,486089..486397,486456..486636,
                     486690..486794,486844..486921,486972..487111,
                     487179..487290,487336..487416,487467..487649))
                     /locus_tag="CNE01770"
                     /codon_start=1
                     /product="ATP binding protein, putative"
                     /protein_id="XP_570800.1"
                     /db_xref="GeneID:3257695"
                     /translation="MTTPAPSGPSRLPPHLADHLPPPSTSGDSESSAQQPAAGNGLET
                     GLLKELARTSLIESLNNVQGAKTLILDPVLAGPLGLVTEVALLKHQAVDKMFWLERGP
                     LNVNTRNVVWLCRPKMEFMNIIAEQIRSQQQNPSAAGPLTYTILLVPRVTELCKKVLE
                     DQGVAGDVTLSEFNLGFIPMEDDLLSLEMEDVARDIYLNGDDTPIHSSSLALMTFQRA
                     FGVFPRILGKGDGAKKLTDLLQRHRSSDPSQYSEIEPAEKVDGLIIIDRSVDWVTPMC
                     TQLTYEGMLDEFMGIKNSHIEVDPSLLDPNPTGTNSPPSTALPSATVTKKRKHHLTSQ
                     KDALFQDIRDRNFAVVGSRLSKLAKRLQDDRGVVKNLRSVTQMKEFVGKIGGMKGDQQ
                     ALKLHTELTEALMRITQTEEFNKNLEAQQNLVAGYDTSTQLSNIEDLMYQQIPWQTVL
                     RSVILMSLTTGGIKPKNLEVFKRDFLQVYGYHHLPLLINLQSLNLLVRSPSLTSQNFP
                     ALRKSLRLLVDDINDAVPNDISYVYSGYAPLSIRLVQCVTQKNVILSGPTEEGPGRQV
                     LPKAHRISGWKGFEDVLAGIPGSTVDVKQKVERVRSDMAGHNGEQFTTTVVFFLGGCT
                     YTEISALRWMSNQTTGRRFLVATTGIINGNSLIEGFGDKMPVPLRSQD"
     gene            488088..489726
                     /locus_tag="CNE01780"
                     /db_xref="GeneID:3257667"
     mRNA            join(488088..488249,488305..488475,488535..488617,
                     488671..488778,488837..488972,489052..489229,
                     489440..489726)
                     /locus_tag="CNE01780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570803.2"
                     /db_xref="GeneID:3257667"
     CDS             join(488127..488249,488305..488475,488535..488617,
                     488671..488778,488837..488972,489052..489229,
                     489440..489573)
                     /locus_tag="CNE01780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570803.1"
                     /db_xref="GeneID:3257667"
                     /translation="MVAITVSASGKPTINLDFANKHPRDVTVKELKAAIQAKFPKLVA
                     NRQRVTVPNIVGKPTPLTDESKTLADYGVGEGAKLKLKDLGKQVGYRVLYLWEYVGPI
                     FLNPLFLYYSHLIWGQYDPSPLQLTVRNLLVIHFIKRFLESAFVHSFSRATVPLSFVF
                     RNCLYYWGICGFLIGLTLYRPAYSKQALDGTLLGDSRWINFWTVFELVAELLNLNAHL
                     HLRSLRQPPGHPRKFPTGLGFGIAVCANYWFEILGVIALVAMTGGDIGTVIYLCIGTF
                     FMKTWADGKYTRYKREFDNKIFPGKRYRLFPPIY"
     gene            complement(489678..491155)
                     /locus_tag="CNE01790"
                     /db_xref="GeneID:3257585"
     mRNA            complement(join(489678..490489,490555..490814,
                     490872..490988,491061..491155))
                     /locus_tag="CNE01790"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_570805.2"
                     /db_xref="GeneID:3257585"
     CDS             complement(join(489813..490489,490555..490814,
                     490872..490988,491061..491077))
                     /locus_tag="CNE01790"
                     /codon_start=1
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /protein_id="XP_570805.1"
                     /db_xref="GeneID:3257585"
                     /translation="MQGFNRYVPPDYDPKKASTLNLHQGKKHALGKRAKDIDKGILVV
                     RFELPFNIWCGTCGAHIGAGVRYNAQKRKVGNYYSTPIFAFRCKCHLCSGWFEIRTDP
                     KNAAYIVEEGAKKKDEDWDPEEHGGFRIHDTEAPSASETATADPIAHLEKTIDQQEWA
                     KKGTSRLTELSRQSARLSADPYAVSAALRRKFREEKKVMLEKQDRDDAVKERYGLGED
                     VDLGDEAVEGGREEWKAGRTEKGLHIPGSSTSSVKGVDRSIGKQRGIGKRRLSDSPAH
                     LAEVLRKSTAKKYNPFDFPVAGFGSPSSPSALLEGLGTRGRMKEMAIPRRKKSVEGRA
                     VNLAEDNSGNASFGLLSGYESD"
     gene            491458..493838
                     /locus_tag="CNE01800"
                     /pseudo
                     /db_xref="GeneID:3257719"
     gene            complement(493846..496359)
                     /locus_tag="CNE01810"
                     /db_xref="GeneID:3257602"
     mRNA            complement(join(493846..494447,494508..494948,
                     495003..495009,495085..495098,495152..495271,
                     495324..495473,495533..495803,495887..496359))
                     /locus_tag="CNE01810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657197.1"
                     /db_xref="GeneID:3257602"
     CDS             complement(join(493968..494447,494508..494948,
                     495003..495009,495085..495098,495152..495271,
                     495324..495473,495533..495803,495887..496233))
                     /locus_tag="CNE01810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512848.1"
                     /db_xref="GeneID:3257602"
                     /translation="MPGDSSWALPIFARPFRPHPLDTWATEEEATQTSSPIAPSHLER
                     KVDEEPEDDDDDCESENREELQEAKADDGPESVEWKSKWIPKVSKKSTVDQLREALEQ
                     MGLNTKGKKETLIRRAQNAIHAANLSVALESQASTPSGDGDNPWDCGDFPPDSVLAAH
                     FVAKEKRRQEREEMKILGQRYRSFLCFDVEATCRGGKEFDYPNEIIEFPVVLVRWGEP
                     NEEGKRVLEKIDSFRSYVRPTWRPILTDFCKSLTGIQQETVDKSPIFPEVLKQLEGWL
                     DKWDLRGDKGLKDALWVTDGPWDLRDFVPKQLHITPPNPFPNYFHGPYLNIKHAVQSV
                     MSEINRRRVYAAAHPDNAANERATQPITTSRRAGKWRPGQGAEPLGGVSRRGPREATP
                     PPAQGVTSPATVMVDRAPLPTPPRTSVRKEGDYYLNIAGMCEALGLGEFEGRQHSGLD
                     DATNISRILIALSRWNVIFEPNGVIQPMGSGKRYPWMGESGKVVWEEWMSSQRPQDDP
                     AKREAEEKKKQKDSKAQDALTEEFEPSVPAEEDPAIRHPEDGTAEPWEEGCGEYYEGF
                     QEEESTTIDEGPQNSLDFVPRILQRKHRVLMRNNAQNQQVSIP"
     gene            complement(496548..498057)
                     /locus_tag="CNE01820"
                     /db_xref="GeneID:3257582"
     mRNA            complement(join(496548..497058,497120..497200,
                     497253..497480,497620..497742,497797..497801,
                     497875..497909,497955..498057))
                     /locus_tag="CNE01820"
                     /product="ras-related protein ypt3 (rab), putative"
                     /transcript_id="XM_024657198.1"
                     /db_xref="GeneID:3257582"
     CDS             complement(join(496925..497058,497120..497200,
                     497253..497480,497620..497742,497797..497801,
                     497875..497909,497955..497990))
                     /locus_tag="CNE01820"
                     /codon_start=1
                     /product="ras-related protein ypt3 (rab), putative"
                     /protein_id="XP_024512849.1"
                     /db_xref="GeneID:3257582"
                     /translation="MTDGSNYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIG
                     VEFATRSINVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHQTYENVT
                     RWLKELRDHADANIVIMLVGNKSDLKHLRAVSTDEAKQFATENGLSFIETSALDASNV
                     ESAFQNILTDIYRIVSSKSLESSGDVIKPSGGETILVAPTADDGGAKSGSKCC"
     gene            complement(498125..502726)
                     /locus_tag="CNE01830"
                     /db_xref="GeneID:3257776"
     mRNA            complement(join(498125..498531,498585..498897,
                     498951..499084,499144..499265,499318..499401,
                     499451..499601,499656..499765,499828..499897,
                     499958..500217,500268..501412,501472..502313,
                     502365..502522,502577..502726))
                     /locus_tag="CNE01830"
                     /product="4-aminobutyrate aminotransferase, putative"
                     /transcript_id="XM_024657199.1"
                     /db_xref="GeneID:3257776"
     mRNA            complement(join(498125..498531,498585..498897,
                     498951..499084,499144..499265,499318..499401,
                     499451..499601,499656..499765,499828..499897,
                     499958..500252))
                     /locus_tag="CNE01830"
                     /product="4-aminobutyrate aminotransferase, putative"
                     /transcript_id="XM_570811.2"
                     /db_xref="GeneID:3257776"
     CDS             complement(join(498169..498531,498585..498897,
                     498951..499084,499144..499265,499318..499401,
                     499451..499601,499656..499765,499828..499897,
                     499958..500116))
                     /locus_tag="CNE01830"
                     /codon_start=1
                     /product="4-aminobutyrate aminotransferase, putative"
                     /protein_id="XP_024512851.1"
                     /db_xref="GeneID:3257776"
                     /translation="MLTRSARALPFSRPLLRRALGARGFSTSDLIPDEPTGPKIVTDN
                     VPGPKGIAASKEIDTFQDPRTHVVVPNYELSKGNYLVDADGNILLDVFAQISSIALGY
                     NVPALLELGKTDQFVKAALNRPAIGSFPPVQWAEWIKTGLLTVAPKGLDQLVTTLCGS
                     SANETAFKCAFMAYRQRERGAIDAPFSKEEMESCMLNHSPGSPELSVLSFKSGFHGRL
                     FGSLSATRSKAIHKIDIPAFDWPSAPFPSLKYPLEEHIAENEAEEKRCLEEYERILID
                     SKSTSPVAAVIIEPILSEGGDKHASPEFFRSLRLIARKHGAFFIVDEVQTGVGATGTF
                     WAHEKWGLKEGEEPDFVTFSKKMQAAGVFHKKETRPNAPYRNYNTWMGDPIRALQARK
                     MIQLIAENNLVSHTAATGGLLASSLSSVFASPAAAGKVFNFRGQGEGTYLAWDMASPQ
                     MRDAFLGKMRKAGVQIGGCGDATVRLRPMLTFGKKHVEVLSGAVEDVLQSL"
     CDS             complement(join(498169..498531,498585..498897,
                     498951..499084,499144..499265,499318..499401,
                     499451..499601,499656..499765,499828..499897,
                     499958..500116))
                     /locus_tag="CNE01830"
                     /codon_start=1
                     /product="4-aminobutyrate aminotransferase, putative"
                     /protein_id="XP_570811.1"
                     /db_xref="GeneID:3257776"
                     /translation="MLTRSARALPFSRPLLRRALGARGFSTSDLIPDEPTGPKIVTDN
                     VPGPKGIAASKEIDTFQDPRTHVVVPNYELSKGNYLVDADGNILLDVFAQISSIALGY
                     NVPALLELGKTDQFVKAALNRPAIGSFPPVQWAEWIKTGLLTVAPKGLDQLVTTLCGS
                     SANETAFKCAFMAYRQRERGAIDAPFSKEEMESCMLNHSPGSPELSVLSFKSGFHGRL
                     FGSLSATRSKAIHKIDIPAFDWPSAPFPSLKYPLEEHIAENEAEEKRCLEEYERILID
                     SKSTSPVAAVIIEPILSEGGDKHASPEFFRSLRLIARKHGAFFIVDEVQTGVGATGTF
                     WAHEKWGLKEGEEPDFVTFSKKMQAAGVFHKKETRPNAPYRNYNTWMGDPIRALQARK
                     MIQLIAENNLVSHTAATGGLLASSLSSVFASPAAAGKVFNFRGQGEGTYLAWDMASPQ
                     MRDAFLGKMRKAGVQIGGCGDATVRLRPMLTFGKKHVEVLSGAVEDVLQSL"
     gene            500264..502811
                     /locus_tag="CNE01840"
                     /db_xref="GeneID:3258003"
     mRNA            join(500264..500929,501000..501256,501315..501445,
                     501508..501798,501851..501962,502015..502323,
                     502379..502533,502593..502811)
                     /locus_tag="CNE01840"
                     /product="general amidase, putative"
                     /transcript_id="XM_570813.2"
                     /db_xref="GeneID:3258003"
     CDS             join(500657..500929,501000..501256,501315..501445,
                     501508..501798,501851..501962,502015..502323,
                     502379..502533,502593..502720)
                     /locus_tag="CNE01840"
                     /codon_start=1
                     /product="general amidase, putative"
                     /protein_id="XP_570813.1"
                     /db_xref="GeneID:3258003"
                     /translation="MTLDVIPSWSEIAAAKVAARDALIPEKWRIPVTDALNVIDIPKT
                     CGVLSPGEIEITETPAPKLVQKILSEELSSYDVTLAFCKRAAIAQQLTNCLTEIFFEE
                     ALKAAAGIDAEYSKSKTPLGPLHGLPVSLKDNFYIEGVDTTVGFVAWANDPAKKQQES
                     EMTQVMRECGAVLFCKTNVPTAMMIAESYNNVWGYTCNPYNRTCSSGGSSGGESALLA
                     MKGSPLGVGTDIGGSIRIPASMCGLYSLKPSFGRFPTYGARSGLPGQEAIRSINGPMS
                     TALESVGMWVKAVVDNKPWDRDPNMIPIPWRDVEVPEKLCFGLIMDNGIVKPTPPVTR
                     ALLETKAALEKAGHKVIEWSPYNAEEATALGARFFTGDGGVKIAQILALSGEPYPEGL
                     AGYRKRFDAIKENPPLVGALWEMQSDRVSYCKRNLQHWLASKDVTGTGRPFDGLISPV
                     SMHSACPKMAFNDHVTYTLMWNIMDYSATTFPVSFVDSQLDKKPAYEPRNETEKKIWD
                     RYDSTEVVGAPVSLQLVCQRLEEEKALKLTEVIAKALVEAGAK"
     gene            complement(503249..505861)
                     /locus_tag="CNE01850"
                     /db_xref="GeneID:3257714"
     mRNA            complement(join(503249..503481,503555..503609,
                     503666..503711,503748..503916,503983..504058,
                     504122..504168,504239..505047,505120..505861))
                     /locus_tag="CNE01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_570815.1"
                     /db_xref="GeneID:3257714"
     CDS             complement(join(504493..505047,505120..505848))
                     /locus_tag="CNE01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570815.1"
                     /db_xref="GeneID:3257714"
                     /translation="MILRQTIQLTMNSTDTSSRKQKSTPSRKKSCLQCAKSKIRCGLE
                     RPACVRCVAAKRECRYAVPPEGPPSNVGSRQSVPPVQSVATPESLSNSLTDHTDIALV
                     GTTLGSQSTPLPSTTQLRTSGNHTDASLDFSNLDLVPLADAEQIRVRWLRPFLAVREQ
                     VPKVFHPYTLQFISCVLRTYPKQMIEENGVPPIIHPMQMADGCTSVALANCYSLIRLW
                     QHRAPGSEGIVAETIQREMNRLAHYDSNAGDLDTLAAFQAYLIYSIGTYFFPIQGNPL
                     VDDATMFTLQEMAFRTAQSGLVSQAEFGRSRPKWESWIVVSAKRRAIFAFYLLSNVYN
                     ADNYVPNFLAEELKEVYAPDAKRLWEARSRIDWEHEYSQYLSQWEDGQLRISELWRSP
                     DTGSAERRGRIDRWVQSADEFGMMLFAVCAHLHGY"
     gene            506036..508473
                     /locus_tag="CNE01860"
                     /db_xref="GeneID:3257728"
     mRNA            join(506036..506530,506612..506878,506943..506962,
                     507029..507360,507416..507457,507525..507720,
                     507780..508050,508104..508473)
                     /locus_tag="CNE01860"
                     /product="SCR1 protein, putative"
                     /transcript_id="XM_570817.2"
                     /db_xref="GeneID:3257728"
     CDS             join(506159..506530,506612..506878,506943..506962,
                     507029..507360,507416..507457,507525..507720,
                     507780..508050,508104..508145)
                     /locus_tag="CNE01860"
                     /codon_start=1
                     /product="SCR1 protein, putative"
                     /protein_id="XP_570817.1"
                     /db_xref="GeneID:3257728"
                     /translation="MDILLRESLFGRILNSLTNERIFPHPQDLTWGKGVVCGPCSDPR
                     QQAALDFTGPDDPEAPRNWPTLTKSFVMADIMFLNFSFYAASAIFTPSIPLIEEKFGA
                     NASKGTLGLSLFVIAYGIGPLILSPLSNLPSIGRTPVYVAGSLAFCLVNIGTALAKDI
                     TTILVLRFIGGFVGSAPISIGGATLMEVYGPTEVPYAIAFYAVSGLCGPILGPTFGTL
                     AVTRWNTWAATLWLLAGITAFTTVFIFFFLPETLSFNILRRRARRLRVQCDRPHDQYP
                     AEPDAKARNFFLDIVYQTVDDFKLSCMDPVILFVNVHTMLIYGVLYLWFEFFPFVFGE
                     IYCFSAIQQALAFFGILAGAVISVTVYLLWLYFFYQPRVADSEVIVQPEDRLRPGQIG
                     AICIPICLFIFAWTSRESVHWIAPIIGTAFFAPGFYLSFQSVLNYLGESYPRHVASIF
                     AGNTFFRSSFGGALPLAASRMLQSLSIGWASSTLGFISIAMVPLPFILERYGERLRSW
                     SKYAN"
     gene            508590..510753
                     /locus_tag="CNE01870"
                     /db_xref="GeneID:3257804"
     mRNA            join(508590..509787,509844..509900,509955..510003,
                     510086..510183,510239..510753)
                     /locus_tag="CNE01870"
                     /product="expressed protein"
                     /transcript_id="XM_571223.2"
                     /db_xref="GeneID:3257804"
     CDS             508873..509643
                     /locus_tag="CNE01870"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571223.1"
                     /db_xref="GeneID:3257804"
                     /translation="MVSHTIPNPGNAPNVSHDAREAYETLKSGGVIIAPTDVGYALMT
                     STQAGIQRIFAAKDRRQGHNIGIIGTYRQHREIHVLPESKFELTRVLTEDMGMIVGII
                     AKFDPQNLHPRLAALDRATLSQVTKGDMVSIAIPEGPFLRELGRLCDTDPQGLLMFGT
                     SANLTGQGQRFRIEDIEPAVLAHVDLVVDYGLQKWHIYGRGGVNFDAENMKVLRMGAG
                     YEIFRDRILRWFPQLLKESGVGLEEDPEHGIRESHVGE"
     gene            511350..513958
                     /locus_tag="CNE01880"
                     /db_xref="GeneID:3258011"
     mRNA            join(511350..511922,511976..511987,512050..512078,
                     512130..512160,512216..512377,512425..512504,
                     512558..512611,512660..512798,512849..512899,
                     512953..513183,513236..513529,513578..513958)
                     /locus_tag="CNE01880"
                     /product="transmembrane transporter Liz1p, putative"
                     /transcript_id="XM_570819.2"
                     /db_xref="GeneID:3258011"
     CDS             join(511793..511922,511976..511987,512050..512078,
                     512130..512160,512216..512377,512425..512504,
                     512558..512611,512660..512798,512849..512899,
                     512953..513183,513236..513529,513578..513846)
                     /locus_tag="CNE01880"
                     /codon_start=1
                     /product="transmembrane transporter Liz1p, putative"
                     /protein_id="XP_570819.1"
                     /db_xref="GeneID:3258011"
                     /translation="MSSLSKFQVKLETIFWGKPPADPKERKLLLKLDLVILTYVCLSY
                     FCNYLDRANLANAYTTGMREDVGFKGNDYTYANSMFTAGYIIGQWPSALILSSGRISP
                     RFWFPFCMLAWGLCTLGLTWVKTPHQVWGIRFVQALFEASTFSGTHYILGSWYKNGEL
                     GKRSAVFATAAQCGTLFSGIMQGAIMTNLDGKNGFKGWQWLYIIDFIITIPIAIYGFL
                     MFPGTPQTTKAFWLTEEERELCVQRLPPAEHHKMTLKSLGKSVKRLVTTWRWYLFTLL
                     FTVSATAFEKVGVYTEFNLWLKAAGYNASQISYYPSIFTATAIVSTYFLTVISDVTRN
                     RFVINPIMYLAVFISSVMLLNWDHLNKGAHWFAYIIGGFGYAGQASNFAWANEMCRDD
                     DVVRSLTLFSMNLFSSVWNLWYQIVAWPVVEAPRFRNGQIATLVTGAASVGIAVTIVY
                     CSKKWPPAIANAELDHERESVAEGEKSTSKDEEAGVSVEGVAH"
     gene            complement(514236..514325)
                     /locus_tag="CNE01890"
                     /db_xref="GeneID:3257493"
     tRNA            complement(514236..514325)
                     /locus_tag="CNE01890"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:3257493"
     gene            514485..515701
                     /locus_tag="CNE01900"
                     /db_xref="GeneID:3257483"
     mRNA            join(514485..514735,514801..514875,514934..515384,
                     515447..515701)
                     /locus_tag="CNE01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657200.1"
                     /db_xref="GeneID:3257483"
     CDS             join(514686..514735,514801..514875,514934..515384,
                     515447..515608)
                     /locus_tag="CNE01900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512854.1"
                     /db_xref="GeneID:3257483"
                     /translation="MATNPDNRSLPDGWVQQFNNDHQAWFYVNTKAPGGPSSQWTHPA
                     DDLPKYAPPPGNPPSKTSTPFAPADDKSYGVSDPYYQSSTPQPTDRQQTPYQSTSQSA
                     SPGPQSQQGKKRGIGGLFSKFSGNNKPSGYQQGYGQAYPQQQQQYGAYPQQQQYGAYP
                     QQQYGYAQQPMYQQQPMYAQRPQRSGMGAGGAAALGVGGGLLGGMLIGNMISDSQHDA
                     YMDGYQDGDMGGDMGGDMGGGDFGGDF"
     gene            516180..518352
                     /locus_tag="CNE01910"
                     /db_xref="GeneID:3257941"
     mRNA            join(516180..516220,516331..516370,516500..516574,
                     516629..518352)
                     /locus_tag="CNE01910"
                     /product="ribosomal protein, putative"
                     /transcript_id="XM_570824.2"
                     /db_xref="GeneID:3257941"
     CDS             join(516196..516220,516331..516370,516500..516574,
                     516629..516812)
                     /locus_tag="CNE01910"
                     /codon_start=1
                     /product="ribosomal protein, putative"
                     /protein_id="XP_570824.1"
                     /db_xref="GeneID:3257941"
                     /translation="MPPQVKTKAQKAAAAMAGSKAGKKKKWSKGKVKDKANNAVIVDK
                     AVYDRIIKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGLIKRVVHHHAQLIYT
                     RATAA"
     gene            complement(516864..518380)
                     /locus_tag="CNE01920"
                     /db_xref="GeneID:3257603"
     mRNA            complement(join(516864..517098,517147..517270,
                     517323..517408,517463..517663,517717..517779,
                     517838..517978,518059..518200,518250..518380))
                     /locus_tag="CNE01920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657201.1"
                     /db_xref="GeneID:3257603"
     CDS             complement(join(516923..517098,517147..517270,
                     517323..517408,517463..517663,517717..517779,
                     517838..517978,518059..518200,518250..518351))
                     /locus_tag="CNE01920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512856.1"
                     /db_xref="GeneID:3257603"
                     /translation="MQRPLLPFASLRPLLRPQRTLHVSARVRSHENPLGIPKRNPNPP
                     PTIPRRGAPPQKSKIRGVKQVVVVASGKGGVGKSTVAANLALSLLNTSPSDRAPKVGL
                     LDLDIFGPSVPKLMGLENAGDPRLSDENKLLPLQNHGVKTMSIGYLLPPNPENDSPVV
                     WRGMMVMKAVQQLLFDVDWTSPNVNGSKEDLDVLVIDMPPGTGDVQLSLGQLVVVDGA
                     VIVSTPQDVALIDARKGVGMFNKVSIPIIGLLLNMSHFTCTSCTTPHELFGSSAKFEK
                     AAKDLNLDVLGKLPLVTSVSDGGDAGRPVMVQAGKEGEEVRQTMRQVGNKVWEWLARH
                     KLNSNIGTRG"
     gene            518468..521098
                     /locus_tag="CNE01930"
                     /db_xref="GeneID:3257702"
     mRNA            join(518468..518895,518954..519888,519941..520357,
                     520408..520643,520699..521098)
                     /locus_tag="CNE01930"
                     /product="mitogen-activated protein kinase kinase,
                     putative"
                     /transcript_id="XM_570828.2"
                     /db_xref="GeneID:3257702"
     CDS             join(518751..518895,518954..519888,519941..520357,
                     520408..520643,520699..520831)
                     /locus_tag="CNE01930"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase,
                     putative"
                     /protein_id="XP_570828.1"
                     /db_xref="GeneID:3257702"
                     /translation="MDNTVAPSKGKKPGGARPNPGTRPESGGPARPTGAGGVPKLSIP
                     PDNVPGMHVDQAGQGGWHQPASLPSLALRPMRPSPTPSSSSRPKLSLTPLTPTIPASS
                     SSAPSSASPAPPNRPALLNAHSARGYGERNTPSLKLSIPGASSVGPGFSTEHDYPLEL
                     PDDTDALSSELKTPTPGRPAGGGLNLSLSSLSLTSSEDANPTLQARGRDYDEGESSYG
                     YGCVGNGLIGPGGDAISAMTEDIRQALSRNRFETGSDRGGARSRAGSLMSDSSRATAG
                     RDRSDSASLYNAASRRESPSASLSGGSARQSLDLPRAAEEVNEQKESPVFDPEGLVMM
                     RRLGEGTGGSVDMVQDRATGRIMAKKVITRTSNPMVHKQLLRELEILNSCASPFIVEH
                     YGSFLADHDSSIGILMEYCEAGSLDSLLGKMKKKSMRCSEHVLGRVASSVLKGLDYLH
                     QRRIVHRDIKPSNILITRQGAVKLCDFGVSGELVESLAGTFTGTSFYMAPERIQNKPY
                     SIKADVWSLGMTLHEIAHLRFPFPPEGENQSVAPIELLSYIVTAPVPVMIDDLSVGRV
                     WSEPIKDFMGQCLIRSGTDRPYPWQLLQHPFIVASEAKKVNMAKWVAALCNWPLS"
     gene            complement(521036..522240)
                     /locus_tag="CNE01940"
                     /db_xref="GeneID:3257712"
     mRNA            complement(join(521036..521503,521565..521708,
                     521763..522240))
                     /locus_tag="CNE01940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570830.2"
                     /db_xref="GeneID:3257712"
     CDS             complement(join(521215..521503,521565..521708,
                     521763..522196))
                     /locus_tag="CNE01940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570830.1"
                     /db_xref="GeneID:3257712"
                     /translation="MAPALPLPEYFTLLIYLAILLIAAFTSLPHSTSYFLSAPLAQSS
                     SADRPEHPFLTPITSRPLITMAWDVIGVGMIMFWWGGKMKGWWEGKSVAKKEEIVGES
                     DMEERTRRTTKMFARFKEAGMATAGMALVYYLFLFLMGAPLNSYFSHSLLLALHLSIL
                     TVWTPVYTLGIPSMYDQGIYARFRMTRLFCQFQPENPIERALVYPVIGTFVGAWIGAI
                     PIALDWDRPWQSYPLTVAFASILGFIVGGFASWTHSVGEDMYKEVSAGGNIKENEKAG
                     KKKNKKKKSIAA"
     gene            522414..524292
                     /locus_tag="CNE01950"
                     /db_xref="GeneID:3257535"
     mRNA            join(522414..522568,522625..522671,522725..522895,
                     522953..522978,523032..523068,523119..523183,
                     523239..523505,523562..523961,524014..524292)
                     /locus_tag="CNE01950"
                     /product="UDP-N-acetylglucosamine transporter, putative"
                     /transcript_id="XM_570834.1"
                     /db_xref="GeneID:3257535"
     CDS             join(522477..522568,522625..522671,522725..522895,
                     522953..522978,523032..523068,523119..523183,
                     523239..523505,523562..523961,524014..524261)
                     /locus_tag="CNE01950"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transporter, putative"
                     /protein_id="XP_570834.1"
                     /db_xref="GeneID:3257535"
                     /translation="MKDPGLISSFLQTTAGEWFMILSLVFGGCCSNVWALEGVLKDHP
                     KSGTFLTFSQFVFVALQNLSSQVELARSRSGILYPKLKTRNVPLKRWIIQVILFFAVS
                     LMNNYAFGLKIPVTIHIIFRSGGLCVSMVVGRVIGKRRYSIAQMLAGLLITIGIVIAT
                     LSAPHRQPSRSSGTVSASTTESVVRPTSWMAHERDYLAGIAILAAALFLSALLGLYQE
                     HTYRMYGKQWKEALFYGHFLSLPLFTPFYSDLIQTYNAYTSSPSLTLLSIPRPSASLF
                     PALFTENPTSFSSAKYFDWHELLIPSAMFALALNLITQGLCVRGVNRLTTRVNSVTVN
                     LVLTVRKAVSLAISVWYYGSGLTWSLVVGGAMVLLGTILYSLAPGPKGLGPSASDKDK
                     TPTIKTSSRPRPIIVEQKEGDGGNGSNQQSDPLVSAGLRYRQSPMEGSVMEKSATKSR
                     "
     STS             522766..522970
                     /locus_tag="CNE01950"
                     /standard_name="AC8"
                     /db_xref="UniSTS:470796"
     gene            complement(524358..525927)
                     /locus_tag="CNE01960"
                     /db_xref="GeneID:3257774"
     mRNA            complement(join(524358..524462,524528..524740,
                     524817..525688,525738..525927))
                     /locus_tag="CNE01960"
                     /product="ribosomal protein L2, putative"
                     /transcript_id="XM_570836.2"
                     /db_xref="GeneID:3257774"
     CDS             complement(join(524414..524462,524528..524740,
                     524817..525688,525738..525824))
                     /locus_tag="CNE01960"
                     /codon_start=1
                     /product="ribosomal protein L2, putative"
                     /protein_id="XP_570836.2"
                     /db_xref="GeneID:3257774"
                     /translation="MMFGGPPPTKKDEGAILKRYTGPGFPFIPSLRHVVYPFHPHLHK
                     GGPVKELTVPLRRKGGRGNDTGQIVTRHRGGGHKRRIRIVDFHRRASGEHRVIRIEYD
                     PGRSAHIALIRKQGSTSTLSAEQAEESLAEGGHDNEAVKGGWSYIIAPLGLRAGDVVV
                     SYRSGIPEKLIQQCDMTSSMYGSTLPSGETDAVSPPRKSRATDTPEMRRALGMLRTVT
                     LKPGNVLPLYLIPPGMQVHNISLTVDGRMQLCRSAGTFGQVVSHQGSDGRSIGGSDVL
                     TMGGGFDEEGNRVPKKGFVLVKLQSGEVRKLDPGCVATIGVVSNKEHQFRQLGKAGRN
                     RWLGRRPHVRGAAMNSVDHAHGGGRGKSKGNKHPRSIYGTLQHVRTRRPKDKDGNKAV
                     VTERPRGKQTAAKH"
     gene            526134..530201
                     /locus_tag="CNE01970"
                     /db_xref="GeneID:3257747"
     mRNA            join(526134..526670,526722..527111,527185..527407,
                     527466..527579,527649..527833,527899..528166,
                     528220..528285,528372..528507,528588..528738,
                     528806..529045,529115..529238,529295..529440,
                     529500..529561,529628..529852,529913..529975,
                     530032..530201)
                     /locus_tag="CNE01970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657202.1"
                     /db_xref="GeneID:3257747"
     CDS             join(526576..526670,526722..527111,527185..527407,
                     527466..527579,527649..527833,527899..528166,
                     528220..528285,528372..528507,528588..528738,
                     528806..529045,529115..529238,529295..529440,
                     529500..529561,529628..529852,529913..529975,
                     530032..530060)
                     /locus_tag="CNE01970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512860.1"
                     /db_xref="GeneID:3257747"
                     /translation="MAIVLATAHSGSIALPHILLILSAGAMILYLQPLKSLLTTLVPL
                     SRSSLGYALVFLSSIALTLGLWPALHIPLRFMYNCFFKPFLHRGSRDQKDHLEAFYAG
                     QADLYDTTRSQLLKGRETMLQLLAAHLKAQPMVRLPVSAPSKPRIWVDLGGGTGWNIE
                     KMDEYLPLTYFDAIYIIDLCEPLLEVARARIKARGWKNVHVLCQDASRFVLPEWESGA
                     VDPRGSLTAITMSYSLSMIPPFYQVLDRCDQVLDTQRGLMAVVDFYTSREVGNKERAI
                     GTASKRVSWFSKWFWECWFDLDGVHLHGSRREYLEYKMGTIKTYNARNNFLNTWFIQI
                     PYYVFLGCSRQRDASASAKSFTLEAGNRLGQSDLGLLTPTSPFTNSPSVFGSPSPMLE
                     MPELVLGPSAAQATQTIFEVGAPLSPFHYHLRKAWRIPYLEEKIHEQFRTHIYGWTWE
                     DPAVDVKKLNINKDDHILAITSAGDNVLHYALTAKPARIHAVDMNPCQGHILELKLAA
                     IQALEYNDFWLIFGEGRHPEFDKLLTTKLSPFLSSHAYAYWKTHTSQFSRNFYFRGYS
                     GWALRLAQIAFFIAGVRGDVKRLCQATSTAEQERIWQKKIRPVFLNKVMVKLFLGNPL
                     FNWHALGVPQNQMNCFLQDGSVEDYVKATLDPIPTLSTLKDDNYFFLLCLNGRYTRTS
                     CPAFLKPEGFKALKNSKSTDAFKLHTDTILNVLRGLPDESLTKIIVMDSMDWFDPIPP
                     GTPLPQGNSTALDTLQATPEKALEHLRAELDYEILEMKRVLKVGGIAVWRSAAKRPWY
                     RQRFEAAGLKVQPIDIRENQEAIDRVNMYASFWKAVKVME"
     STS             529975..530775
                     /standard_name="Hind27"
                     /db_xref="UniSTS:470797"
     gene            complement(530077..534671)
                     /locus_tag="CNE01980"
                     /db_xref="GeneID:3257506"
     mRNA            complement(join(530077..530613,530663..531287,
                     531346..531989,532072..532898,533007..533774,
                     533835..534671))
                     /locus_tag="CNE01980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657203.1"
                     /db_xref="GeneID:3257506"
     CDS             complement(join(530194..530613,530663..531287,
                     531346..531989,532072..532898,533007..533774,
                     533835..534543))
                     /locus_tag="CNE01980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512991.1"
                     /db_xref="GeneID:3257506"
                     /translation="MLAHGKRPSALVGGFETSSEEESLPDGARTSSSGTGMTTPHRPS
                     SRDVSHSDSTWRPEPPSKRSQGVVLPSSATGQVSRTSGTAREGRLDKRPKRKTSKDTA
                     DRPPSRTSRRSPSLRSHLSARSDGGHAAQNGLAARGRTASSRSQHDPAARPNRQSSMS
                     SANSKPVDRLKHGGERTSSPEGRWKDKGKGRDTTAERNVEESDRDREQQPSTADTLTE
                     SLGLTGSGPNIKDASLNTDQIHSLLSDSDLASAIRLMNDNKAISPRVPFSSCATDPYN
                     HGTTSTVDPPSHVSPYLVSAPPPLTNDSPNSHGRERSVSAVSSISPATPTTWSPHFRS
                     TFEVPDGHGLGVQRQRQRSVSRASMSAELPGGHVPFTHHLPVVPQADEEDSDDRSTQA
                     ASGTLETAQPVQQQSFLHENNNNKKKKGGNNRKGALSSLFHFGRRGSNDSNDRSPRLK
                     EKEHLWRTDRYSEEHAKDREAREREEEMRRIEWERRQEEIMQDRRYRALTQVAAHPNA
                     ERLAYRTGAHLRAYYQHVYDCIENPPRLNFPKMLRWLTETDKQNALRAQYYAASHHQG
                     DADHAHEQPNARSIGSSSRVDLSGSQRSVGSGRTHSVSSNRRSNDVSPQKRVPDLVIP
                     HRGWRYTVDDIQAFRDSGGVVNYFVPPRQVRACNDELNEEEASASPQTVANRVEHSLN
                     RTYGQRALTPQSQSKDIDRHRDDNSSAAGSSKKGHLHEFSLRTANNTASNVSLADMDQ
                     GMREANLSRSTSFDTGGDKSISGRRDHRVSHRSHQSLSAVGHSSLSHALKQPFEKLSS
                     VTKKQRTMPHFHPYGDRESGQTNDFAPSSDHPGVALSGLSPSPQRAGLVSRDSMGSVT
                     NRSSSLGHARNNVNRLKEPSFFKRHGLTGHESVTDEEGGRLKLFIKGTRKIGLDDHKK
                     RQGKDCTGDLVECRNEELKEAERIYAREQQFKNNQLQAEEEKAKVTKAEEAALTKILD
                     LEKDIYQERAQHLATAKDRLAIVNSNIHIIDESMRQYLAQIDFARDEAKISMDLETDW
                     SMVEPLYTKYNRRRSVESDELRDTVPPLRSFGSGDSNSDGGRSQSGPVARRNRFQTSS
                     RSGSGPMPKRTLSLQNSIALHHIDPLQARHHPRRTYLAPDGLTRVDPVRHAELMIAFG
                     KKREEEVGKEKEDMAKEMEKMIGQIEAMIRQKEEVRHWVADVLERVGNAKTQLERFRS
                     QENSFLDIVHFAEQRDRLVDSITKGLGFTIRVAWYVFQWIKVPCKIIKMFFHPIWFIA
                     TLIFSVLSLPWTALKQVTGRDSPNSIDASEDPAVGRQRRRRGISVMWLTGSALSCVIA
                     MFFWYYGTDG"
     gene            complement(535095..538894)
                     /locus_tag="CNE01990"
                     /db_xref="GeneID:3257997"
     mRNA            complement(join(535095..535620,535673..536042,
                     536106..536540,536589..537124,537343..537403,
                     537504..538089,538147..538894))
                     /locus_tag="CNE01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657204.1"
                     /db_xref="GeneID:3257997"
     CDS             complement(join(535494..535620,535673..536042,
                     536106..536540,536589..537124,537343..537403,
                     537504..537723))
                     /locus_tag="CNE01990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512861.1"
                     /db_xref="GeneID:3257997"
                     /translation="MYCTLATLSLLALAEAAGPHNRRLDDHRRHYARIALSGESETPP
                     LPHNLHVEVPTKRDGCTHGGWNCVGLQLQRCNWGDWIVIQNCTGENIVCSTQEDAVGC
                     VWTWFVDDSTTSQGAQGTPSATTSLVFDASSAVSASYVSATPSQGLDDGEPTGTASSY
                     YATATTSTTASDKNDQACDDDDDDDDEVCEDEDASSTASGTFNPATITSSATFSTSDA
                     QGTLTSQIGDGLLAGHKSESASSSDDWRETAGSDHKSRTKQWGSWGTSSASDGSAPTT
                     NASVSYPAATASSTTTAASSSHSAPTNLGGWSAPHYVIYADRWLSAMPDVSELSSFNR
                     FILAFWESNGGAVDDVQAWSSWDEGYRRQIIEEYHDAGIAIMIAAFGSTDQPTTSGAD
                     AKQVAQKLASFVMEYNLDGVDIDYEDMSAMNSAQAVSWIVELQMELRNLLPSPYIISH
                     APVAPWFTSANDYSDGSYVSIHQQVGDSIDFYSVQFYNQGPDQYVSCETLITDSGSEW
                     PSTSVFEINSHAGVPLDKIVIGKPLEPGSASNGYMSASDLHQCVSEAKERGWNAGVMF
                     WEWSEEAPSVMATVRG"
     STS             536268..537210
                     /standard_name="Kpn2"
                     /db_xref="UniSTS:470798"
     gene            539067..540102
                     /locus_tag="CNE02000"
                     /db_xref="GeneID:3257706"
     mRNA            join(539067..539547,539613..540102)
                     /locus_tag="CNE02000"
                     /product="expressed protein"
                     /transcript_id="XM_570842.2"
                     /db_xref="GeneID:3257706"
     CDS             join(539131..539547,539613..540068)
                     /locus_tag="CNE02000"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570842.2"
                     /db_xref="GeneID:3257706"
                     /translation="MNPSNPQTKFYSDLFRAQQSQAQFIPNSGNSNTYTYGATPLPSS
                     AGQMPMVNNPDLAMIARQGYLQQQQRLAQMGQMGVPNMMPPQGGTPQQGQPPVYMGIA
                     PEMREKQAMEAAARETMLREKAMRDAALHEAAKKRARTKPTPAQQAIARQPGAFQPPI
                     SNEQYLKSALTGPPSAPSAVPAASVPGPAAEPIEPWADPLDELDPRELAMARFRKRHE
                     VINEVFGPETVKEIVTAGDWDSWEEMEEKRLQQQVEQLEKEVEELEKTMEGNIEAFKE
                     RLEDIESGEVASNA"
     gene            complement(540118..542522)
                     /locus_tag="CNE02010"
                     /db_xref="GeneID:3257992"
     mRNA            complement(join(540118..541755,541815..542115,
                     542163..542184,542243..542522))
                     /locus_tag="CNE02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_570862.2"
                     /db_xref="GeneID:3257992"
     CDS             complement(join(540198..541755,541815..542115,
                     542163..542184,542243..542437))
                     /locus_tag="CNE02010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570862.1"
                     /db_xref="GeneID:3257992"
                     /translation="MPKRQRPPSSPGSPAKRSAATRHSIADLFPFQEIFLRILSFLSA
                     NELAKVQGVCRYWQVMSLDPQLWKRLYLDKYPHPHQSRLIQTPESPKTTPMTVTGSLR
                     PIARLPSRAFPPPSPSRTSSASTSLPTTPGKPEEVQSGNRAEAFGSLDMVGQYVRNDG
                     VDWKMMLRLGTNWSNGNVLSQATMPLPPSPSPSVHLSEGLPLFNPSSVPPRPSTQHLA
                     LFPSFIFTASPDSPLVYCYPSSASHINSPIGIIPPPPGWSSPSRPDNVTAICADQAVV
                     FPEEGDGERSLPARMAVFYQSGGFVILTVRLSSALSNRGVTWVRDAVSPGQSRPPSVR
                     RRMYGQDRGDPIVYASMYSRLLVVCSKAFHLSVFDLQSGQLPRRITTMRSDVSFHPAT
                     LTLLPSFPEGKDSGGQFVADHGTSQSFQAALTYSTPVYPSSWTIAVQEFTILLPPVSS
                     LSTPSVSRGPTYHVSPRSTAGEPIWPRKIRPAVGVKGAAKSVGTDGRWCVLAGECNKV
                     EVFSLPFSSPNSSYCDDGIIKHSQTLVTHSSVIASVALASGRCVSGCKDGKVLVWELD
                     DEEQLESSGDDDNGEERRKAGRTVGYVEVREGGRRSTWKGASGPYYSQSNKVDKEEGA
                     GHEGLPHPQSISSAARTLFLPQPPRTQNQVEERDGRKEIRCLAFDEEKIVGVVRGAKE
                     EAIKVWNFG"
     gene            542758..543561
                     /locus_tag="CNE02015"
                     /db_xref="GeneID:36392861"
     mRNA            join(542758..542969,543083..543392,543446..543561)
                     /locus_tag="CNE02015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658522.1"
                     /db_xref="GeneID:36392861"
     CDS             join(542859..542969,543083..543392,543446..543456)
                     /locus_tag="CNE02015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514372.1"
                     /db_xref="GeneID:36392861"
                     /translation="MNPGGPPLLATQLSPEVSPLYPQSVMHNNRILSSINTLSACFSG
                     LIAGILGLTNTSGFLLYLLSSVATAAAIGSLKCGFDIRRYVPDAQIQRKKQPVNRSNG
                     VKESRKYSWRGWWALMGLGQENLLGFLLFWIGSYALIHVYD"
     gene            complement(543438..544386)
                     /locus_tag="CNE02020"
                     /db_xref="GeneID:3257677"
     mRNA            complement(join(543438..543732,543798..543898,
                     543961..544386))
                     /locus_tag="CNE02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_571132.2"
                     /db_xref="GeneID:3257677"
     CDS             complement(join(543625..543732,543798..543898,
                     543961..544327))
                     /locus_tag="CNE02020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571132.1"
                     /db_xref="GeneID:3257677"
                     /translation="MALLPYSAHAFRTYMRPATLPVTRASARVFSPRRYLQNILAPTD
                     PDANSPTLIISKLTPRGFILSDNLIIPGGAILHSGKVLLWDVDPPRQPQAGEKGGLEK
                     VWDGWEKERFGALEMLVPRPEILLLGTGQRALPAPKRLREYISGLGIQLDVMDSRNAA
                     STYNLLVEEGRRVAAALCPLGPIDPRTGEPR"
     gene            545617..546429
                     /locus_tag="CNE02025"
                     /db_xref="GeneID:36392862"
     mRNA            join(545617..545789,545863..545924,546098..546429)
                     /locus_tag="CNE02025"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658523.1"
                     /db_xref="GeneID:36392862"
     CDS             join(545692..545789,545863..545924,546098..546303)
                     /locus_tag="CNE02025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514373.1"
                     /db_xref="GeneID:36392862"
                     /translation="MITHMQGHRAISKRPLYPPRPPPGIKRKLWEWKIKFDCTFALSV
                     MGPGEQMVIGATFAIIALLVLVYVYNYLPSQISHTSRRLAYYIHGDEKTAHFMEEIGR
                     NILRGWTINMNGKGDPILA"
     gene            complement(546504..550007)
                     /locus_tag="CNE02030"
                     /db_xref="GeneID:3257534"
     mRNA            complement(join(546504..547070,547141..547803,
                     547860..547872,547918..548496,548561..548703,
                     548754..548947,548998..549228,549286..549426,
                     549476..549541,549594..549749,549802..550007))
                     /locus_tag="CNE02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657205.1"
                     /db_xref="GeneID:3257534"
     gene            546854..547832
                     /locus_tag="CNE02035"
                     /db_xref="GeneID:36392863"
     mRNA            546854..547832
                     /locus_tag="CNE02035"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658524.1"
                     /db_xref="GeneID:36392863"
     CDS             547147..547710
                     /locus_tag="CNE02035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514374.1"
                     /db_xref="GeneID:36392863"
                     /translation="MDPWSVSIDTLFLVLTLLLIPSISRTPQLNITPPGDLLISPPAS
                     PLSPITPASASSSHLSVPGVGMPFVVPSIILTPDAPETYSRSRRSSIGSLTKRFGHKR
                     KSVSFSLSAIDDVLPPQTSPNKRRPPTPFVKGPTSPSPSVSSANSQPGTPIHVIAGIT
                     GEGTAQSMTHGKDVEDAMGVKKKWLMA"
     CDS             complement(join(547392..547803,547860..547872,
                     547918..548496,548561..548703,548754..548947,
                     548998..549228,549286..549426,549476..549541,
                     549594..549749,549802..549969))
                     /locus_tag="CNE02030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512960.1"
                     /db_xref="GeneID:3257534"
                     /translation="MLARSESAHSTLDFGSETTHSPLPSAEQESRWYRRDPGNSKQRW
                     TSHPYAIHSVIHQGDSLTNDLDRYDDAKFWPFVGALKPWKRPDGLDQWKWDDFEDTVA
                     FCGLNKLMIGKCADNQPWRVMLDMSFEDDTLYTLAWTYHPFTCHPLIAVAGANALIYI
                     IDIITKRCIRTLKGHGDEILCLAFAPLNPHILASTSSDRSIRIWNILGSDAPSPHPGD
                     LPSENYPMADADEGNVIVAVLAGEGKGGHRAYVVSCAFHPTKRAIATCGMDYTAKIWP
                     LPPFPDPSPVPIPTPLGYRPIIMYFPLFSTSRLHYGFLDWIEWITDDILIIRGDKVMV
                     TWQWLSYSRYFREDEYAPLSMEPASYSDYTDSGSFMVVSRVNTLTDMWFRHPHLHRGF
                     HPTSADLARFPNSNNIVTDPLLACPHQMDPREMRKHWYPEVRLYNFLMARDGRPPRPI
                     TELRPYKPEIYNISVDFEKENTEGSKMRKKSSTQQVVKRKYITFPDEGSETRSAAGSA
                     HNSLLVPWRLRPTTSPWPTKREPWLRSQYRTGICNVAISPRGARWIVGVGEGAISHCH
                     SSRIEIFFLNQRVCYRFVNSFLIRIMGLHYAISHFFFTPIASSTSFPCVMLCAVPSPV
                     MPAITWIGVPGWLFAELTLGLGLVGPLTKGVGGRRLLGDVWGGRTSSIAESEKLTDLR
                     LCPNRFVRLPIDDRLERE"
     gene            550186..552171
                     /locus_tag="CNE02040"
                     /db_xref="GeneID:3257724"
     mRNA            join(550186..550649,550704..550758,550815..550908,
                     550968..551046,551121..551176,551238..551383,
                     551433..551501,551565..552027,552079..552171)
                     /locus_tag="CNE02040"
                     /product="uracil phosphoribosyltransferase, putative"
                     /transcript_id="XM_024657206.1"
                     /db_xref="GeneID:3257724"
     CDS             join(550540..550649,550704..550758,550815..550908,
                     550968..551046,551121..551176,551238..551383,
                     551433..551501,551565..551597)
                     /locus_tag="CNE02040"
                     /codon_start=1
                     /product="uracil phosphoribosyltransferase, putative"
                     /protein_id="XP_024512869.1"
                     /db_xref="GeneID:3257724"
                     /translation="MSKVNISNHPLVLSKLTQLRLHDLPPKDFREGIRTIGSMLIYEA
                     ARDLPLRDVPDLRSPIAPFTGQTIPLRIGLSPILRAGIGLTDAALESFPEATVLHLGL
                     FRDKVSLQAIEYYSKLPSQVTADLVFLLDPLIATGGTAIAALNMLTEWGLEQSQIKVV
                     SVLGSKLGVKNVQDEFPNVEIYIAAVDDELTDKGYISPGLGDAGDKLFNTFAH"
     gene            complement(551656..554371)
                     /locus_tag="CNE02050"
                     /db_xref="GeneID:3257978"
     mRNA            complement(join(551656..551982,552045..552069,
                     552128..552238,552294..552359,552414..552526,
                     552578..552869,552918..553017,553063..553082,
                     553133..553225,553275..554100,554156..554371))
                     /locus_tag="CNE02050"
                     /product="expressed protein"
                     /transcript_id="XM_570866.2"
                     /db_xref="GeneID:3257978"
     CDS             complement(join(551783..551982,552045..552069,
                     552128..552238,552294..552359,552414..552526,
                     552578..552869,552918..553017,553063..553082,
                     553133..553225,553275..554100,554156..554334))
                     /locus_tag="CNE02050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570866.1"
                     /db_xref="GeneID:3257978"
                     /translation="MSVADTDEVDDHLLLFDFPQLTPLPDEEYPRHLEPRRPDRGYYI
                     AMCLVLMVWMITPMSCAYLLWFILLSPYPHNLTATLFAAYALTEALFAIYLSYLNSFV
                     QRPSPPSNVSDEFRTALMRRVFHSGLRYPTPPKGVLAHNDVDPAGRDAVAERAEEDYQ
                     KGFISVAELYHIRDREYEESVGLRERKRTGRMTQTERAVIDAFVEEEEGDRERMLRDQ
                     IEGNLKPTEEESGYEGIIQNGEIVKLHKWDRRAIEFRERMRTWFNHAPWESIKKLNVQ
                     VWLAWSCYGLPLEDVRANKEQSAFIDLATKLLEARTGVDFEEGFTSKVEVMRLTLDPV
                     NAKSRPLILYALSNLMNLWLREVVYPYQGMGLYREGDIDYLIRIPKDWTPDKGRKIPN
                     AMPVVYLHGLGFGLLQSHLLIKHLIQSLPTHPLLIPLSPHTSQALFHHRHLRPWTRPE
                     LVTAMKNICRQWGFWNGGDDESKAQGGEGDDREKVIGGVSMLSHSNGSVGHAWILKDC
                     PSLIRRSTFVDPVVFCLWEGDVCHSFCYRKPSTALELLLYYFIAAEVGIANYIQRNFD
                     WTENTLFIEEIPDAADPKKTAFFLGGRDIIIDAARVRKYLERHGVTSGLHWDATAGHG
                     DGLAGVARDRVVMFVGTGTTNWKNWLGTGRRRHSLGMNDLRERGGIRRDE"
     gene            complement(554694..556317)
                     /locus_tag="CNE02060"
                     /db_xref="GeneID:3257485"
     mRNA            complement(join(554694..555005,555056..555561,
                     555619..556317))
                     /locus_tag="CNE02060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571224.2"
                     /db_xref="GeneID:3257485"
     CDS             complement(join(554814..555005,555056..555561,
                     555619..556222))
                     /locus_tag="CNE02060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571224.1"
                     /db_xref="GeneID:3257485"
                     /translation="MTVSPLPFIILGGIVIASAAQTEFAHYVAAELHYDQPYFSFYLT
                     HSTFSFIFPIHLLYLSLTGSVPVIAYLSSLRHVLTEQLELASPIPTTSAGYIASWSTI
                     FPRWCRKVILLTILVTVPAISWFIAMQYSTPVDITSIYATSSFAAYGFSLLLLKEPLN
                     KVTVWSIILAFMGVLVISIDGMGEGGEEAGKRALGDSIMLFGALALGLYEVIYKLALP
                     EGHGGVSPTPSDDDYSPLPSSNAAQVASSPSAFYHRHHRTSSTPDIPLESSSPVVEEL
                     PLRRHTSISQLIIPKSGSTRRIHDQEPPVPLPPALHANFLTSCIGIATLLLLWPPIIW
                     LDWMGYEVFKWPGAGGEAVGKTWLCLEVVAWGGSLYNAGLMVLIGIWGPTTSSVANLL
                     AIGLVAIVDALWIGSLPDLQTFVGVGMICAGFGVLLWQGEG"
     gene            559402..563611
                     /locus_tag="CNE02070"
                     /db_xref="GeneID:3257971"
     mRNA            join(559402..559768,559826..561874,561922..562201,
                     562249..562316,562368..562818,562891..563611)
                     /locus_tag="CNE02070"
                     /product="cyclin binding protein, putative"
                     /transcript_id="XM_024657207.1"
                     /db_xref="GeneID:3257971"
     CDS             join(561019..561874,561922..562201,562249..562316,
                     562368..562818,562891..563440)
                     /locus_tag="CNE02070"
                     /codon_start=1
                     /product="cyclin binding protein, putative"
                     /protein_id="XP_024512872.1"
                     /db_xref="GeneID:3257971"
                     /translation="MRARSSFDSPENSRPSSSRPPSISSSGQCRASDQNLHSLDSQLS
                     SENLRLDRSRTTRADSTSTIVENEASRFDARSRTSSRARGPPNASGTPPLTASPNLAH
                     LVPSSSNHEGVDDGRGRKSHKFSLAATLRGISKDVKERVSHSRGHSKSRTRVDKHLRA
                     DSMHDSLDGSSSSMLSLPMSRAGSSSALAPSETGRGSVTHGSRHSSVRNDDFVPPHGR
                     GGAGSVRRSRSRDRDSSTVRGRDQERSRSRARGRHMGMKVLTDKLGLGEHEEQEKGED
                     VHNWKEFRKGTYNYPISFPIPVNAPPTIHAEFGSVVYRLKATIVRVGALTPNLTEDME
                     VTMIATPQEDDLEETENVIVERQWEEQMRYQITLGGKAFPIAGTIPISVRLMPLLKCK
                     IHRLTVALEEKTDYYAQERKVARHETPKRFVLLFVKQPDFKERIEPLLPIISDDPNAA
                     EQSPLAEMARQAAMNDPPSDAFDLERDPNDAMYASLMEPTGPWHLEKDLQLPDCSSKI
                     KFTTKHDQTNITVAHWLKVTIRVERGDDEALDSKGRRKQFDIIIETPIKILDCRVNHQ
                     YNSLPTYSLTQRNFHSAPGICSIHTGKAIAPIGAARPIALPPSVQASMSTATSSSMSS
                     VLPGTGSHHHHLFPHRDHRNSESQATHGVPGPALGEGEDTLLQRNIVYDRLMSGQLTE
                     TGEVPPTYGEAMADAVRERSVSRVGGTNGTLGTGGRGQSRNRGSRSRNRLRD"
     gene            complement(563577..564406)
                     /locus_tag="CNE02080"
                     /db_xref="GeneID:3257938"
     mRNA            complement(join(563577..563743,563797..563872,
                     563930..563991,564040..564150,564218..564406))
                     /locus_tag="CNE02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_570870.2"
                     /db_xref="GeneID:3257938"
     CDS             complement(join(563665..563743,563797..563872,
                     563930..563991,564040..564150,564218..564369))
                     /locus_tag="CNE02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570870.1"
                     /db_xref="GeneID:3257938"
                     /translation="MPKIVSRAIVSSSEQAALTQSARAVLRSYYCLCGDFVLVLQGKL
                     DRLPRRRTDGAYIIRSQPGSDPEKQPARKFKLNAQPAQRCLLKRKGTADLEIRQPFCC
                     ARCKTPVAYQTAPPPAGEGPFLYIIKGAVTELQGRVPADAFEGEELLPPDEAGGSKD"
     gene            complement(564639..565933)
                     /locus_tag="CNE02085"
                     /db_xref="GeneID:36392864"
     mRNA            complement(join(564639..565007,565069..565122,
                     565163..565259,565313..565933))
                     /locus_tag="CNE02085"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658525.1"
                     /db_xref="GeneID:36392864"
     CDS             complement(join(564759..565007,565069..565122,
                     565163..565259,565313..565830))
                     /locus_tag="CNE02085"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514375.1"
                     /db_xref="GeneID:36392864"
                     /translation="MYGRLNSISKPLFDLEAGSPFNPASPRSVSPTLAAKDPFHRRLF
                     SKFSADINPSSVDLVSIYMCFLTGLTASPSFAACFVWCGFQTGNAAQLGLAIAKIFTP
                     DEHKTFGFQKMDQQALTSLLTFLMGAVVGQLGNMVGGRKRIWLLGATLGQMLLMMAAA
                     LAAHFCGESGLSKSSRGDPSWVTPTGMAALGFLSAAMGLQGAVGTACQKLGTPLGTTV
                     PLTSTWIDLFNDPFLFSIKHIRTRDVRSLGCFALILGAIISRAILGAIGQALTIAVVI
                     GFRAVLAVWWFWLPDAPLSEEVIQEAAKT"
     gene            complement(567198..568736)
                     /locus_tag="CNE02090"
                     /db_xref="GeneID:3257524"
     mRNA            complement(join(567198..567553,567623..567724,
                     567778..567885,567935..568104,568155..568211,
                     568621..568736))
                     /locus_tag="CNE02090"
                     /product="DNA-binding protein hexbp, putative"
                     /transcript_id="XM_570872.1"
                     /db_xref="GeneID:3257524"
     CDS             complement(join(567422..567553,567623..567724,
                     567778..567885,567935..568104,568155..568211,
                     568621..568666))
                     /locus_tag="CNE02090"
                     /codon_start=1
                     /product="DNA-binding protein hexbp, putative"
                     /protein_id="XP_570872.1"
                     /db_xref="GeneID:3257524"
                     /translation="MFGAPRGSSCFKCGQQGHVAAACPAEAPTCYNCGLSGHLSRECP
                     QPKNKACYTCGQEGHLSSACPQGSGAGGFGGASGGGECYRCGKPGHIARMCPESGDAA
                     AGGFGGAGGYGGFGGGAGFGNKSCYTCGGVGHISRECPSGASRGFGGGGGGFGGPRKC
                     YNCGQDGHISRECPQEQGKTCYSCGQPGHIASACPGAGAEAPAA"
     gene            complement(569042..570826)
                     /locus_tag="CNE02100"
                     /db_xref="GeneID:3257897"
     mRNA            complement(join(569042..569128,569194..569267,
                     569322..569378,569428..569510,569567..569627,
                     569682..569711,569775..569789,569859..569872,
                     569944..569980,570044..570051,570153..570260,
                     570374..570411,570473..570487,570551..570826))
                     /locus_tag="CNE02100"
                     /product="uracil phosphoribosyltransferase 1, putative"
                     /transcript_id="XM_570874.2"
                     /db_xref="GeneID:3257897"
     CDS             complement(join(569116..569128,569194..569267,
                     569322..569378,569428..569510,569567..569627,
                     569682..569711,569775..569789,569859..569872,
                     569944..569980,570044..570051,570153..570260,
                     570374..570411,570473..570487,570551..570693))
                     /locus_tag="CNE02100"
                     /codon_start=1
                     /product="uracil phosphoribosyltransferase 1, putative"
                     /protein_id="XP_570874.1"
                     /db_xref="GeneID:3257897"
                     /translation="MFTNITTCLPASGSNVHKAKLPDNAFVLPPTSQLQSLLTIIRDE
                     TTQRGDFVFTSDRIIRLLVEEGLNHLPVLPKKVVTPVGREFEGVAFQGRICGVSIMRA
                     GEAMEAGLRDCCRSVRIGKILIQRDEETAQPKLFYAKLPDDIAQRYILLLDPMLATGG
                     SCIKAIEVLLDQGVQEEKILFLNLIASPEGINKVCTRFPKLTIITAWVDEGLDNHSYI
                     VPGLGDFGDRYFL"
     gene            570972..576452
                     /locus_tag="CNE02110"
                     /db_xref="GeneID:3257835"
     mRNA            join(570972..571478,571540..571585,571640..571679,
                     571728..571802,571855..572054,572114..572127,
                     572181..572251,572304..572350,572411..572424,
                     572487..572604,572664..572937,572987..573065,
                     573122..573391,573471..573694,573757..576452)
                     /locus_tag="CNE02110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657208.1"
                     /db_xref="GeneID:3257835"
     CDS             join(571250..571478,571540..571585,571640..571679,
                     571728..571802,571855..572054,572114..572127,
                     572181..572251,572304..572350,572411..572424,
                     572487..572604,572664..572937,572987..573065,
                     573122..573391,573471..573694,573757..573981)
                     /locus_tag="CNE02110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512875.1"
                     /db_xref="GeneID:3257835"
                     /translation="MTIIAGSSQSPSLIHHPTPIVVNNKRTSEDTVPGEVRLEEEKYG
                     RTDSDTTIVSRENVGKLGSIRKHGRGLTEGDNEVPDMPKNNLALVMPALGLVLFLAAL
                     DQTIVATALPTIAEDLNSSPSEYSWVGTAYMLSSTVQTPFNGRVSDIIGRKPMLYAAI
                     VIFTVFSALCGAAKSSSWLIIARAFQGLGGGSIIGLTSIIVSDIVPLEKRGAYQGLLG
                     SSWGIAAVLGPLLGGVLTEKASWRWCFYINLPTCGLAFVLLIFTLKLNPTRKLTFKQL
                     LATFDFVGLALLLISCALLIVGFSRAADYGFDTPTSYGIIIAGAVVFVAAVVNFLMTK
                     RNAIIPSRMFKNRTTLFFLLGSTLHAIAFLPSNYLLPQMLQGLRGDTPLESGVHLLPY
                     ALLVAWMTVVAGQINSRLRIIRPVVWIGYALAAIGFGLFYKYYTADVSYATQEGLLVI
                     ASTGIGLSLQSPLLILQAAMPLKEMAATTSAFSLTRSMGGSIGLAVFTAVLNTNLRTR
                     FAKIPGYGTEFTVPRSASDYAALQNLPDGTMKDQVMTGFANSFRQCWIIGCAFFLGSL
                     VLTLWTKSYSTRRSKLQAGLIEGEAQEQTDLEAQIEVPRNGDRTTELPLTGYYTVDEF
                     SGEEAKQGDRRIPKELS"
     gene            complement(574105..577542)
                     /locus_tag="CNE02120"
                     /db_xref="GeneID:3257985"
     mRNA            complement(join(574105..574557,574619..574650,
                     574710..574834,574885..575212,575266..575424,
                     575479..575599,575659..575868,575923..575954,
                     576016..576036,576094..576127,576196..576255,
                     576332..576423,576480..576523,577464..577542))
                     /locus_tag="CNE02120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657209.1"
                     /db_xref="GeneID:3257985"
     mRNA            complement(join(574105..574557,574619..574650,
                     574710..574834,574885..575212,575266..575424,
                     575479..575599,575659..575868,575923..575954,
                     576016..576036,576094..576127,576196..576255,
                     576332..576423,576480..576694))
                     /locus_tag="CNE02120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570878.1"
                     /db_xref="GeneID:3257985"
     CDS             complement(join(574219..574557,574619..574650,
                     574710..574834,574885..575212,575266..575424,
                     575479..575599,575659..575868,575923..575954,
                     576016..576036,576094..576127,576196..576255,
                     576332..576394))
                     /locus_tag="CNE02120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512877.1"
                     /db_xref="GeneID:3257985"
                     /translation="MSNESGTNKSHPSAKAPQKTVLNLGNLPPKPKANELRQNANQYP
                     RTPSRVNPNQPPWPAYRGYHEYSFAHATMGVRLPTILGKAIDDVWKSVNQEYDEDRIV
                     DLVNCIGRMEHLMGDLQGNSKLRPIIDDGAGDIALWNKEIAKFFRGKDFMNAPWLFAE
                     AYKYRRLRECFSLSKYFVEYDVFFRQKCDTFSRSNQAVFELSQRFSESQTIDANLSEE
                     EQLEKKKLLFLELTQVCLWGNSTDLSLLIDMTEDDIKKLQSTGGDHLAATEKNILGND
                     LHKLANYVATLKGGRIDFVLDNAGFELYCDMVYADWLIQSGICSQVIFHGKKIPWFVS
                     DVTKKDWDWILNSCVYGHLFEEATDVEMDSLRTLGHRWKKYEKEGKWKYEAHPFWCTG
                     YTFWDLHSEAPDLFQYLSESDLVIFKGDLNHRKLTYDCHAPLDTPFSIAIGPLASEAG
                     SPPVCSLRTIKSDVVVGIPTGVGEKLDEEEPGWKISGKYAVVLLSEGRKGETPVYSS"
     CDS             complement(join(574219..574557,574619..574650,
                     574710..574834,574885..575212,575266..575424,
                     575479..575599,575659..575868,575923..575954,
                     576016..576036,576094..576127,576196..576255,
                     576332..576394))
                     /locus_tag="CNE02120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570878.1"
                     /db_xref="GeneID:3257985"
                     /translation="MSNESGTNKSHPSAKAPQKTVLNLGNLPPKPKANELRQNANQYP
                     RTPSRVNPNQPPWPAYRGYHEYSFAHATMGVRLPTILGKAIDDVWKSVNQEYDEDRIV
                     DLVNCIGRMEHLMGDLQGNSKLRPIIDDGAGDIALWNKEIAKFFRGKDFMNAPWLFAE
                     AYKYRRLRECFSLSKYFVEYDVFFRQKCDTFSRSNQAVFELSQRFSESQTIDANLSEE
                     EQLEKKKLLFLELTQVCLWGNSTDLSLLIDMTEDDIKKLQSTGGDHLAATEKNILGND
                     LHKLANYVATLKGGRIDFVLDNAGFELYCDMVYADWLIQSGICSQVIFHGKKIPWFVS
                     DVTKKDWDWILNSCVYGHLFEEATDVEMDSLRTLGHRWKKYEKEGKWKYEAHPFWCTG
                     YTFWDLHSEAPDLFQYLSESDLVIFKGDLNHRKLTYDCHAPLDTPFSIAIGPLASEAG
                     SPPVCSLRTIKSDVVVGIPTGVGEKLDEEEPGWKISGKYAVVLLSEGRKGETPVYSS"
     gene            complement(578260..580121)
                     /locus_tag="CNE02130"
                     /pseudo
                     /db_xref="GeneID:3257872"
     gene            578342..581551
                     /locus_tag="CNE02135"
                     /db_xref="GeneID:36392865"
     mRNA            join(578342..579091,579152..579999,580057..580117,
                     580169..580577,580624..581551)
                     /locus_tag="CNE02135"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658526.1"
                     /db_xref="GeneID:36392865"
     CDS             join(579350..579999,580057..580117,580169..580207)
                     /locus_tag="CNE02135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514376.1"
                     /db_xref="GeneID:36392865"
                     /translation="MPSKYPASPRYAKPTKIPGAFNKGVITGAGHSSIYLTPVQEERI
                     LNWREASTSSQPRRPNVRSAPASVRLPSNSSICTCTCTDCQGNPSPIMSCCCSGHSPK
                     SKTSRQSKKDKGPNSHVKSYYSRNTAPESSNMTPTLPTMMTVRPKTVPIGRQPPKIKA
                     NKTWAASRPTYEQTSPLTAGPPQWTAPGDSPMDITPLNTEIPMFRIAGSRDPISQSYW
                     KRMFPPAAMPTAMPAFGLLPPQLFGMPSRKP"
     gene            complement(580615..583104)
                     /locus_tag="CNE02140"
                     /db_xref="GeneID:3257715"
     mRNA            complement(join(580615..581028,581081..581775,
                     581838..583104))
                     /locus_tag="CNE02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_570881.2"
                     /db_xref="GeneID:3257715"
     CDS             complement(join(580721..581028,581081..581775,
                     581838..583033))
                     /locus_tag="CNE02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570881.1"
                     /db_xref="GeneID:3257715"
                     /translation="MPREPDNGQLSHTGSSQWYLHHLDAHIKASRRSYLGQLGNTTVK
                     PLRTTPVPPTNNIWTSYDKQLFFAALSRHSRLRPDLIASDVGKSVAEVQWYLDLLETS
                     RQTHESKGRPTKERCVERNGYWREEVAPAAREVSDKWVLKEEKLATEAIAVIEQKEKE
                     EYRVFQKKRKRKARSDLNKEVDIPRDTRPGERKRIIESWPGTEEMEKRWEAEEWLESI
                     GVDKVPELDHLIWKFWLDYYYKEEVTQPTTPPVAEPSSDDERSSAGPSNSLQVPGIGS
                     REEKIARDLRNLSAIQAIPKKRRTPEQRLLLTQILNRQQCRERYRTKKLLEEGMTTAE
                     IHAAGGADVIFAKRNQAESSTDMLESLRETGISDRQRSKRPEIIDCLKSRGLDIFVYN
                     SMSRFLERDGQPNLTITLSTIQGLYIDLLKFLKPLVLNSIIIAEQSAVQAGQSSNGAK
                     DDDDFAVISLHVQQALALQCADALSFQDTKTSMTDVHSSPAEVAEDHEQRRSPEGRNK
                     GTSVIEYGSEYTCWNNLSRELFPPNDIPWRALSSFYNHHPTIPEPHSLDATPSILCSE
                     SESDAEDEEDAILHDMLHKVDMEHDRLYEDSLWEALDSNDVEYEPDDKNGSWNGDAEK
                     PSETEQEYINLHRQIREDRRKRKNAAWRRARYPSSRGEHLNSKKGRNAISDAFIDDET
                     EEGLEESSSEIGDEETHASEEEEEREVSYGTVHQGDGETQGREHQMLEDA"
     gene            583258..584881
                     /locus_tag="CNE02150"
                     /db_xref="GeneID:3257741"
     mRNA            join(583258..583569,583643..583691,583761..583817,
                     583888..584399,584454..584582,584646..584881)
                     /locus_tag="CNE02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_570883.1"
                     /db_xref="GeneID:3257741"
     CDS             join(583286..583569,583643..583691,583761..583817,
                     583888..584399,584454..584582,584646..584679)
                     /locus_tag="CNE02150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570883.1"
                     /db_xref="GeneID:3257741"
                     /translation="MGSHSRNRSRSRSPDRENDRDRERHGHRHRNRSSSPRRDRHRED
                     RNRSHGTDRDRDRDRPKSKRDKVRDTTPSDEESLLDLDEMGVKEISEDDYFLKSNEFR
                     LWLKEERGKYLDEMSSESAHKYFRKFSRRWNDGALNRKYYNSPEPLPATSSTGYRWSF
                     ASRGDVSLPSVRADVGRMAKSSVPATGPGRPADEIGPSYGPTFPPPITSRRLGPTLPS
                     ASDRQYAVEAAQEARKVERKAAYKEDYRRADEVVPRSGGREGKMEEKRATNAENRTFR
                     EKDVTAGLEVDEGTLMGDSGSFAAALRRRDEAESRRRERKELANLNTKSSVNERLQER
                     KQKETATMEMFKAMAKERFG"
     gene            complement(584863..585908)
                     /locus_tag="CNE02160"
                     /db_xref="GeneID:3257503"
     mRNA            complement(join(584863..585060,585114..585224,
                     585278..585474,585525..585590,585746..585824,
                     585886..585908))
                     /locus_tag="CNE02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_570885.1"
                     /db_xref="GeneID:3257503"
     CDS             complement(join(584940..585060,585114..585224,
                     585278..585474,585525..585590,585746..585824,
                     585886..585893))
                     /locus_tag="CNE02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570885.1"
                     /db_xref="GeneID:3257503"
                     /translation="MTCAPRKQSKTYKVPKRPYEAARLDAELKLAGEYGLRNKREIWR
                     IQLTLSKIRRAARELLKLDDKDPKRLFEGNALIRRLVRIGVLDDTRMRLDYVLALKTE
                     DFLERRLQTQVFKLGLAKSVHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQKHIDYAL
                     TSPYGGGRPGRVKRKRAKAAAGGGDDAEEEDEE"
     gene            586248..587169
                     /locus_tag="CNE02170"
                     /db_xref="GeneID:3257826"
     mRNA            join(586248..586255,586306..586378,586580..586684,
                     586742..587041,587091..587169)
                     /locus_tag="CNE02170"
                     /product="60s ribosomal protein l21-a, putative"
                     /transcript_id="XM_024657210.1"
                     /db_xref="GeneID:3257826"
     CDS             join(586318..586378,586580..586684,586742..587041,
                     587091..587107)
                     /locus_tag="CNE02170"
                     /codon_start=1
                     /product="60s ribosomal protein l21-a, putative"
                     /protein_id="XP_024512881.1"
                     /db_xref="GeneID:3257826"
                     /translation="MPHSFGMRARTRHMFRRGFKEHGAPSVSTFLITYRVGDIVDIKA
                     NSSQQKGMPHKFYHGKTGIVYNVTPRAVGVIIYKVVNGRYMEKRVNIRVEHIRHSKCR
                     QEFLDRVKSNAAKKKEAKEKGEQVLLKRLPAQPREARVVSIHNNVPQTLTARPYETFI
                     "
     gene            complement(587239..591994)
                     /locus_tag="CNE02180"
                     /db_xref="GeneID:3257583"
     mRNA            complement(join(587239..587477,587559..587691,
                     587750..587882,587936..588036,588088..588165,
                     588213..588411,588466..588594,588654..588728,
                     588791..588867,588921..589026,589082..589178,
                     589238..589341,589397..589486,589536..589640,
                     589697..589828,589879..590087,590138..590225,
                     590278..590454,590512..590526,590577..590812,
                     590863..590957,591014..591301,591353..591465,
                     591520..591994))
                     /locus_tag="CNE02180"
                     /product="telomeric template RNA reverse transcriptase,
                     putative"
                     /transcript_id="XM_024657211.1"
                     /db_xref="GeneID:3257583"
     CDS             complement(join(587306..587477,587559..587691,
                     587750..587882,587936..588036,588088..588165,
                     588213..588411,588466..588594,588654..588728,
                     588791..588867,588921..589026,589082..589178,
                     589238..589341,589397..589486,589536..589640,
                     589697..589828,589879..590087,590138..590225,
                     590278..590454,590512..590526,590577..590812,
                     590863..590957,591014..591301,591353..591465,
                     591520..591894))
                     /locus_tag="CNE02180"
                     /codon_start=1
                     /product="telomeric template RNA reverse transcriptase,
                     putative"
                     /protein_id="XP_024512882.1"
                     /db_xref="GeneID:3257583"
                     /translation="MTTPFSDRAPAKIQQETSPPTLHHKTLSAYYPYIYTLSKFISSR
                     LEGFESQPQASNTTAFSTFLKTTLCAFRNEDELNRVELDKDRRVIFPTQQEAIDKALS
                     HVAKASSGPGKVQNLLLFRTSSKLHIQDLPINMSRPSVPNQTIQGPAGVFRSSEWQIL
                     RSRIGDKSFSQLLLGTSLFSPVGNNCYLQLSGIPLYELYEDDHRRAFSKIELSRKRKR
                     GAEKNRKGKRKRPKSTTVIQAEESSEIFDQAKAKEKKDDGNPSNISIQRQRMFYGRPY
                     WHKQGVLSHGLPPSHILNSLKCGKKSHEAPSDFDCLSLLDDIFPQLVGNNKDISTLTT
                     EKLPKRAAGMIGIAREIIVRHSRLEYEDIMKQCLKRMDRVSSKTPPTYTEKSAWTATP
                     AQSNEQTLPTSAVRRERSARVNIAIYEEKTHNPFMPKTHRQVCWFVTTIVRSLFSTQI
                     MGSQHNLDILLANVRRFITAKQFETISLHSLSQDLRINDFRWLHENIGSGQRVSPGEM
                     KKRKELVLSLIHWIFECFLVPLIKNSFYVTETATTKYETVYYSQKDWNKAVRPHYRKL
                     QDNLLEEIDKNKVEAARRGVLGVSTARLIPKPTGFRPIVNLGRKIETPDTTNSKRKSW
                     SANQILGNVHKVLTSEKDRQKPRLGGALFGTNEIFPPLQKLKCDLTKKHGNLPQLYFI
                     KTDIKAAFDSIKQDKMLEMLEDMLRQSSEYRVILYSVLLPPGHKAYQGTSKRFFKSRA
                     IPTEDVSLTFADHAKEIAASMRNATIVDMVRRYSVTTQECLDLLRTHIKDNVWQVGKQ
                     YYRQKTGIPQGSKVSTLLCTMFYSYLENEHLSWTRREGSLLLRYIDDFLFITDNYNLA
                     RRFVDVMSRGFPEYGARISVDKTLLSFEYDTGKQLAPVCGVNEQGDVDFPYCGFLIRT
                     GTLDIMPDYTKFLNYSIKQSFARRSTRKQGSTFLTWYSRQLENRNHVALLDTAHNGLG
                     TVMMNVFINFAITTMKVPHYFKGTDTGANFNRLVFASMLCSSEYTFYAGRARVLHHVR
                     TKNSKNLDKKEHFSLKKEEFILLAITAMSHVLKRKASRFRGVVDLLEAEGKKRVYRGL
                     AGKLAVVCDKGWDAVKDAKY"
     gene            complement(592245..595339)
                     /locus_tag="CNE02190"
                     /db_xref="GeneID:3257815"
     mRNA            complement(join(592245..592376,592432..593001,
                     593054..593227,593285..593537,593589..594031,
                     594085..594450,594500..594852,594903..595055,
                     595109..595169,595220..595339))
                     /locus_tag="CNE02190"
                     /product="ribosome biogenesis and assembly-related
                     protein, putative"
                     /transcript_id="XM_570891.2"
                     /db_xref="GeneID:3257815"
     CDS             complement(join(592296..592376,592432..593001,
                     593054..593227,593285..593537,593589..594031,
                     594085..594450,594500..594852,594903..595055,
                     595109..595169,595220..595255))
                     /locus_tag="CNE02190"
                     /codon_start=1
                     /product="ribosome biogenesis and assembly-related
                     protein, putative"
                     /protein_id="XP_570891.1"
                     /db_xref="GeneID:3257815"
                     /translation="MSGHSHRPTLKQSNKGFKSKHASKGSLKAAAKGKVSSSAHSHGT
                     KNALGNSKKARLNANAQKRTAKRQAVIQDQKFFSTSSGGGHVPRIVSVVPLLPSISPR
                     TFIANLLPSLGLDESELQEISAALADYGSYLLRAPRYKTSLQINLLPPLSVYPTLDAA
                     FVSDYIVLLMSSVDEVQLQGETILRSLQGQVGGAEIVACVQAPESNPLRPDTRQLIHK
                     SLLSFTRYFFPSVGKIYSSDTPQESLLLARALCEAAPKGMRGDDGRAYIVAENPNSIR
                     WTGSGILTEDGQEKGQLEIIGTVRGGGTLNADRLVHIPGSGDYQVAAILSAPLPSKRQ
                     QTQIATNDTLSVPTEDADDLTATNIPDLLANEQTWPTEEEMGGSMEHTVEEPVVKKRV
                     KRVPKGTSAYQAAWIVDDDEEVDAEDLSDDESMGASGDEAASAGERSAAEDEEEFEDV
                     EVDSRQEVAHKDLDPEQEEADYEAYLKERSKADREDAMFPDEVDTPRHIPARTRFQRY
                     RGLKSFRTSPWDPYEDLPIDYAKIFQFENFAATSKRIQLEGAREGVKTGTRVILVLRD
                     VPRSVIEDRETGIPFIVHGLLRHEHKQSVLHFVVQRNTEYAEPVKAKEPLVLCVGPRR
                     YIVRPLYSQHVRGGGKGANNVHKSEKFLRPGTATVMSVFGPICFGKSPCLLMKDRGIK
                     TGKFILSHIDAYSDLHPLSVPDLVAMGSFLSSDPTRIIAKRIILTGHPVKIHKKTATI
                     RYMFFNREDIEYFKSVQLHTKYGKIGNIKEPLGTHGYFKAHFDGPIQQMDTICMSLYK
                     RQYPKWSEEFRPQLAVGAIEEAGEDVMETDE"
     gene            complement(595515..597585)
                     /locus_tag="CNE02200"
                     /db_xref="GeneID:3257817"
     mRNA            complement(join(595515..596144,596198..596474,
                     596522..596587,596638..597250,597306..597375,
                     597460..597585))
                     /locus_tag="CNE02200"
                     /product="prolidase, putative"
                     /transcript_id="XM_570893.2"
                     /db_xref="GeneID:3257817"
     CDS             complement(join(595617..596144,596198..596474,
                     596522..596587,596638..597250,597306..597375,
                     597460..597546))
                     /locus_tag="CNE02200"
                     /codon_start=1
                     /product="prolidase, putative"
                     /protein_id="XP_570893.1"
                     /db_xref="GeneID:3257817"
                     /translation="MAQKYPSRAHALKLIHELAKLIPDHERGKLHGIFLQGSPTLFRD
                     DTDHEHPFHQEANFNYLSGIIHPNCSLAVFFSLPATPSSSSVIEHHLFIPAADPAETM
                     WSVAPPTIEVAKQVYDSDNITFTSSIPGVLGSAVKSGNGELVLHVLPRTMEYPALPEV
                     IDQTSGLRLESSYLFKALHIARLTKDEHEIDLIRQANRISSAAHEVVMRELGRFASAR
                     EKGGRDLKERTGKEGVKEWEIESERDAEAVFVATCKRMGATDQAYLPIVASGTRSSTL
                     HYVCNDRLFPSIPRKRGDVTFTHEVSRGCCGDDHNQPISSVLHNDAFLPQLLLIDAGC
                     EWKGYASDITRTMPIGNGGKFTKEGGEIYELVLRMQKECEELVKPGVHWDTIHLHAHK
                     VLIDGLLSLGILTGSPEDILQSGVTAAFFPHGLGHSLGLDTHDSLQYLRLVHEDLPPT
                     TTSTPSKLYKFLRIRLPLTLNMVLTVEPGCYFAPQLMEEHGVWTSRFVVQDKLKEYVG
                     IGGVRIEDVIVVRERGVENLTTVGKERDWVEAVCSGTL"
     STS             597049..597845
                     /standard_name="Bam4"
                     /db_xref="UniSTS:470799"
     gene            complement(597859..600647)
                     /locus_tag="CNE02210"
                     /db_xref="GeneID:3257660"
     mRNA            complement(join(597859..598066,598132..598275,
                     598334..599011,599063..599085,599139..599208,
                     599267..599282,599338..599534,599593..599798,
                     599850..599908,599962..600103,600165..600253,
                     600311..600354,600471..600509,600564..600647))
                     /locus_tag="CNE02210"
                     /product="endodeoxyribonuclease, putative"
                     /transcript_id="XM_570895.1"
                     /db_xref="GeneID:3257660"
     CDS             complement(join(597920..598066,598132..598275,
                     598334..599011,599063..599085,599139..599208,
                     599267..599282,599338..599534,599593..599798,
                     599850..599908,599962..600103,600165..600253,
                     600311..600354,600471..600509,600564..600566))
                     /locus_tag="CNE02210"
                     /codon_start=1
                     /product="endodeoxyribonuclease, putative"
                     /protein_id="XP_570895.1"
                     /db_xref="GeneID:3257660"
                     /translation="MAGAMERAKRDLPKIRDEERETMFGSVFSVSGPVVIGENMRGCA
                     MYELVRVGHDELVGEVIRIEADRATIQVYEETSGVTVGDPVLRTGKPLSVELGPGLMT
                     NIYDGIQRPLKAIQEKSQSIYIPRGINTESLSREIKWDFNPANLNVGDHIAGGDIFGS
                     VYENSLVDNHRIMLPPRAMGTITRIAEKGSYTVEDVVLETEFQGKTTQHTMMQLWPVR
                     APRPVAEKQTATYPLFTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQALSKFSNSD
                     IIVYVGCGERGNEMAEVLADFPELTLERAGREEPIMKRTTLVANTSNMPVAAREASIY
                     TGITLSEYFRDQGNNVAMMADSTSRWAEALREISGRLAEMPADSGYPAYLGAKLAGFY
                     ERAGKVSCLGSPSRNGTVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLSKSLAQRKH
                     FPSVDWNLSYSKYLKILDPHYEKNNPGFIDLRTKVKEILQKEQDLAEIVQLVGKSALG
                     ESDKITLEVARMLKDDFLQQNGISEYDRYCPFYKTSGMLKNFVAFYDGSQRAIEANDM
                     TFAQVRDATSDIMFKLSQMKFESPNTQSEEEIQAKFDALYNEIGETFRRLQE"
     gene            600843..602202
                     /locus_tag="CNE02220"
                     /db_xref="GeneID:3257670"
     mRNA            join(600843..601342,601401..601564,601617..601689,
                     601741..601828,601878..602202)
                     /locus_tag="CNE02220"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_570897.1"
                     /db_xref="GeneID:3257670"
     CDS             join(600848..601342,601401..601564,601617..601689,
                     601741..601828,601878..602158)
                     /locus_tag="CNE02220"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_570897.1"
                     /db_xref="GeneID:3257670"
                     /translation="MRPRNIPIHAIPPSLTRPATHLRLRPSYHSLPRATPITLLPPRF
                     ISRPITIQAPGPIPDPDRRDAQNEPPIITQPPVASGSGIHGDPTSSNITTATSLPAPP
                     ESLNFTPRYLQHPFDTHAFVSYLEKNGLDRETSRALMESVKDMIIKRGKRTKDTMVGK
                     EEAENTAYLFNAALSELRTELSVQTRNDGLALKSMAVAIRREVEQLEQKMKEDIQTLK
                     HDIEMDMNNRKAETRTEIKGFDINIEEINNKFTISLGDLRTEIESVKWDATRRAISVI
                     ILVVVVTIGSVTFFTADPAPNAKVQPEVKPPTSTMKDMSVGTEDDFIEDVGTYTEQRL
                     EKLLQEQGMDIEKLKKKKEGKKGKEDLFIDRI"
     gene            602461..604857
                     /locus_tag="CNE02230"
                     /db_xref="GeneID:3257950"
     mRNA            join(602461..602619,602675..602811,602869..603154,
                     603216..603398,603816..604039,604090..604209,
                     604262..604342,604405..604857)
                     /locus_tag="CNE02230"
                     /product="expressed protein"
                     /transcript_id="XM_571216.2"
                     /db_xref="GeneID:3257950"
     CDS             join(602565..602619,602675..602811,602869..603154,
                     603216..603398,603816..604039,604090..604209,
                     604262..604342,604405..604794)
                     /locus_tag="CNE02230"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571216.1"
                     /db_xref="GeneID:3257950"
                     /translation="MEDLTSISRSLREILNSSTQEQGNLTEVVQKYLESDDIGAQRAV
                     CEVILELLEEGDEETKTQRCTLLLEDSALTYISPIIRLSSTAPGTVHSLIQLISRYGR
                     PREVLMALSEALQYVIDRAEGFSVSDDEEDNRPLDDDDVDYESLWAEWQMIISGYIIA
                     IPRLPNVRSTPTLLSLSEEISQSIRSLGPHASTLWSRTCLIMLCSLTDTIWNWAQKTT
                     DKAAAIPLRTVDPHLPDPLPQSLLEDMMPVLCAALSGTSIDAGAVWLWWIANRALESK
                     KEGAQVVNVGYDEMTMLIELLVPLTAQHPNPGMRLALFKLIGTLISLLSSRDKVLALR
                     HLLEPENPFDTVRIESMSILREETASNNDLLSPDLLAQLAPILFPPVTLSDPDSPYNL
                     SSPDLLSSPNPSWWTEVAHYIWFLSTRDSADRSGVRSTYREDIIMWLDAVRSKLNETL
                     SYVQENGNVKEVAEVLPGHGVGFFLNRWADALDRARVALDA"
     gene            complement(604814..608721)
                     /locus_tag="CNE02240"
                     /db_xref="GeneID:3257922"
     mRNA            complement(join(604814..605720,605780..605905,
                     605960..606165,606235..606322,606384..606451,
                     606509..606551,606609..606668,606720..606870,
                     606934..607176,607227..607325,607380..607495,
                     607559..608017,608072..608402,608462..608721))
                     /locus_tag="CNE02240"
                     /product="expressed protein"
                     /transcript_id="XM_024657212.1"
                     /db_xref="GeneID:3257922"
     CDS             complement(join(604926..605720,605780..605905,
                     605960..606165,606235..606322,606384..606451,
                     606509..606551,606609..606668,606720..606870,
                     606934..607176,607227..607325,607380..607495,
                     607559..608017,608072..608402,608462..608490))
                     /locus_tag="CNE02240"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512990.1"
                     /db_xref="GeneID:3257922"
                     /translation="MSTTDILFESFAKLIYRFGNPPNSQVTNGPYSPDKIFTSWLNHL
                     RKPFPIHTGKHLFRLLFPHIGSRRRYGLKEQKLALELSKILGAKTLNQWDSIRWDDTG
                     DAGTGCLGRDIEALVKNRSISDDDNRSLLTIRELDNLLDELASSSSFSQLSQLPDAPR
                     PIGKILTILYLDWKLSPYALSVLTQIILRDLRPLQDPIPCLPIRNPTSLLRINAKNSP
                     RQLSLRDAMICWDRRMWDLYNGGYGNVDICADILERNPLLDPSKSHGPLIGVNVAIPK
                     CKKGRSIRDTMKEFTGTRYAEPSKAIWAETKYDGYRLQIHIDVQNPYPKITIFSKSIR
                     DSTQDRLNTHAIICHTLNLPVDPSLPIHRLLSQRIQSTTFCPQPKIQKSVILEAEVVP
                     FNENSREGDRGPGIEEFWWLGHAGVSAGAMNWAYSGKSLPSISGRHLCLVFFDILHIN
                     GQGLLNHTYEERRRLLEDVIMVIPGFSQLAERTKISLQHGPEYALDELEAIFKKSNNL
                     REEGLVLKAAESTYINMRWQWVKLKKDYIPNLGDCIDLVVLGAGWDIDRARELRVDTS
                     VFTTFYVGVLTNAERVKSRCETPHFEILFRVSYGCSRDELEVYNENIRLGRWKNKPFD
                     KDDALKRRLIGLSWTYSLQRGMTPPSILFEKPMCVEVMGAGFQKLPASELYELRWPRL
                     QKIYDPRERQWTEALSALSLISTAHSSLGYKCISASSYGQNSPRFQDSIDAAWRSASH
                     LNVTDIPDFPSPSPKSQGQKRSKSEADLTGCRVKDEPLTPRLSPLRRSSGGRVEVVKW
                     EYTKMASKRLRDVMAKGEGMVRESDTEISPLEYLQTATATDAVVDRSIPSKKRRLSAS
                     AGLSLSTMPLKEKVQSAKLQDVTVLTMAAGQSIKEPLQKVPEIVTTTMLQKAKNPNVQ
                     RWGKPLSLKSRIKLAMRQAGKVS"
     gene            609024..615889
                     /locus_tag="CNE02250"
                     /db_xref="GeneID:3257659"
     mRNA            join(609024..609336,609398..609977,610031..610836,
                     610888..612134,612186..612964,613034..614242,
                     614289..615889)
                     /locus_tag="CNE02250"
                     /product="expressed protein"
                     /transcript_id="XM_024657213.1"
                     /db_xref="GeneID:3257659"
     CDS             join(609222..609336,609398..609977,610031..610836,
                     610888..611957)
                     /locus_tag="CNE02250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512884.1"
                     /db_xref="GeneID:3257659"
                     /translation="MASTRESTPRQPVIEPRAKRTHARRSCSICKLRKSRCELPDLNV
                     PSGPDPLPEDKACHRCKVLSLPCVVDDSNRKQRKRKDPPAGSSGLSQGQETPEAGPST
                     SKRQEPIPAGPSHTLASKFTIPSQSSIHAIDHSLDLLPGLSVFNGQALAEDPVDNFEK
                     LKRELGARGVDRESGNTLSIKLHGRPLELTCAMLRVAYGRKEKRGKRMKLEDDEIEVD
                     VIIDEAMMARLAPGVSQLMTYHPHLDDLPTMFNEYRRNPEPTIALLIASVAYLASSVL
                     PPDSTIIHLRNELTPFIYQRRDFLLLHHPHTFFALQVLELFITHCPFGILPIQPANLH
                     TLGVAKGVTAAAKDISSQLNFDKLIHQILAGPGLRHSFNCGDIWLWLALNAAEAAAML
                     EESNPQKPIQLAEARRITESFFKLTDEGACLWQERLGRMEITVLVGRLALCDKIARLE
                     EVLDGMARIRGVLEHSARDPTVDPVRGILAEFEEYTKKTDEIDRRHGAMIAMMQGYSK
                     NIETGWVTYRAIRRRYEFSKLHVTGLRALMATHFLPGSPYAYPDLPSFVSPAHAVAYA
                     IGRACHPPDIVRFIGGTSNAGGASPAVQAVWEWGHRRRVNMEHNLVACAELAQTYGSD
                     LTGMVYTCIVPLHECICIAVESSKILMEMEAGTIHILRSHNQLYKAARPRPWLEIMKQ
                     VSQTMHNVSMMMHDDGLGGETLANGASNLIGSMVRVAEKWVTSGQEEAARQGTEEMAL
                     DPTQAHQGYDSNTDPHVHNSHRQSGVTSHQQYMDKSDRWMAGNGQSSISHQHAMATPP
                     IHIDAAILNSPDLSHHNYHTPPVLGRLPITTQLDGLLSDMFGYSCNPAQPPQNQATPQ
                     "
     gene            complement(612854..616240)
                     /locus_tag="CNE02255"
                     /db_xref="GeneID:36392866"
     mRNA            complement(612854..616240)
                     /locus_tag="CNE02255"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658527.1"
                     /db_xref="GeneID:36392866"
     CDS             complement(613177..615873)
                     /locus_tag="CNE02255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514377.1"
                     /db_xref="GeneID:36392866"
                     /translation="MVEVHSSRVAIRTSAKSAQSLVVVLFLILVLYIFFFGKGNGKNK
                     AKQSSSKESHPDASLSNHTKDKDRKRRKPKEKSDGQTASSATSSDSSQPVRYDGNRKF
                     KKKRDKTSSKSKKSKSEKTKRIKEKPEWLQPSSPPLLSPIPDLRSASPAKSIIRKRGS
                     DDSLPPSPNTAKGNRIHWVDYEGLSPHEVTKHVRKWEDYVGVTDQTREGTFENSPVKR
                     KEKWESHQKILVNPAEWAAKELRRKGKLDEGLLDAMEQAEEISMATPRDSLWVKALQD
                     EWDEHLGPVPAVAMVMAKRFGKHISFDNIVLLADTMTRRASMAPSLDKKRSYSKFVES
                     IGVDKDDPLYPYKLVLAWYCDTFRCKHYSERMGICDEPVQMASHDKLGPVAQMLGWME
                     YLGRLNMTQRLFVGLDLSGLAMRAQAMREGEGYRLDLTVFLPGGPQSSVDDIAEGWTD
                     RIDESAKAFRTVHLELAKIFDKTKDDMIYRDPFVRRRLIFRPGWTLNGVNSANLDKPK
                     PEASVAQRQLVTRVPRVLELTADINDRIPSALRKPTRNVRKALSRLAPGEICFQSIRQ
                     YAWDKSTITAENSTFNSVTFWIAWSYSGEKIQYSRSTDIVQDQRAHDFVRSLDLGGYI
                     PIHIADPHKFLRIGGFPALEVLLLSYLPKNQVGATVDLVLEPSFGLLQELEKSRQSSR
                     YFYDRPSRLKLFVSVTDAHAAQGFVLELDRRLAQEGRQYLASGSSREQTVEIMSELAS
                     KALGEIYLVDESKSGEIGEGKLPKGIPLNYDVRRAVQILLDPRATQRPLQVGTIPENL
                     ENINITPASPERQPPLSNRESSTMIPPPDSPVIPSTPSTPIIPSHFPPIPVNSSNGPS
                     TEVKQRDVLEEERDSPLREVRPNYPPSPSLEDVSLENPWRSE"
     gene            617223..619794
                     /locus_tag="CNE02260"
                     /db_xref="GeneID:3257579"
     mRNA            join(617223..617880,617936..618263,618314..618376,
                     618433..618683,618735..618997,619052..619328,
                     619382..619442,619495..619794)
                     /locus_tag="CNE02260"
                     /product="expressed protein"
                     /transcript_id="XM_571217.1"
                     /db_xref="GeneID:3257579"
     CDS             join(617253..617880,617936..618263,618314..618376,
                     618433..618683,618735..618997,619052..619328,
                     619382..619442,619495..619540)
                     /locus_tag="CNE02260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571217.1"
                     /db_xref="GeneID:3257579"
                     /translation="MPHPLRFDSSRSSASSSESDSHESSASSYSLPRYTEKPRQYSFT
                     QRASAKLKNALRPSRRSSLPFAYVARRRTTQLALAAGLLILGALLLSEFRYHNERQQL
                     WNKELALQEWEVRHSGDREVNLFAFRADYESKRREEMYAERKRRVDSGSLDKEQLWTA
                     QEDETLQREVNDKWPSWWGNPDVVGQSPFDHRPALLPPRKEKRRLLMLTDYKDYLERM
                     NTHTYEIVDAALRHPHLIVDVWGPGWAGYNKSIPLSANIRKRAHRVSQLEKSKVEFEK
                     KQRKKREKLAEGAEQEVWQRPDWLDVVPDKCSDVRYDVVLTISNIYKETDPHLDFLDC
                     GALMVQQLGDCHSLRCAYEWYPQSNNITLSKYGFELLELFDYHNVKAKYPDWEMGLFG
                     HSPDTGNEWDFWPVTWSEKTSDARIFGFDGSFYPIRTTVTNHLREVGNKELETLISRH
                     PHPGYTVSVPQEARDNPLETYEQNHQYYTTHLKLREDFAKGMRESKICVFDASLERKM
                     IRKYAQAFLSGCVVAADIPTEHESALSKFVIPLKATWSIEQINAAIQYYIDRPEVLQQ
                     MAVDGFVYARQHLTTTNKISHILEMADHYREGSRGYEFPYGFSMKCRAYWSDENGYRP
                     PWCRNTQGYRGLEA"
     gene            complement(619825..620755)
                     /locus_tag="CNE02270"
                     /db_xref="GeneID:3257597"
     mRNA            complement(join(619825..620106,620168..620214,
                     620358..620470,620530..620755))
                     /locus_tag="CNE02270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570901.2"
                     /db_xref="GeneID:3257597"
     CDS             complement(join(619870..620106,620168..620214,
                     620358..620470,620530..620717))
                     /locus_tag="CNE02270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570901.1"
                     /db_xref="GeneID:3257597"
                     /translation="MKKEQRWNQACQAIMEVADLASRYDDDGIDVYFLNNKRVGKELR
                     SSEDVEGLFAGLGPRGITPTGMRLEAILRDYMSRLEASQHTGEEVKPMNLIVVTDGAP
                     TDDPESVIVAIARRLDRGQYPLSQVGIQFLQIGNDPEAREALQELDDELSSEHGIRDM
                     VDTVLFNGEDMSAGLIIKTLLGGINRRLDRRSTA"
     gene            complement(621376..623482)
                     /locus_tag="CNE02280"
                     /db_xref="GeneID:3257738"
     mRNA            complement(join(621376..621524,621584..623018,
                     623082..623181,623259..623350,623402..623482))
                     /locus_tag="CNE02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_570903.1"
                     /db_xref="GeneID:3257738"
     CDS             complement(join(621472..621524,621584..623018,
                     623082..623181,623259..623350,623402..623431))
                     /locus_tag="CNE02280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570903.1"
                     /db_xref="GeneID:3257738"
                     /translation="MAYYPYTAQQGRTFRYRLEPMYAASNVEWAFMNTQLTRDPEFVK
                     QVIRSYIDVKHSHGRTKLEISQKLEPLERAYPQFAQSFVEVRTERGLPKSRIISLRIN
                     PPNSLQRASTTQSPNRPSDPRPGSLRVQTTTNTTRRASAPSQSARPPVVRNPEDGDEL
                     PPPPYSSQDPEPEATRILQERLAAETNVEPPTVPSPSTPQTTSNPAPVSPHPSSPPNH
                     EPTRPSIADSNPPSDPQMAQIWEESQLDEAKRASLAWREQQELEEVMRLSLAEAESIG
                     VGSSTGPGTSTNTQSGQNRLSVVDENEAATYEQASNSSQQPNADLMGLVGDLEDLTFS
                     NSEQASSSNRAPHNQSSILDDDGPSGLNQQPLVPSKTGLVMQSKNPFLSQTEMGTSDA
                     NGSSTHLDNTTSTPAQASANGFNQLSAHGSPGSTHTSYISQPIYAPPPGAPPPHLRVP
                     TPPAQSPLPTQNQTSPSPRPLPRAPVSPRLSSPTVSQTPGPPVYSSQTASSSQQPDSS
                     TVDGDFAAPPLLPRRPNKRKSTYVPPTQGEDPLEMLREFDTVFLVDDRGRQNAAHFYF
                     YFC"
     gene            623675..625856
                     /locus_tag="CNE02290"
                     /db_xref="GeneID:3257517"
     mRNA            join(623675..623998,624071..624170,624247..624537,
                     624594..624722,624777..625002,625055..625856)
                     /locus_tag="CNE02290"
                     /product="arginine N-methyltransferase 3, putative"
                     /transcript_id="XM_024657214.1"
                     /db_xref="GeneID:3257517"
     CDS             join(623723..623998,624071..624170,624247..624537,
                     624594..624722,624777..625002,625055..625760)
                     /locus_tag="CNE02290"
                     /codon_start=1
                     /product="arginine N-methyltransferase 3, putative"
                     /protein_id="XP_024512891.1"
                     /db_xref="GeneID:3257517"
                     /translation="MSYKLTSAAPLSISSSSSVSSDDSDERCSDWASSFGDARQTKSL
                     FDDTVLSTQELALQYDRDNWDFDLKEVCEKLGLDMFGRIRLINLIRNAGLDKDQISAL
                     KADDPLLKDDNLLIPVIPDDPLLQYDFDDFWSDDDEPPQASSAGPSNDAQSPESQKVT
                     LLEAELEKARKDLAAMQLLVTKTIGSEDDESMGRQVKVDGKGKGKAVARDDDTHYFHS
                     YEENDIHEIMLKDTVRTVSYARFLLSNPQVFKGAVVMDVGCGTGILSMLAAKAGAKHV
                     YAIEASGLAVKARENIEKNGFADVITVIQGKVEDVQLPVKEVDVIVSEWMGYMLLYES
                     MLDSVLVARDRFLAPNGLMAPSQTRLVLSAITGDRVCRERVNFWNSVYGFDLSTMNAV
                     GFDEGLTEVVDKEEVVTTESIVRDINSHNATVKSLDFHSSFTLSATSATPTTVRAFLT
                     HFDTFFSPLGGDASHFPPSYPVDIRQFGDDEYTCPVEPLTPSSGKTGVEVSFTTGPGG
                     KYTHWKQVVFLLRKPIELAPGEEIVGQFRCKKSDTNSRELDVEIHWAKGKKGEAGERT
                     YTVQAYKVR"
     gene            625984..626972
                     /locus_tag="CNE02300"
                     /db_xref="GeneID:3257787"
     mRNA            join(625984..626650,626720..626972)
                     /locus_tag="CNE02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_571218.2"
                     /db_xref="GeneID:3257787"
     CDS             join(626015..626650,626720..626947)
                     /locus_tag="CNE02300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571218.1"
                     /db_xref="GeneID:3257787"
                     /translation="MALPSSSCTSLRRSAPGITSTLLSRLPARGQSSPPAPAHPLICP
                     AARAYASPAAASSASSSYPPPPLPSSTSSTTPQAAQSYLASLFSLPPSRQFSPALALQ
                     ILTHKSYRFAHPVRHSPSLSDAQSSIGPESSAPHNARLAFLGRRALSTYLALFVHEAY
                     GSSGALREQGSDFLRGKELEERLTALRHVNNLGRMVGGEWRVEDVLRWDRNQTSQASG
                     NLSVKGQTVEAILGGVFTQFGSPAAHRAFHLHVLPKFVSQLRDPYLVEKVETVREQLE
                     NEFGRGILPRE"
     gene            complement(627678..628954)
                     /locus_tag="CNE02310"
                     /db_xref="GeneID:3257935"
     mRNA            complement(join(627678..627882,627942..627988,
                     628047..628191,628266..628550,628687..628954))
                     /locus_tag="CNE02310"
                     /product="ubiquinol-cytochrome c reductase iron-sulfur
                     subunit, mitochondrial precursor, putative"
                     /transcript_id="XM_570926.2"
                     /db_xref="GeneID:3257935"
     CDS             complement(join(627731..627882,627942..627988,
                     628047..628191,628266..628550,628687..628897))
                     /locus_tag="CNE02310"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase iron-sulfur
                     subunit, mitochondrial precursor, putative"
                     /protein_id="XP_570926.1"
                     /db_xref="GeneID:3257935"
                     /translation="MAAHIGRINLLPTTRTLASGAPLARGISLAVPAAGDAHSHGHDG
                     HEGPRPDIPAAWAFKAGARGHIGRTNALPTPPGFQQRFLSTTRNVPAAASSSATDVPD
                     FSAYRAKNPNTTRNVSYFMVGALGALGASSVKSTAVDMLSNMAASADVLALAKIEVEM
                     GSIPEGKNLIVKWRGKPVFIRHRTPDEIDEANNIDVKTLRDPETDEQRTQRPEWLVML
                     GVCTHLGCVPIGEAGDYGGWFCPCHGSHYDISGRIRRGPAPLNLEIPEYAFNDDEEKI
                     VIG"
     gene            complement(629084..630901)
                     /locus_tag="CNE02320"
                     /db_xref="GeneID:3257700"
     mRNA            complement(join(629084..629781,629843..630492,
                     630549..630901))
                     /locus_tag="CNE02320"
                     /product="expressed protein"
                     /transcript_id="XM_571221.2"
                     /db_xref="GeneID:3257700"
     CDS             complement(join(629134..629781,629843..630492,
                     630549..630795))
                     /locus_tag="CNE02320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571221.1"
                     /db_xref="GeneID:3257700"
                     /translation="MPSLSSFLALLPPQRPVTPFDYNLGFFNAFLTTVILSLPHHGPW
                     RLFRIAIAAPLISAIWGYLMFVPVTESNYDHWGIPILLLSFIFRTYELLVFFPAEEHT
                     HRFIPRSNPRPPLKVSALKPPSSSDDTQPLVPERVPAPYTLAKFYWATSLWWSWRGVG
                     WNYCCPLPSSSRREPYTKGSPRRAYFFSRLTFLAAAWLFYDFMRSLMNLTSARAFFHP
                     NPTLTYTDLTLGQKAIYSIMVVTRTWYGLNLSHVLAALLFVGIGGLMGWEGEMWSPWG
                     WPPLFGNFTELWKYPGLSTMWSRTWQGFNRRWLYVFGWIGISEKVFHLTHTGLSSHPS
                     VPPDSSSSANTPSPSGRVSPNHPIPTSPTQLPSKRMTPMLMFQNLVKSTIVFGLSGLQ
                     HDCGTLVLLMKTHPGKIRYFKDILILTPFFVIQPLALAAEATVKTTWRGWKFRTHPTW
                     KLGKQPGWLIFVERLLGFIWTWVWLGWSAGWFVRGTTEAGAYWMQEGERYPSLVGGLV
                     WNKWTH"
     gene            complement(631288..632195)
                     /locus_tag="CNE02330"
                     /db_xref="GeneID:3257972"
     mRNA            complement(join(631288..631497,631548..631721,
                     631773..631900,631957..632195))
                     /locus_tag="CNE02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657215.1"
                     /db_xref="GeneID:3257972"
     CDS             complement(join(631372..631497,631548..631721,
                     631773..631900,631957..632131))
                     /locus_tag="CNE02330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512962.1"
                     /db_xref="GeneID:3257972"
                     /translation="MSTPLLQQFPSLSSYPPSFLKDLLSSPELTEAFLFTLPEVQQLA
                     AEVEKLGRENEETARRNLELKDELLALRDATAQSYAHAEDLKRQWADIEKSQQNLYQR
                     VRPSFLHLRLRHSLTAQDELSEKIASAFIEGRSATNSRPGSRIDSPAPSAEGLRVDRQ
                     IQGRAIEDFIHEFKAARKIYHKRAIWAERWSRGEVAWRDD"
     gene            632303..635605
                     /locus_tag="CNE02340"
                     /db_xref="GeneID:3257983"
     mRNA            join(632303..632418,632467..632704,632753..633202,
                     633250..633434,633493..633730,633781..633878,
                     633932..634433,634484..634600,634658..635605)
                     /locus_tag="CNE02340"
                     /product="lipid particle protein, putative"
                     /transcript_id="XM_024657216.1"
                     /db_xref="GeneID:3257983"
     CDS             join(632354..632418,632467..632704,632753..633202,
                     633250..633434,633493..633730,633781..633878,
                     633932..634433,634484..634600,634658..635554)
                     /locus_tag="CNE02340"
                     /codon_start=1
                     /product="lipid particle protein, putative"
                     /protein_id="XP_024512893.1"
                     /db_xref="GeneID:3257983"
                     /translation="MPPSPPSSAAADQWNIDYVNEDHLKAFAQALSYNDVQPLDGDSS
                     PLSPRSFSLPPESPQLSTASVKAPPPTWKYGPDNGTLRSGRDTEERVEKLTATSDFAP
                     IHQRVSRKRQRATSQGLTYNVIRWPLLFFIFFIIYLEFSAYVITRQIVNIFEWLVAWR
                     GYKAKLRKELRKAKTYDEWVNTAKKLDKHLGFDDWKDVEEDSYFDWALVRRVRRTLTR
                     LRAANDTRGLMDALAVCVRANFAGTESVKMYSETFIGTKKAVEAHIKEVAACLDYVRT
                     ATDVSLEEKRAFFRAVNKHYGSSALCLSGGASFGYYHFGVIKAFLEADLLPRVITGTS
                     AGGLCAALLCTRTDSELKELLVPELADKITACSDPFTVWFKRFRQTGARFDTIDWARR
                     SMWFTRGSLTFKEAYTKTGRALNISVVPSDRHSPTILLNHLTAPNCLIWSAILASAAV
                     PGILNPVVLMAKDRSGNIKPHNLGGSRFKDGSLREDIPLGSLHTQFNCNFSIVSQTNP
                     HIHLFFFAPRGSVGRPVAHRKGKGWRGGFILSALESYIKLDLSKHFKVIRDLDLMPQI
                     LQSDWSGVFLQRFSGDLTLTPRSTIGDWFHILSDPDRPQMKRMLRVGERVAWPALGMV
                     RNRMTVERAILRGRSEVRTALSHDRTSNDPATSLPETNPELTGALDHVPIESDVDAGF
                     VSRSRRARNKTGSKGGDTPEEQLNLAGVFQLDESSKGVRRRKQKKSGMPLVAEPLGEL
                     PEVSPTHSPIATESPQRNYTSNFGDSFRHVRAPSLPALSSPFRSIRSNTSSSSNNVQS
                     PSSSQRFRSQLSITRWFGGVSESSSDEEDEDLGGLQSGEATASSGEEGIPTFQLDSAV
                     ESHSDRSEDEMLHSGANVKEEYQSEESEGKIPIPGGERVTQEKIDSSMASGERLRPAG
                     GSKGSAKTPPVQDGA"
     gene            635814..638334
                     /locus_tag="CNE02350"
                     /db_xref="GeneID:3257968"
     mRNA            join(635814..636453,636520..636724,636786..636903,
                     636959..638334)
                     /locus_tag="CNE02350"
                     /product="expressed protein"
                     /transcript_id="XM_570930.2"
                     /db_xref="GeneID:3257968"
     CDS             join(636073..636453,636520..636724,636786..636903,
                     636959..638147)
                     /locus_tag="CNE02350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570930.2"
                     /db_xref="GeneID:3257968"
                     /translation="MSSVAHSSLPQFRTKYHASSNGTQDGQPVTAPLPSLPPPEPPTP
                     APGESIKDMDDNVQSHEKIANSSPITLSPRTPSSRPLSPDLPNRDALYLFCNFSSYMR
                     SPHEGCDCISPEDFRDTIRLLDHARFLAAQRRSNVHILHLKYRFQGQHKTFRSPHSFA
                     NNQLPFNHRDNAGRARNPVPQPFAVLHDPVMKIDYMENGIFEPLPAQAIFSHIAKSCQ
                     PPPRIIVISYVHSKVTENHLSSLSTWAITSSPPMYIFSPIETRLREQRPLHLALNHAI
                     PMSMYAWPLEAQLSYEADRPQCRSVRSSSTGIRANWEHYRKASEGSPILLTRRISEQN
                     TPVVNKQSHLDSSSRKTRYPPDPVASLTIIMSSLETLSIIKDKGDGNKNSAPNSAPLP
                     WCVPSQSLTSKIPSIDRIPLWQLAPGVGILHGSTSASIGIHISDFSAINLVGESGDVK
                     QGEADKKIKEREVEGLGIKTEVMGMNELRATDGTGVTSEALEATALLERPISRPSSTA
                     PVPVGAPGAKTGSSTNTHATAYPTTHLTRSDPSTKSIARPWRSLSSQSWPAPVSKAPG
                     WRKGRKEMMEDTLEELGLGHTETELEHEILQEAVDPALNTEGISLSCGTVTEEESNLL
                     NLLMCR"
     gene            complement(638170..639498)
                     /locus_tag="CNE02360"
                     /db_xref="GeneID:3257844"
     mRNA            complement(join(638170..638413,638462..638898,
                     638950..639062,639111..639228,639297..639330,
                     639403..639498))
                     /locus_tag="CNE02360"
                     /product="casein kinase ii beta chain (ck ii), putative"
                     /transcript_id="XM_570932.2"
                     /db_xref="GeneID:3257844"
     CDS             complement(join(638344..638413,638462..638898,
                     638950..639062,639111..639228,639297..639330,
                     639403..639446))
                     /locus_tag="CNE02360"
                     /codon_start=1
                     /product="casein kinase ii beta chain (ck ii), putative"
                     /protein_id="XP_570932.1"
                     /db_xref="GeneID:3257844"
                     /translation="MEDLSTGSESDYADSWISWFLSSKGNEYFCEVDEDYILDRFNLT
                     GLNAEVVQEYSRALSLITDNLNEDDLDDDTREGIETSARFLYGLIHARFIVTTRGLAK
                     MLEKYRKADFGRCPRVYCYSQPLLPVGLSDIPYQKAVKLYCPRCEDIYSPKSNRHGSI
                     DGSYFGTTFPHMLFMVYPQMIPGKGQPVGSSVADVNRSLVSAGQSREGGAGISTSAMA
                     LKAEMFEPKIFGFKVNEDAKLARWRTARRDTQISRLEAQEHEQEQEKEKKSSV"
     gene            639856..640635
                     /locus_tag="CNE02370"
                     /db_xref="GeneID:3257892"
     mRNA            join(639856..640116,640188..640264,640329..640427,
                     640484..640635)
                     /locus_tag="CNE02370"
                     /product="FK506 binding protein 2, putative"
                     /transcript_id="XM_570934.2"
                     /db_xref="GeneID:3257892"
     CDS             join(639965..640116,640188..640264,640329..640427,
                     640484..640581)
                     /locus_tag="CNE02370"
                     /codon_start=1
                     /product="FK506 binding protein 2, putative"
                     /protein_id="XP_570934.1"
                     /db_xref="GeneID:3257892"
                     /translation="MYHPKALIIALLFSLSLILAAKSAEQLQIGVKYVPEECPVKSRK
                     GDRLSMHYTGTLAKDGSKFDSSLDRNRPFEFTLGAGQVIKGWDQGLLDMCISEKRKLT
                     IPSHLAYGERGHPPVIPPQSTLVFEVELLGIKNRHVDEL"
     gene            complement(640603..642355)
                     /locus_tag="CNE02380"
                     /db_xref="GeneID:3257837"
     mRNA            complement(join(640603..640798,640862..641201,
                     641263..641610,641669..641747,641814..641899,
                     641962..642083,642144..642355))
                     /locus_tag="CNE02380"
                     /product="expressed protein"
                     /transcript_id="XM_570936.2"
                     /db_xref="GeneID:3257837"
     CDS             complement(join(640662..640798,640862..641201,
                     641263..641610,641669..641747,641814..641899,
                     641962..642003))
                     /locus_tag="CNE02380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570936.1"
                     /db_xref="GeneID:3257837"
                     /translation="MRGTRLDLQPLTPEDIPDPETPEFQLFLNNHFALGVKLIETMSD
                     WNRHSSKHDSTVQILNLPSSSSFKHIRETLGVKEFWCGRESRHTEESLRNIPHHPPSH
                     VAPQTDSTTRRDSFNPIGLVRSLSHRFSRQSGESHIGQTTGNPDGEQQDGNVPEETRQ
                     AQVMSCTPDGLYERFRRGLLEYHSQNEREYIEACRETECLHVYKKHVAEVWRLTYKTP
                     PPTNPRTFVVLLLSRELISEPHGERAFMNISLPFSHPGCMEKKGNESKRVRGRYVSVE
                     RVQEMDKGRQVEWRMATSSDAGGNIPRFVTNSSLPNSIAEDVPSFLSWMVNRFPEGGE
                     VASEHVDAT"
     gene            complement(<642503..643784)
                     /locus_tag="CNE02390"
                     /db_xref="GeneID:3257896"
     mRNA            complement(join(<642503..643346,643405..643458,
                     643509..643784))
                     /locus_tag="CNE02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_571220.2"
                     /db_xref="GeneID:3257896"
     CDS             complement(join(642503..643346,643405..643458,
                     643509..643606))
                     /locus_tag="CNE02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571220.1"
                     /db_xref="GeneID:3257896"
                     /translation="MAAVNYTIEDPNTVPWIKTPLVRSAALSKLAGCEILLKLENIQP
                     SGSFKSRGIGNLVLQSVNSAPPDTPLHFYSSSGGNAGLACVNAASTLGYPSSVIVPLS
                     TKPFMIDKLRTAGATEVIQTGQTWFEADKHLQEEILARDPNGIYLPPFDHSDIWQGAA
                     TMVDEIVQELTHVPDAIVCSVGGGGLMIGVCKGLERLDKEKKAKVVAVETLGAESLHK
                     SVKAGQLITLPGIASLATSLGATTVAAKALEYALQPQVRSTVVSDKEALEACIRFLDD
                     ERILVEPACGATLAMVYSGKLKDVLKLDAKSKVVLVVCGGSNISLELIEGYKKMF"
     gene            complement(644135..645811)
                     /locus_tag="CNE02400"
                     /db_xref="GeneID:3257905"
     mRNA            complement(join(644135..644282,644334..644410,
                     644465..644544,644608..644723,644784..645034,
                     645092..645168,645223..645261,645320..645358,
                     645417..645458,645526..645811))
                     /locus_tag="CNE02400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570938.2"
                     /db_xref="GeneID:3257905"
     CDS             complement(join(644202..644282,644334..644410,
                     644465..644544,644608..644723,644784..645034,
                     645092..645168,645223..645261,645320..645358,
                     645417..645458,645526..645737))
                     /locus_tag="CNE02400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570938.1"
                     /db_xref="GeneID:3257905"
                     /translation="MFIPFSRLFQTIARPFAPLPSRPLPIRIASGRIYLRTMSTETPI
                     VPTSPSSVADPLGKGKYIQTAGCIIVGDEVLNGKTKDTNSNFFAQYCFDLGIELKRIE
                     VIADDEDEIIEAARRMTEKYDFVVTSGGIGPTHDDITYASLAKAFNLPLVHHPETLRR
                     MWALTTPERRAELEKATPAQREARERMALFPTQKEEGDVKTEVIFVDADKWVPVVRLA
                     GKLCVFPGIPSLFQQLLLALTPYLPLPPASSKPFRHLIYTSKPESAIAPYLTELQARV
                     KKEGIRIGSYPYLYQGVHVSLIGHDIERIKELGREVIQEVHGKVVAEGKLGDDSTLTT
                     SKM"
     gene            646019..648820
                     /locus_tag="CNE02410"
                     /db_xref="GeneID:3257691"
     mRNA            join(646019..646504,646569..646619,646665..647014,
                     647072..647101,647151..647282,647332..647572,
                     647628..647942,647992..648353,648407..648496,
                     648553..648820)
                     /locus_tag="CNE02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657217.1"
                     /db_xref="GeneID:3257691"
     CDS             join(646370..646504,646569..646619,646665..647014,
                     647072..647101,647151..647282,647332..647572,
                     647628..647942,647992..648353,648407..648496,
                     648553..648688)
                     /locus_tag="CNE02410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512897.1"
                     /db_xref="GeneID:3257691"
                     /translation="MSQFQNDFPAPSSPDSAPKSGAGAADARPQRSRDGCLTCRSRKV
                     KCGEQRPICDRCRIKSRECVWPSEDEAERRRNKKRKASGARAPYGSSYYGSMYSDQDE
                     TSPVHLPAVSVPVEMRRPPKHAIKGTVHVPPNFLPPEAMAGQQVDAKGKQKLKDERRD
                     ELVDWLVPEKLRAEMMMEPTFLQPYFRTVDERLVMRHYISKTVHIIIAFESDHRPWNP
                     WLSIHAPLAFQHLPGTKPAADALRAAILAVGGVHLQYSNSPDDRSAAYRITKSAKVQV
                     LKLVKETLQSPDGRPRQLTKEDIELVLASLLSCTIASSLAADDSWHHLLSSVLGLIDQ
                     LGGAHHILRDAPRDRLSPYRFFMEQLAIRDVFGCMTTELAPSILQDAFTPWFFEAESW
                     SRTDVEWESVERMFGISRGMVDMIARVCTLIAAVRTRGRPIFMDPDDSPSLLPTDPNP
                     SAPPSNLTELQLAAQNLMAEIRVWDEAENFTPLHPRTQYGNLAYRHAIKIRMLRKVYD
                     VPSDDERVASSAESIIELAAEMLAFYGKITWLTWPIVIAGFEIPRGHPSRQTALGMLG
                     AFGPHACFDNRAGARILSDYWMWHDMDGDHATSWEMANILNQRPFLD"
     gene            complement(648794..650088)
                     /locus_tag="CNE02420"
                     /db_xref="GeneID:3257916"
     mRNA            complement(join(648794..649805,649862..649924,
                     649987..650088))
                     /locus_tag="CNE02420"
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /transcript_id="XM_570942.2"
                     /db_xref="GeneID:3257916"
     CDS             complement(join(648927..649805,649862..649924,
                     649987..650076))
                     /locus_tag="CNE02420"
                     /codon_start=1
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /protein_id="XP_570942.1"
                     /db_xref="GeneID:3257916"
                     /translation="MSFVFPSWSTAFSPAFHEDAKAMLEGALNKGDKPPVIQGKIEVV
                     ELHMGEQPPTLTLLEIGDLSIDRFRGILRLGYQGDAWLEVRCRVQANPLSHNPHLTFS
                     TLPLSTPLLASQPLLVPMTLRLSKLHLRAILILVVSASKGITLVFKNDPLQNVDVSST
                     FDSVEVIRGYLQQEIEGQLREMFREHLPGIIHRLSQKWFSGSGVGGKVEMPYRDMSPV
                     PSYAPINEEVEEEENEENHGTSPGNEESFPPRHIGPGGITLPLNNSVSQLAALSYSAH
                     TLSPYARGHEHIAVRSFPYLGKSGAGTGSSGRASLASSSVGEGDIKAKRKRIFRIGKS
                     KEADEKSEA"
     gene            650259..655444
                     /locus_tag="CNE02430"
                     /db_xref="GeneID:3258001"
     mRNA            join(650259..650356,650411..650510,650568..650812,
                     650865..651042,651098..651705,651763..651876,
                     651927..652202,652255..652336,652387..652566,
                     652614..652771,652822..652894,652951..653082,
                     653139..653200,653249..653459,653510..653665,
                     653723..653870,653925..654087,654139..654452,
                     654504..654647,654699..654777,654834..654879,
                     654926..654973,655027..655195,655252..655444)
                     /locus_tag="CNE02430"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_024657218.1"
                     /db_xref="GeneID:3258001"
     CDS             join(650291..650356,650411..650510,650568..650812,
                     650865..651042,651098..651705,651763..651876,
                     651927..652202,652255..652336,652387..652566,
                     652614..652771,652822..652894,652951..653082,
                     653139..653200,653249..653459,653510..653665,
                     653723..653870,653925..654087,654139..654452,
                     654504..654647,654699..654777,654834..654879,
                     654926..654973,655027..655195,655252..655408)
                     /locus_tag="CNE02430"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_024512898.1"
                     /db_xref="GeneID:3258001"
                     /translation="MSARSPRGPATEDEFSHQIAIEMSRIMNQVNPNDLLGKRIVDIA
                     KGNRTGDAFLRAVSTFGQFPSEPMLSLHTRILAHLSVLQGQNQSGARRRSEHSPPRML
                     GGRPVGENVEGMDHDDTDTLAPEPVRKGGLRRADNAPKFKAPATARPSLLGLDKLAAE
                     KRAAAAATADRNGPPSKKARKDEGNEDDEQSGGVFKVPTIPIRRDNVRVRPEETPSRG
                     SGLSEEARARLEARRRERNQPSTGISASTADREHSREGLGDFQRRANRDRWNERGGER
                     EPGQGEYSRDGRGGGNDWGRRQNGRDGKPWNAAPTPRTSRADRDFDGGSARIPNRGWD
                     ETPRGSRGPGGWGKGERTSRGWDQTPRSARESPEGGGLDLNAKEWEEEQVKLDRDWYS
                     YDDEGAVAADDDHNPFSQWENLERAKEEELQAKAVKRQTARQAQFNADNDLWETNRMQ
                     TSGVLQRGGVDDDFDDDSDSKVHVLVHDLKPPFLDGTVAYTKQLDPINPVKDGTSDMA
                     LFSKKGSALVRERRERQEREKAAAKAASIAGTTLGNLMGVKDEPDLGQEGQKDGVTEN
                     YKADSQFSSHLKKSEGVSNFAKSRTLKEQREYLPAFAVREELMGMIRDHQVLVVVGET
                     GSGKTTQLGQFLYEDGYCANGMIGCTQPRRVAAMSVAKRVSEEMECTLGETVGYAIRF
                     EDCTSKDTKIKFMTDGVLLRESLNEGDLDRYSVIILDEAHERSLSTDILMGLLRKILT
                     RRRDLKLIVTSATMNAEKFSQFFGNAATYTIPGRTFPVEIFHSKSPCEDYVDSAIKQV
                     LQIHLSSSQGDILVFMTGQEDIECCCQVIEERLSQLDDPPPLAVLPIYSQMPADLQAK
                     IFQPTPDGRRKVVVATNIAETSLTVDGILYVVDCGYSKLKVYNPKVGMDALQITPISQ
                     ANCGQRAGRAGRTGPGFCYRLYTETAYLNELFASNIPEIQRTNLANTVLLLKSLGVKN
                     LLEFDFMDPPPQENILNSMYQLWVLGALDNVGNLTSIGRKMSDFPMEPSLAKMLIVSV
                     DYQCSSEMLTIVSMLSVPSVFYRPPQRAEESDAAREKFFVPESDHLTLLHVYTQWKSN
                     GYSDSWCMKHFLHPKLMRKAREVRGQLEDIMKQQKMDLLSVGTDWDIVRKCITAGYFH
                     QAARVKGIGEYMNIRTGLPCVLHPTSALYGLGYMPDYVVYHELVLTSKQYMMCVTSVD
                     PYWLADLGSVFFSIREKNFDALARARANRDFSKKTEMEAEMARQREEMERAKAEKIKK
                     EAVAKTPRIGGVGVAYTPKSAGIGAGARSSATPRRRAGGI"
     gene            complement(655426..657071)
                     /locus_tag="CNE02435"
                     /db_xref="GeneID:36392867"
     mRNA            complement(join(655426..655631,655703..655976,
                     656030..656310,656372..657071))
                     /locus_tag="CNE02435"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658528.1"
                     /db_xref="GeneID:36392867"
     CDS             complement(join(655566..655631,655703..655976,
                     656030..656310,656372..656746))
                     /locus_tag="CNE02435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514378.1"
                     /db_xref="GeneID:36392867"
                     /translation="MAVPRPPPDLGGNTFIFGADSSKKRPGLVPGKVQSGISPHSQAQ
                     DLSNTTSISTPAATLPWLEIAGLGTGEENYWGKEAPKPQILPQGMSYAGPMGAYPMLY
                     TPHKRGFWAKISDWWDGEPYQGNPTLPRSTPKQHRPIPGIANGVTPTAAAPYAPLAKT
                     LQNPAITPAFNSLPRWERKLIEKQQKAEIKAWKKMEKEQTKLYKRSLKFTIREERRNL
                     KAMEKELKKNNQFNHAHIPLHNGQRPLPQVSDHAPEEPKPKLEPEKPKKEMLAFMMLP
                     QEEFGVRRPLGGDGMPKGLGGRHHWPMMSRTMTHALINLGNDEKSYTVRPMRMPL"
     gene            complement(657237..659300)
                     /locus_tag="CNE02440"
                     /db_xref="GeneID:3257484"
     mRNA            complement(join(657237..657618,657676..657847,
                     657899..658337,658393..658502,658565..658714,
                     658767..659050,659117..659300))
                     /locus_tag="CNE02440"
                     /product="la ribonucleoprotein, putative"
                     /transcript_id="XM_570946.2"
                     /db_xref="GeneID:3257484"
     CDS             complement(join(657350..657618,657676..657847,
                     657899..658337,658393..658502,658565..658714,
                     658767..659050,659117..659246))
                     /locus_tag="CNE02440"
                     /codon_start=1
                     /product="la ribonucleoprotein, putative"
                     /protein_id="XP_570946.2"
                     /db_xref="GeneID:3257484"
                     /translation="MSAEQAVASIPEESKEVELGPLPTVEGKSEDEVKELLTKAAKQV
                     RFYFSDSNLPVDKYFFSLTCCNAEGWVPIKTISTFKRMKDFQSLGVPFVAYALRLSIK
                     EDGNDPLVAVSEDGENVRRKRPLEKNTTAWDRSVYIKGFGEEETEANTQEKIEAYCDQ
                     FGKINAVRMRRGDIEGKGAAGKGKGQFKGSVFVEFAYEADAKKFAEQESIPKFTPDGP
                     EMTFMSKDAYVKMKAKEKGIPEGDINRGGQSKSKPEGKFNAFREMERAKHGQLPSLAK
                     IPDGVAIVGSRPEMKNLKAGENKKKRSREDDDEEREGKEARTDEPEPLVIEYNGASLE
                     CDRHTGKVLDRSKVAFEINSAVKFINHGENPDWKDLKAQVSNVIASPFLAFPPGSSSG
                     TIAKSDNSVINDEEFEKLKEAKMTFGGAEVEWARMAEEEHRDFWYTRACFKGKQAAQA
                     LNEKEEKEKRGRGGRGGRGGGRGGRGRGGRGGRGGRGGKGGRGGRDGRDGKEDNSAGF
                     PPKLATGEQ"
     STS             658152..658966
                     /standard_name="Pst22"
                     /db_xref="UniSTS:470800"
     gene            659619..662707
                     /locus_tag="CNE02450"
                     /db_xref="GeneID:3257833"
     mRNA            join(659619..660023,660081..660381,660437..660752,
                     660809..662707)
                     /locus_tag="CNE02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_570948.2"
                     /db_xref="GeneID:3257833"
     CDS             join(659820..660023,660081..660381,660437..660752,
                     660809..662498)
                     /locus_tag="CNE02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570948.1"
                     /db_xref="GeneID:3257833"
                     /translation="MTRKIQKTSTVTSAAAALAALPRAFASTPAARWGHQGVYVKSKK
                     AMYIVGGETSASGYQITNEVLVLSLNSSSPSFTTGSSDGLPAHAFASAALSNDENSLV
                     VMGGMTSDCSSDGLAHTLDLSNDDEWTSTSPSKFTRRRGAGMAWVDNNSTYGEFMVIG
                     GIADSYSCSSSTSAYTAADVLSLPLSSSALVSSRSLPKSLTGSTLAVSDFGLASDSSG
                     KIYLAGGQSSSGDLVSLDTIGVWDSTNGWQSQTTSGDVPDGRVGASLVAHPNLDMLVL
                     HGGSVSNSTSGSYSSTSLLAFLNTTTFEWSTPSNLQPPSSSAASYHSAVMTDQGVMIS
                     AFGLSASGAPRSDVYYLDLRDTAKTSWAWKSSWNSDMLEAYSGSSTSANGTANGVTAA
                     DAKSSSSMSSKKLASIIVPILVVALLLTPLIVYLIRRRVRVIKKRRMAQHFSFSSQED
                     SGAFNFRTPFNQYLAKRRSEGQFPVGGDSSEREGNFVTGVTGTLGRMVSRLSNRSSDS
                     GHEDARESGEEGQRQMAQVGQRVMINLDDAQPMNWEEIDFGLGKLDESKGHGSSHDAN
                     SRAFVQDRQNSVPSAAEGYTADQLYALEEVPSEAENVHAQIIPNTLVTAYPVMEPSPA
                     YTPHQAGDWTKLQEDLTQKPAFQKISPSAQLRSHSHPAPAAISPFADPTLASETLAIN
                     RSSSLTRTISQAPSIAPSIPPFEFQRAESPGGTITLVNPQTAAQTQEILPFASAKGAN
                     GTHRSVSQPITRQLIDGRLARRESAPSSSGSHSGSESGEAQPTKTLSHAKGRTVSANH
                     APQVRRSSSSSAGTVKYPSASRRKTQLRVVNLTESEEH"
     gene            663179..665911
                     /locus_tag="CNE02460"
                     /db_xref="GeneID:3257634"
     mRNA            join(663179..663614,663681..663749,663816..664098,
                     664156..664171,664228..664306,664362..664741,
                     664796..664857,664910..665080,665133..665216,
                     665280..665309,665368..665911)
                     /locus_tag="CNE02460"
                     /product="expressed protein"
                     /transcript_id="XM_570949.2"
                     /db_xref="GeneID:3257634"
     CDS             join(663465..663614,663681..663749,663816..664098,
                     664156..664171,664228..664306,664362..664741,
                     664796..664857,664910..665080,665133..665216,
                     665280..665309,665368..665699)
                     /locus_tag="CNE02460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570949.1"
                     /db_xref="GeneID:3257634"
                     /translation="MPGLDVPSRPSQVVNLNGSSEDLQRSNVTADVHSGDKSQEEARP
                     MPWGAKWRSSAWFITLVVTLGTTTDILTYTIVVPVLPYRLQDMGYSNVSALTSWLLFA
                     YSIGIFLCTLPVAYFFHKYPFRRIPLIVAVIVLELSLILFMLATPYWAMVISRFLQGA
                     SSTVVWSVGFALICENVEEKNIGRQIGFAMAGVSIGQTIAPPIGGALYSKMGWYAPFI
                     FCIIVCFVDLVLRLFVLERTDLRKWEEKRLGLAPGSLQPKVVDGQVIMSSEVEASPFM
                     HLTTAEKERLAGVELSPWQVLIALGSSPRGMTSFLTMFAFGMIIGALEPTLTLHVQSV
                     WNKNADFVGLVYLAAAAPTFFCGPIVGALADKYGAEWIMLPSIILTLPWLPLMLLNNS
                     LAGFIIFFAFANLFPNCAMAPTGLEVTMVARDVVGVSEIHQFAAMNIAFAISTAIGTI
                     VGGQIYDHIAKGWAAVIWFCFAMAVVIIPLLFFFAGNKSIYQRCFHRGKETGAKMEEA
                     VGEAGVGQQTKDESARVVTERQHSITPSSSEKFEDRDVISCQQ"
     gene            complement(665731..670232)
                     /locus_tag="CNE02470"
                     /db_xref="GeneID:3257964"
     mRNA            complement(join(665731..665995,666050..666276,
                     666329..667362,667414..667633,667686..670028,
                     670086..670232))
                     /locus_tag="CNE02470"
                     /product="vacuolar membrane protein, putative"
                     /transcript_id="XM_570950.1"
                     /db_xref="GeneID:3257964"
     CDS             complement(join(665944..665995,666050..666276,
                     666329..667362,667414..667633,667686..670028,
                     670086..670202))
                     /locus_tag="CNE02470"
                     /codon_start=1
                     /product="vacuolar membrane protein, putative"
                     /protein_id="XP_570950.1"
                     /db_xref="GeneID:3257964"
                     /translation="MPSSQSRSGKGICAMRGTCGKTSMFGADLPCPDDSDATVPDQRL
                     LDLMASVCGPSYSLPDHVCCTYDQLSTLSDRLQQAAPLIASCPACINNFRSFYCDFTC
                     SPNQSTFLSVTATQKTTEGKDAVKEVDYEVSSDFKQGFYDSCKDVQFGATNGFAMDLI
                     GGGATNASGFLKYMGDLRPGLGSPFQINFPDNDDSAYRRAPLSCSDAENINARCACAD
                     CPSVCPSLPYIAPPSTKQCHVGAVSCLTFSLLIIYSVIILVGALLYIWKQAARHRQRR
                     YERVALLDPPHSPTIQNGQGSGLDGLMGRNDDAESGPSGSIHFRLGRGASLLDPMEHL
                     QPKQNKINATLRRFFYRLGLTCAKRPIEVFAISALIVGLFNFGWKYFEVETDPVRLWV
                     SPTSESASQKQFFDDSFGPFYKSEQIFITQSSGSPVNYDTLDWWLKVETEINALKTSD
                     GIGLEDICFAPAGKGTPCVIQSVSAWLGDDMEVWGEEWESRVRDCASRPGECLPPFGQ
                     PIDPKLVLGGANGDWLEAKALVVTWVVNNYNDERVEPAEQWERKLRDYLRDLKRPGIK
                     ISYSTGVSLEEEINKSTNTDVKIVVLSYLVMFFYVSLTLGGGLPPSMIQAFTHRAYRL
                     VFRIGVLLHLVKDAPLEESAPPPDFRVIPTLLSVNSKFSLGLFGIVIVLIAVSSSVGL
                     FSLLGVRVTLIIAEVIPFLVLAVGVDNVFILVHELERQNNLHAAQQPGDDESVHSNGA
                     QPSGTFLAPEERVARAVARMGPSIMLSSVTEVVAFALGALVPMPAVRNFAIYAAGSVL
                     FGAIMQCTVFVSAMTLDLRRSESMRIDCFPCIRLRPPIGLYDNEAPSREGMVKKFMRT
                     VYAPSLLRHEVKQLVLVAFGGLFLAAIIGIQHISLGLDQRLALPSESHLVPYFNDVDS
                     YLDVGPPVYFVTEGGDPSSRHGQQQLCGRFTTCLELSVANTLEAERKRPDSSFIASPP
                     AAWIDDFLQWTNPTFESCCRVRRRDPTIFCSPKDSERLCRPCFEGQKWDSTMDGLPEG
                     EDFMRYLEQWLISPTNDECPLGGQAPYSAAVKLVSSNTTVAASHFRTYHTPLKSQADF
                     INALAAARRISDDITHRTGVRVFPYSLFYVFFDQYEHIISMAIQVLFLAFVAVLVITS
                     TLLGSWRTGGTVTFTCALAVINVMGVMGYWGISLNAISLVNLVISLGIAVEFCSHIAR
                     AFMGAGSGLPLDKVEGRKERDERAWTALVDVGPSVFSGITMTKLIGISVLALTRSKLL
                     EVYYFRMWLSLILSGALHGLVLLPVLLSYLGGQGYPLEDTDEDWVTSQMRRPMDYEYA
                     PFADTDSVDD"
     gene            670422..671347
                     /locus_tag="CNE02475"
                     /db_xref="GeneID:36392868"
     mRNA            join(670422..670534,670582..670631,670689..670901,
                     670955..671347)
                     /locus_tag="CNE02475"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658529.1"
                     /db_xref="GeneID:36392868"
     CDS             join(670527..670534,670582..670631,670689..670901,
                     670955..671112)
                     /locus_tag="CNE02475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514379.1"
                     /db_xref="GeneID:36392868"
                     /translation="MLYALGFIVFLVIVLVVWLVRLAVLRANRKRNAAAGRVDPEVQF
                     REVAEQVFSGRCQSSPHNGYSPYCRRNDRGAVIRQANGSEASLPAYGAESLPVPPEAA
                     YQPSQTRIRPDQTALNSVDIPEVPPPKYTAEPEPVSATRT"
     gene            671696..672960
                     /locus_tag="CNE02480"
                     /db_xref="GeneID:3258005"
     mRNA            join(671696..671826,671892..672176,672221..672789,
                     672837..672960)
                     /locus_tag="CNE02480"
                     /product="ATP binding protein, putative"
                     /transcript_id="XM_024657219.1"
                     /db_xref="GeneID:3258005"
     CDS             join(671787..671826,671892..672176,672221..672789,
                     672837..672917)
                     /locus_tag="CNE02480"
                     /codon_start=1
                     /product="ATP binding protein, putative"
                     /protein_id="XP_024512899.1"
                     /db_xref="GeneID:3258005"
                     /translation="MSTSSRCLVRGSVNIDEFFHLPHIVRPGETISSTGLTKRAGGKG
                     ANQAFAVARAGGQVELDGAIGDDGIWVKEMLESAGVGIGKLKVVKDEVTGRAVIQSAA
                     DGENSIVLHAGANYYLPSPTPATSLSTYTHLLVQNEVPLSSTLAYLTAAGQSSPPLTS
                     VFNPSPMLTPAQLREFPWKHLSWLIVNEGELGDLLLAFGSSANPGEAKEDELQAKASA
                     GILELHENEYFSKNVGIICTLGAKGILYYEPGKEVGYLPAAKLQNPVKDTTGAGDCFA
                     GYFVAGLMGGKSLQDALKTCLVACGICVENEGAMESVPTLEAVNERLA"
     gene            complement(672932..674594)
                     /locus_tag="CNE02490"
                     /db_xref="GeneID:3257933"
     mRNA            complement(join(672932..673179,673228..673559,
                     673613..674230,674312..674320,674394..674594))
                     /locus_tag="CNE02490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570952.1"
                     /db_xref="GeneID:3257933"
     CDS             complement(join(672990..673179,673228..673559,
                     673613..674230,674312..674320,674394..674531))
                     /locus_tag="CNE02490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570952.1"
                     /db_xref="GeneID:3257933"
                     /translation="MPGELAFKSGADLGAVRAALPLDHLVPYLEKNIEAFKGPVEVKQ
                     FNFGQSNPTFLITPSLPSHPFVLRRAPSGKLLSSTAHRVDREYTILAALNRYNSVVSP
                     AHVVPVPKVYCLCEDKQVVGAAFYVMEYVQGRIFTDVRMKNLGQEERWSCWRSAIDTL
                     TRLSTIPLSALQLPPSFAPSSSQKPYFPRQVKSLLRVSDVQSEARSEQTGEQLGHIWG
                     TREMRPWFEKGANLIAAQESRSGIDSVVHGDFKIDNLIFHPSESRVIGILDWELCTLG
                     SPLADLGNVLLPFSFPPISPEQRQALSSKLDGKDKEDLNLLLGLKGVSSEETGIPQRE
                     ELEKWWVDGMIRGSEYHKNRQAVWKWPISGMEWVRSWMLFRLAIIAQGIAARAMLGQA
                     SSADARADSRPVFDFYGKAAWNIKNEVDDDVVKAKL"
     gene            674819..676792
                     /locus_tag="CNE02500"
                     /db_xref="GeneID:3257629"
     mRNA            join(674819..674897,674948..675724,675772..676508,
                     676558..676792)
                     /locus_tag="CNE02500"
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /transcript_id="XM_570953.1"
                     /db_xref="GeneID:3257629"
     CDS             join(674867..674897,674948..675724,675772..676508,
                     676558..676761)
                     /locus_tag="CNE02500"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="XP_570953.1"
                     /db_xref="GeneID:3257629"
                     /translation="MAPRKTVGILGGGQLGRMLTHPAALLGIPLLILDSGSYTPAKQT
                     LLPPPPHSHPDGPFTSETHIRKLASACDILTVEIEHVNADVLEAVEKEGLCEVQPSPQ
                     TIRLIQNKYDQKKYLAERGVAVAPFEELPANPTEEDFKAIAGRLGLPLMLKAKTLAYD
                     GRGNSPLKSASSGDIQASLKFLGDRPLYAEGWAPFVKEVAVMVVRNKEGEVRSYDAVE
                     TIHRESILRVCLAPLRGEKGVNQRARELAEKAVGHLEGAGIFGVEMFLMPDGELLLNE
                     IAPRPHNSGHHTIEACLTSQFENHLRAILSLPLGSTALRVPSAAMVNILGASSTMDAI
                     DKMADNALTVPGAAVHLYGKAESRKARKMGHITVTAESDAELNERLRALLFAQPDAHA
                     DWIDLIAPPSPAPAHSHAKPLVGIIMGSDSDLPVMHPATKILEKFGVPYELTITSAHR
                     TPERMVKYAKTAADRGLRAIIAGAGGAAHLPGMVASETSLPVIGVPVKASVLDGVDSL
                     YSIVQMPRGIPCATVGINNSTNAALLAVRILGTSVPALNKATEEYSKALEEEVLAKAD
                     ILEEEGWDKYIERLKK"
     gene            complement(676803..679772)
                     /locus_tag="CNE02510"
                     /db_xref="GeneID:3257927"
     mRNA            complement(join(676803..678949,678998..679261,
                     679325..679440,679493..679772))
                     /locus_tag="CNE02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_570954.1"
                     /db_xref="GeneID:3257927"
     CDS             complement(join(676858..678949,678998..679261,
                     679325..679440,679493..679606))
                     /locus_tag="CNE02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570954.1"
                     /db_xref="GeneID:3257927"
                     /translation="MADDIRSWITKVLIDHDIRYGANFKVPVKCKHYCQLLKFYTYRD
                     DRNPRAQIEGSIGDRTHRVKVVFDPEETDKFEQPDPDTGYKHSLTSQLRSIFQIKEFH
                     IHIAPPSPLAGTKIPIVTFFVTKWDVVSGNHDEPVYWLDTCKIGEGNNDGKVRDVLKK
                     WWSGESNSESSQNRSSQNILSQGNIPDMSISAARPRGNKDVAHYYRTTVALGDIVSIE
                     EAKASRVGEWDAQSALAWLERNQDTVLNTHAQYRNYPSNNAETIKSLQHSQGKTVQEP
                     SDHGYPPESQPIEEGISRNSRSPHISNRRSPPGSSQSHHISSSSLLHASPTKCQFSKE
                     KITDPLNFPSSPATNMSPGNTDEELLSPYEREERRKRSRKSKAIREDGNKELEQSSPS
                     PSQLSQLSWLSPPSPTMATPRKSGAELSRGDRPVPELSPSGNATISNARDKWKRPRES
                     LNSKGQSRIVVWDEDEDSDEEPMVKNGLKRKIILSSSEPSPQVIEIQDSSGDEENFAQ
                     TSSSLTTKRSTKGDAERTIMAQQDTMLRTREATRPIKTPSSSSGLNGISADRRTCTDG
                     DKREENGRGKGGNALGGEEKTMVEEKEETGIGEEEDEEEDEEEEQEEEEEEEEKIEED
                     EEEEEEIEEEEEKIEEEEEEEEIEEEEEEEEEEEEEEEEEEEEEEEEEGEEEEEEEEV
                     EVEEEEEEVEEVEEMEEEEELKDDREIEGKKEEEEQQTGEKKEGIQVKLGEKRTEGGV
                     RGRTMKKTEISIKEENDDVDGNRVQRRLENERLARMDVLRMEKEMDEAHTPPVLERGN
                     EILRRKRKHRAEDPTSNQHVPKFGGFKLDMTLREGGLDEACVLQMLEWAREKRQEIAK
                     RSKKP"
     gene            679875..681118
                     /locus_tag="CNE02520"
                     /db_xref="GeneID:3257513"
     mRNA            join(679875..679962,680007..680039,680101..680140,
                     680193..680249,680298..681118)
                     /locus_tag="CNE02520"
                     /product="superoxide dismutase copper chaperone, putative"
                     /transcript_id="XM_024657220.1"
                     /db_xref="GeneID:3257513"
     CDS             join(679936..679962,680007..680039,680101..680140,
                     680193..680249,680298..681037)
                     /locus_tag="CNE02520"
                     /codon_start=1
                     /product="superoxide dismutase copper chaperone, putative"
                     /protein_id="XP_024512900.1"
                     /db_xref="GeneID:3257513"
                     /translation="MTLATASFNTEFAVDMTCQSCVNAVSGALRDVPGIERYDIDLEN
                     KRVTISGKTPPSHLITALKSTNRQVIVRGTSSSANANFPIQAAVAILESPLPLPASLA
                     STSNPVLAGLPEGSLKPLPGMNEEEYSQKVFGICRFVQIAPKTVLMDLTVRLPPPSRV
                     GLGTAQGAQDTSYSVYIASTGNLVNPPVTTGKPYISLGSITPDKDGYGDMFKEVDGEL
                     WEWIGRGCVVQAANETAPAVTQLVAKEAAPGSEQNEATIGRLFAGVVARSAGAWGNDK
                     TVCACSGKTMWEEGREMESKRF"
     gene            681650..682332
                     /locus_tag="CNE02525"
                     /db_xref="GeneID:36392869"
     mRNA            join(681650..681972,682027..682069,682133..682332)
                     /locus_tag="CNE02525"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658532.1"
                     /db_xref="GeneID:36392869"
     CDS             join(681706..681972,682027..682069,682133..682188)
                     /locus_tag="CNE02525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514380.1"
                     /db_xref="GeneID:36392869"
                     /translation="MAAPHHPLRRISTGSLSSLARSTDKNTSSPSGLEFLQPAMTDLA
                     DEAATLAANTSQMTTLHDALGTFNEAFAAYLYALKMNAFCVEWPEAPNELSFSRAESL
                     QKPAPPPPNPSVSLDQSKS"
     gene            682897..685528
                     /locus_tag="CNE02540"
                     /pseudo
                     /db_xref="GeneID:3257949"
     gene            complement(683005..684807)
                     /locus_tag="CNE02530"
                     /pseudo
                     /db_xref="GeneID:3257810"
     gene            complement(685140..686904)
                     /locus_tag="CNE02550"
                     /db_xref="GeneID:3257570"
     mRNA            complement(join(685140..685247,685312..685388,
                     685441..685529,685586..685756,685809..685920,
                     685988..686096,686150..686221,686274..686428,
                     686479..686904))
                     /locus_tag="CNE02550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570957.1"
                     /db_xref="GeneID:3257570"
     CDS             complement(join(685167..685247,685312..685388,
                     685441..685529,685586..685756,685809..685920,
                     685988..686096,686150..686221,686274..686428,
                     686479..686869))
                     /locus_tag="CNE02550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570957.1"
                     /db_xref="GeneID:3257570"
                     /translation="MTLHDPLDLLKTSLQSSNPPQLLTAASEPAPTLALAAYLSFTSI
                     ANPINLPKDTPTRYTSKPGSTSEFYNIGQLYLAWVEKDSGVRDYLIKGQAGGVGYVAI
                     TDRRPAVDYLLGKGDGEGRIVAKGEEGAKQQPAGDSAASATAEALPSALESTVEAGPS
                     RASAQAKRKYEVDVIDREFCRKLRSEEIELRDRNSILRSSAGGKANNFEAFQRNIMHE
                     KIKALRTSFEKGGKQPTAATASQSDLNRAKKARSTNPIIVISSSPTSLITMWNVKKFL
                     EQGVFESSETVRQREASQGNVKAEDMIPVIRKRSGPHGDVISKYYIVDSADALQKFGQ
                     DAWDRVICVVTTGQTWQFKPYKWDDPKVLFQHVKGIYFQWGNDPVNPTVKDWNVTEMK
                     IDRNKRHTDRQVVADFWRILDNAKRR"
     gene            687070..688474
                     /locus_tag="CNE02560"
                     /db_xref="GeneID:3257726"
     mRNA            join(687070..687197,687271..687297,687352..687405,
                     687474..687556,687618..687672,687736..687775,
                     687821..687975,688033..688474)
                     /locus_tag="CNE02560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571219.2"
                     /db_xref="GeneID:3257726"
     CDS             join(687161..687197,687271..687297,687352..687405,
                     687474..687556,687618..687672,687736..687775,
                     687821..687975,688033..688304)
                     /locus_tag="CNE02560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571219.1"
                     /db_xref="GeneID:3257726"
                     /translation="MDNEGTELVEAYDYLFKFIVIGEAGTGKSCLLYQCIHEQFKENS
                     SHTIGVEFSSKTLRIGDKNIKLQLWDTAGQERFRSVTRSYYRGAAGAILVYDITSRQS
                     FVNLSRWLTDCRALASPHLVVVLVGNKLDKEEDREVEYTEGSRWAQENGLLFVEVSSL
                     TGKNVSTPFLLAGRTILSAIDAGTLDPDSAGSGVSYGERQLRAVGSQSRLSAAFGSSV
                     KRKRRRDSVSIRDMVGGQRCSC"
     gene            688639..690339
                     /locus_tag="CNE02570"
                     /db_xref="GeneID:3257778"
     mRNA            join(688639..689066,689128..689188,689250..689385,
                     689443..689586,689642..689942,690002..690161,
                     690210..690339)
                     /locus_tag="CNE02570"
                     /product="succinate:fumarate antiporter, putative"
                     /transcript_id="XM_570958.2"
                     /db_xref="GeneID:3257778"
     CDS             join(688912..689066,689128..689188,689250..689385,
                     689443..689586,689642..689942,690002..690161,
                     690210..690281)
                     /locus_tag="CNE02570"
                     /codon_start=1
                     /product="succinate:fumarate antiporter, putative"
                     /protein_id="XP_570958.1"
                     /db_xref="GeneID:3257778"
                     /translation="MSSTTSKPFGGGVTGDRVAPPPPKAISGKEKVPLSTHLIAGGVA
                     GLAESLACHPLDTIKVRMQLSKSRKAKGLKPLGFFATGRQIAARETPLGLYKGLGAVV
                     SGIVPKMAIRFASFEMYKGWLSNPDGSISSKATFLAGLGAGATEAVAVVTPMEVIKIR
                     LQAQQHSLADPLDIPRYRNAAHAAFTIVREEGIATLYRGVSLTALRQATNQGVNFTAY
                     QQFKKWAMDFQPQHKESGQLPSWQTMILGLVSGAMGPFSNAPIDTIKTRIQKASKVEG
                     ETALSRMAKVASEMFRNEGAKAFYKGITPRVLRVAPGQAIVFTVYERVKKMIDVAKGT
                     ALGAEYDE"
     gene            complement(690052..692120)
                     /locus_tag="CNE02580"
                     /db_xref="GeneID:3257666"
     mRNA            complement(join(690052..690147,690199..691132,
                     691183..692120))
                     /locus_tag="CNE02580"
                     /product="expressed protein"
                     /transcript_id="XM_024657221.1"
                     /db_xref="GeneID:3257666"
     CDS             complement(join(690366..691132,691183..691942))
                     /locus_tag="CNE02580"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512901.1"
                     /db_xref="GeneID:3257666"
                     /translation="MTSGAAPQDTWVFDSSTGVFYHAPSNTYAIHDSATGQWTYHTAS
                     EFHQASGSNIHHQQSLEDPLTPTTTNLDGRPQIIEEGEIPDDVGWGGLMEPEKLAEIE
                     KAAKKKEKRNGEHGTLEGVHYGAGEFREGSTAAEAISSHRSTNTTPPPDTLVSVSGMP
                     PEPPDYTLLRLVVVSTKSPKVSAGQIAVIDTREGGVQIGRDKCEKGAPARVRLREMEV
                     SKTHALIFWGENGDQQVEVEEDGEKSREGWWIVDLGSTHGTFVSPSNASDQASNNDTG
                     IRAHKRLSIPKHSSKPFPLFHLSLFVIGSTTFQAHIHASWPCDTCQLKGGNELPLDTG
                     ETFVNNTQDAAGYEEKVWDVAMNSQQRRGNREAKRKIEMANLRESLLNRGGSEEGSAS
                     AQNMPSRGYIDRSAMRRGLHRPSPPRGGQARFTGHTDAPVEVAPVENKFAEDFLGRQG
                     WQRGEGLGKDGTGRADPIMTHTRVRKRGIGAEGSIDDGEDWRVKGKLRRWGDVAGQKS
                     "
     gene            692315..697679
                     /locus_tag="CNE02590"
                     /db_xref="GeneID:3257961"
     mRNA            join(692315..692527,692588..693565,693631..694020,
                     694069..694365,694421..694720,694775..695290,
                     695342..695681,695736..696527,696579..696671,
                     696729..697041,697095..697679)
                     /locus_tag="CNE02590"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570961.2"
                     /db_xref="GeneID:3257961"
     CDS             join(692436..692527,692588..693565,693631..694020,
                     694069..694365,694421..694720,694775..695290,
                     695342..695681,695736..696527,696579..696671,
                     696729..697041,697095..697528)
                     /locus_tag="CNE02590"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570961.1"
                     /db_xref="GeneID:3257961"
                     /translation="MSPSHSIVGLEKLETCRKALLKASPQDLQDVQLLSEATEIILSP
                     QEEKLHLKLLELLLALLRQLTTVLSLSPNGPVRSLAQDRLAPEFQPGKPLILFLSANI
                     DHGLKVQQTRSVEVLAAAAKLAVTISSQGILASSASSAARHDNFMVPLFTCIAGGDVT
                     NRGDLSILIALLPYIPPSAIPSSLFDKLLSELHVAHNASVRCHLAADLAIVLGGASLA
                     APSSNLPSTPEQQKRILLPLRSAFATSQPSSTLLHVSRYLLPRLFSLFPSLLLTLLSM
                     LGAPDPVYGAWVAVASIGVQQGLISIEDLPQEDVMVVLESDEPETRLRAFELVSGRKE
                     YTESVIELIKLSFKRNEALSSAGARSAFSSATYAFFVRLHQYETLARRTLRKLSKQPN
                     TSSTVTEATQLRGSLSKTADFHSWFLHFIHDNLWHARRYPVFRVLLVLNLLGRYLEVF
                     GDDEGVQGKIYTQDMVENLLACQASEFTEVRSRARKILDDAKVSLTGYESLHTPSAQA
                     LLVSAFASLDHPRKTQAEAGKAALCILFGKVVHYGTVRESLEFVQNIITKLEKGVEVI
                     ERDLVQIENHPLHGLLGAIKDVILCLNIKTVEAQQTWSPIFRQLMSLVIRIWNATRAV
                     ISLAPSGLVSADENGVEGSARADHEIARAYEVLGGGEEGEEEDGMDHTGLLFGCWRAT
                     MTAGELLAAIFILPLARGGPSQLIWSVQDVNAAGTTFLTWLHEIRHRGTFSKLANAFA
                     QLVEAVRAIESLQSLCDDWLTDELRAISSDQHSTTRRSAALPYSILSIVSNSEALLEK
                     AVTSLLEFAKVENASTSNVTKVHALNVLKIVLLDARQTKWFDVWFERSVITALQAFES
                     PDWNVRNVGLILFSTLVHRCLAPPRGGQDYYRSRTTLASRRPFSLFHNKYPLILPFLK
                     EYLTKGSNPDCQTRIRHSPLLPILIIVRSLRWSDKNSEMLSDLARAVEPYLRSREYQI
                     RQTAAQALSSTVSPSEALQRALSIENYLSPSPEMANETHGYICFLRQLISNFIEWETV
                     NAESRAGIDNILLRLVKEYIPGTHPTITADVIGCVESYLVCTSVGKGSLVTEITSRAQ
                     KYMNRASRAFVPAEEFRLAACAAVLSTHAASPSIILSLLGSSSSEASNIVILENLWHL
                     QESYSPELVDRVISLGVRGKAGEGIQLKALNVLSEITWQSVDCDALAEWKEKGGRFES
                     VCEALDRIVINSKCVPIREAALVALAWALHHALTNSPGESKKVIPMYGRLAQYVLRAS
                     HEDESQPARFAAYKALTHLTSHLVHLPHPSFHQTLIRLAQDDDEEIRHGAARIIVGML
                     GDEKSVVQQRAVEMWYDWATRLLSGFDRDSDELGQWLVWISDLAQDHKGYEHDVKTLK
                     GGVDSEVLFEIEPSNIFRDPLVDVFYASRLLSNLRLAGLLGDRLSHLVPETKTRPEIH
                     LIENVTQTPTTVTTACDDSNLQSPEHAEYLELDRVAKEPCVSSPSPIDDAWEARRSFM
                     RRKKLQRMIVPKEGCRQESR"
     gene            697859..701218
                     /locus_tag="CNE02600"
                     /db_xref="GeneID:3257873"
     mRNA            join(697859..698190,698254..699678,699753..699866,
                     699914..700478,700528..701218)
                     /locus_tag="CNE02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657222.1"
                     /db_xref="GeneID:3257873"
     CDS             join(698524..699678,699753..699866,699914..700478,
                     700528..700799)
                     /locus_tag="CNE02600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512961.1"
                     /db_xref="GeneID:3257873"
                     /translation="MCHHQSPPSAPSVTAHTSSTASDSIIVPHYSKQQEVPKERESSI
                     GALPSSHVDSLFVPSAQIWEESYGQLKDPEAGDKTTDVPSLTPATFSVSQSSLQPGGS
                     LFDFSTLVTLVPCSHQVAKDLVDLPISITESQFTGTEFLNRSDNVNFPQQDWLAKCGS
                     ATGEMITPSEVSLGKSFSSSITNRNSAPKMLCPSHANSQAITDCISSITSPPTHMEPK
                     DLLKATLATHVCVVQSSTRTQQNGAGFVPQTNEEELIPMEKETSGGGATALCSGSVAL
                     TRDNNPRGSLPEPSFSSSQDTSRDACFFDATYSSIDCTVREKASFKRMPTTFQSSFPK
                     FGVSEQSNNRLRSVAVETKVRDEMEDLNVLHFQQGVLSIASAFYVDLATLVERTPVNV
                     IRMGMTRSGLGPRGQNLQQTIDDIKDVCAKLTEGNAVGVEHLVSPSKRTNSCEGRLSH
                     YATMRLAGDRRKSSSADAMTHPEKMAENVSPYWHHDSSAPVNAGSCPIKKHKSVASPS
                     FTSSSPHSSSKPITPSPQSSMPGAISRLASLSSPSSLPQPPRIIHGPWTSAEIERLKG
                     LVKLSKDAEDGVPREHVDWAWVVRNFGDRRNRRQVLIKAVELGLRETSTHYSRRIRQN
                     AQQNGHKHTAVSAAPIRSVLIHKHHNLETSQPPGATFVQQSLVFPSPSAHTRRNSAQA
                     EFNDSARTAMPPTPKNSLS"
     gene            complement(701129..702307)
                     /locus_tag="CNE02610"
                     /db_xref="GeneID:3257770"
     mRNA            complement(join(701129..701356,701410..701471,
                     701519..701556,701613..701714,701766..701832,
                     701895..701994,702209..702307))
                     /locus_tag="CNE02610"
                     /product="nucleoside-diphosphate kinase, putative"
                     /transcript_id="XM_570963.2"
                     /db_xref="GeneID:3257770"
     CDS             complement(join(701302..701356,701410..701471,
                     701519..701556,701613..701714,701766..701832,
                     701895..701994,702209..702243))
                     /locus_tag="CNE02610"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase, putative"
                     /protein_id="XP_570963.1"
                     /db_xref="GeneID:3257770"
                     /translation="MSTTEQTYIMIKPDGVQRGLVGEIIGRFEKRGFKLVALKLHTPS
                     KEHLEKHYSDLSEKPFFPRLIEYMMSGPVVCMVWEGLDAVKTGRVMLGATNPLASAPG
                     TIRGDYALQVGMNVCHGSDSVENGQKEIALWFPEGINQYKLSSQAWLYEA"
     gene            703141..705530
                     /locus_tag="CNE02620"
                     /db_xref="GeneID:3257875"
     mRNA            join(703141..703293,703336..703581,703642..703707,
                     703760..703785,703837..703996,704059..704222,
                     704270..704355,704417..704504,704572..704840,
                     704905..705107,705184..705530)
                     /locus_tag="CNE02620"
                     /product="branched-chain alpha-keto acid dehydrogenase
                     E1-alpha subunit, putative"
                     /transcript_id="XM_570965.2"
                     /db_xref="GeneID:3257875"
     CDS             join(703147..703293,703336..703581,703642..703707,
                     703760..703785,703837..703996,704059..704222,
                     704270..704355,704417..704504,704572..704840,
                     704905..705107,705184..705315)
                     /locus_tag="CNE02620"
                     /codon_start=1
                     /product="branched-chain alpha-keto acid dehydrogenase
                     E1-alpha subunit, putative"
                     /protein_id="XP_570965.2"
                     /db_xref="GeneID:3257875"
                     /translation="MPYNLLDAIFNTFRSEPLTKKHYQMRTALQAVTSYSRLPLAANA
                     SRRSLITGPPPNIPPIHNTTSTSAPLPLPTPLPSFSPPSIQDAKPLYVPGSQAERQAR
                     AGRMSRPLRRGTHESWWSAEMGWFNAVAKTIPTFRVLDEEGHMVKDGHESQATKEQTL
                     SIYRTMTLIPIVDNVLYQSQRQGRISFYMQCAGEEAAIVGSAAAMLANDEIFGQYRES
                     AALLHRGFTLDALMAQCFGNVDDKGTKGRMMPVHYSSPEHGFHTITSPLATQMPQAAG
                     AAYMLKLDEERQGDCVICYFGDGAASEGDFHAALGMNSVLGGPCIWFCRNNGFAISTP
                     IIDQYAGDGIASRGPAYGLDTIRVDGNDALAVYAAVCEARKRAVEGKKGVLVEAMTYR
                     VGHHSTSDDSSMYRAIEEVKEWSVVDNPIHRLRSYLVSKKWWSEEEEKALLKKNKADV
                     LKAFSRAEKLPKPKLGEMFNDVWGVAPGEEVPAVIMEQRAELGRLLKKYGEVWPPWKK
                     ELKKFVEQGEDVMDCDGKGA"
     gene            complement(705655..709923)
                     /locus_tag="CNE02640"
                     /db_xref="GeneID:3257647"
     mRNA            complement(join(705655..708149,708204..708288,
                     708341..708485,708535..708934,708997..709563,
                     709634..709923))
                     /locus_tag="CNE02640"
                     /product="glucan 1,4-alpha-glucosidase, putative"
                     /transcript_id="XM_571215.2"
                     /db_xref="GeneID:3257647"
     gene            705710..707922
                     /locus_tag="CNE02630"
                     /db_xref="GeneID:3257568"
     mRNA            join(705710..706242,706306..706583,706657..706860,
                     706916..707704,707761..707922)
                     /locus_tag="CNE02630"
                     /product="glucan 1,4-alpha-glucosidase, putative"
                     /transcript_id="XM_570967.2"
                     /db_xref="GeneID:3257568"
     CDS             join(705871..706242,706306..706583,706657..706860,
                     706916..707704,707761..707851)
                     /locus_tag="CNE02630"
                     /codon_start=1
                     /product="glucan 1,4-alpha-glucosidase, putative"
                     /protein_id="XP_570967.1"
                     /db_xref="GeneID:3257568"
                     /translation="MASRTEMESDDLLSFEKSLFLPRNATPRPYISRTEHNCHRYRSV
                     VIKGLFLCLLILSAIVISVSLGLWPHYLNSRSVRFDHWSGHQNVFLESRILANIGPGI
                     GAKEGLVVASPSKGHGKEPDYYYTWTHDSALTISTLIPHLRFDLADINNTTEPWELYS
                     ALSDVLKEYLFRDYIESQAEIQIGKNPSGDLKKGGLNEPKFHVDGTPFTGNWGRPQRD
                     GPALRAIAVMIYANFLLDRGFPSDVSYVQQRIYDPRHLKSPGRVLKNDLEEVAHGWSK
                     GGFDLWEEVDGHHLFTLLVSRKALYDGSTFAKRLNDVGAADHYLAQAHSITQKLSSFW
                     DSKRGYWLSSLSGRDFELVQLKSEFNFTNAYPRREWLDCSIPLSIIHAGSHTLQPSHN
                     FSFPFSATDPSVLSTIHLYIKSFDGLYSINDGKPWSDGWALGRYKEDVYDGKGQSQGN
                     PWFICTFSVAHSLYLAYKEFREAGAIVIANQTVAFWEDVVSISSKPPKVREGDVWTEG
                     EDWQFKEGMKCLKDVAGRFMEVGQQVAAANGGRMSEQIDRDDGQCRGARDLTWSYASL
                     LDLIRVRSDLD"
     CDS             complement(join(708042..708149,708204..708288,
                     708341..708485,708535..708934,708997..709563,
                     709634..709852))
                     /locus_tag="CNE02640"
                     /codon_start=1
                     /product="glucan 1,4-alpha-glucosidase, putative"
                     /protein_id="XP_571215.1"
                     /db_xref="GeneID:3257647"
                     /translation="MRTSPHTCVLLLCAASVIATPQRQAPIQLPLSASSPSSESFAPV
                     QRYDGDQVWRVKLGGEDIRRIEDIVDLVENLQLDIWRTTSRSLDIRLNELQKNDLQEL
                     LHPDTLFEPFITNVQSLVDFTTPSYYSDIIDSSLEVNADQSLRNGQPLQISKKNKKPK
                     IDPFNLTTLATPFHDSYHTLKDVHQFGDALVETFNGKEGIEVWSFDVGTTWEGRPIRG
                     WSARLMRNESDVNNSQRRRRSRVTEEDEELQKEIVIISGQHGREWVGPSSALYFLHSL
                     LLTSLSSPSSEAALMLSKFTFSVIPTINPDGFVYSQSHRMWRKNRQPVGHKSCVGIDL
                     NSNWAYKWKKEKKEKPCNEGYRGKAAFEAYETKAVGEWLAKGAERGTRVRAFVDLHSY
                     GQLFMFPFAHSCNDFPADAEMLMEAGLGVAKAIRTAHGETYETGQACDLTYRAPGDSV
                     DYAYGVTDIRWSYSAELRDTGTYGFMLPKTLIRPTAEEISAGILHLAKFIYVLEIAD"
     gene            complement(710039..712425)
                     /locus_tag="CNE02650"
                     /db_xref="GeneID:3257843"
     mRNA            complement(join(710039..710551,710610..710966,
                     711020..712345,712390..712425))
                     /locus_tag="CNE02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_571214.2"
                     /db_xref="GeneID:3257843"
     CDS             complement(join(710137..710551,710610..710966,
                     711020..712278))
                     /locus_tag="CNE02650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571214.1"
                     /db_xref="GeneID:3257843"
                     /translation="MSQHEIPPQNPLSRDPRLPLDPNEYDPRQPHYQIQPPPPQQAES
                     QQQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQERPLSYELPKSTFQETWRPTPRESYT
                     PKRDAELKVPKSAEEPNGQVNAKAKPQAPINANVSDTGLPTPSLTAQSSSSVISSGTI
                     NEFASKLQSQPRKDQQAQSSGQSPAPQEIALDSLAKLRQFKAEVEATRQTRGGAAELE
                     PAKLAKMAESFLLSQQQQLQLQQPQTQDVHVIEEEKDKMAREQQLKEQLKARAKGDDS
                     RLVDRNKDRSPSSSSAVARRPRAEDLIDSEKSTPDVEGKPDLRSSSNPPPSAVHLQQD
                     PRFRRRTPAPVPAPPSGNNFEPSAKNFVPSRFQNGKGGVPEIGEFRKAHQSSRSPRSR
                     PSMERIDREKSFETEAAAPSFEGRKLAERISGPRPAGRPRSPSPARSARSSVAPYRGR
                     PLSPPPRDSYRPMSPPRRYYDRSPPRSAYPSRPYDVPFDYRNLPDPHDTRDPRNAPDT
                     RFSRGSIDPRDAYRQPPSVGYDRYPPADRDPYGRPHPADYRAPPAPSPLDGNVLETIE
                     NLKAQLSQLQEVTMHQPYPPRERERDYMPDPYGLPPPGYAPRGYGREASPPYRSGPPP
                     RRLSPPPMDRGYPERDYGYDRMDGPFARKRRPSIDLDDPRDYRGPGRGRGRV"
     STS             711898..712196
                     /standard_name="AGC9"
                     /db_xref="UniSTS:470801"
     gene            712541..713414
                     /locus_tag="CNE02660"
                     /db_xref="GeneID:3257574"
     mRNA            join(712541..712677,712735..712938,712999..713414)
                     /locus_tag="CNE02660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570969.2"
                     /db_xref="GeneID:3257574"
     CDS             join(712579..712677,712735..712938,712999..713346)
                     /locus_tag="CNE02660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570969.1"
                     /db_xref="GeneID:3257574"
                     /translation="MSSPHSPAGSPADTHAASSTRPRNTVLDMQRRQLEKLLANPDRE
                     VALPAGPQEKTLRAPREMMKNVQGSSAGAGSGEFHVYKQSRRREYERIRLMTEKTKAE
                     EEHAEFLKRQAERDAIAEAKTAKNRAKRQKRKHGRKGGADATEGEATSAGDGGVAKRK
                     LQGGAKVLFKKPGEEASDSEEDVGPVAPAVEEEQTPEVAEPQRVAEEARISIVDED"
     gene            complement(713375..715967)
                     /locus_tag="CNE02670"
                     /db_xref="GeneID:3257912"
     mRNA            complement(join(713375..713660,713715..713845,
                     713902..714467,714534..714678,714730..714824,
                     714870..715062,715116..715539,715593..715967))
                     /locus_tag="CNE02670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657223.1"
                     /db_xref="GeneID:3257912"
     CDS             complement(join(713516..713660,713715..713845,
                     713902..714467,714534..714678,714730..714824,
                     714870..715062,715116..715539,715593..715909))
                     /locus_tag="CNE02670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512905.1"
                     /db_xref="GeneID:3257912"
                     /translation="MDFRRQTLVSNGGSSQPQPSVPSSAIKKASRLGPARQSLAPSQI
                     QSRTSILGVSNSQENASHGMMGSRKSTVPGKMGDRDQLMSASRGDGGIYGRTPQMNRG
                     IPGSVRRSSVFTSNSQGRTSMAPGVYSTAYKDPRPLRDKVFQSNCMRNVNEYLISVRY
                     PLPLTAKTLTSPTAKEFQSIFKFLVNDLVDPGAAWGKKFEDDTLSILKDLKYPGMDSV
                     SKTALTAPGAPQSWPNMLAMLNWLVDLCKALDNWDDPEIISDPLMVPATELPLDYPNL
                     DDRLLWDFAAKTYSQWFDGEAEEFDEAEQELEHAYDRMASATVAECEKLEREIQKRNV
                     EIQQLHVQEPPLKKLEDEYVQLMSDKNKFISFLDQQGQKIEKIRLRISKVKEAVISQE
                     AELEARQSELAHIEQAVAAQNLSPDEVQRMNHERDSLTRSLEDLRNKISEASQFAYDQ
                     EMVVTKSMDRFEGLLTDYNSLAHQIGLLDSSLDVPSLAANVNYNLDVDLGAEELEEVK
                     AVGVRMRSTIWQALQTCRETFRQEALGLGNGTIALEDEFDKLGQSVERQKEEVGNLEV
                     RLKIVHNQAEDAQSQIASENSDTNKIITQLETEVTNMLAASQQGVLSTQSQLESTRIA
                     FKELRHKTALFQDSVVAEVGEHIDAIIKAKEHTANSLKSIRALAETQ"
     gene            complement(716073..718390)
                     /locus_tag="CNE02680"
                     /db_xref="GeneID:3257703"
     mRNA            complement(join(716073..716663,716717..716890,
                     716941..717283,717333..717801,717885..718390))
                     /locus_tag="CNE02680"
                     /product="protoplast regeneration and killer toxin
                     resistance gene, putative"
                     /transcript_id="XM_024657224.1"
                     /db_xref="GeneID:3257703"
     CDS             complement(join(716415..716663,716717..716890,
                     716941..717283,717333..717801,717885..718119))
                     /locus_tag="CNE02680"
                     /codon_start=1
                     /product="protoplast regeneration and killer toxin
                     resistance gene, putative"
                     /protein_id="XP_024512906.1"
                     /db_xref="GeneID:3257703"
                     /translation="MAATNAQIYQQSQMPMPMPMPMPTPSLNPNINSAPTPGPNAMSV
                     YDDCQSPLDTSVSGMYPGDRGSRVVSQPAPLLDQSHLRPGNQANLLSHDRTIELYREN
                     AKKTNDPELIFEFSAFMIDAAKAMIPPEQENDTNPSPAVIKQMEKREEIIKEATSLLK
                     RLADRGFPDAQYFLADCYANGIGTARGKQDFDRAFPLFILAAKHGHPDACYRAGTCCE
                     HGWGCRRDSAKAVSFYKKAAVGLHPGAMYRLGTAELNGALGFPRRPKEGVKWLKRSAE
                     HATEEFPHALHELALLHERGIENVVFVDNDYAAELLAQSAELGYAPSAFKLGECYEYG
                     KMGCPVDPALSIHYYNISAQQNHKDACFALTAWYLVGSPGVLPQSDTEAYLWAKKAAE
                     LGLAKAQYAVGYFTETGIGIEANPQAALTWYKKAAEGGDKRAAKRLATGSRSSALDRR
                     LEMEALKEEKRLGAADLAQRSGSGSGASGKDGKDGCLIM"
     gene            718554..719744
                     /locus_tag="CNE02690"
                     /db_xref="GeneID:3257793"
     mRNA            join(718554..719089,719158..719269,719328..719744)
                     /locus_tag="CNE02690"
                     /product="ribosomal large subunit assembly and
                     maintenance-related protein, putative"
                     /transcript_id="XM_570976.2"
                     /db_xref="GeneID:3257793"
     CDS             join(718620..719089,719158..719269,719328..719672)
                     /locus_tag="CNE02690"
                     /codon_start=1
                     /product="ribosomal large subunit assembly and
                     maintenance-related protein, putative"
                     /protein_id="XP_570976.1"
                     /db_xref="GeneID:3257793"
                     /translation="MRSLLRALQQPFSRTLATVAEASSSTAPAPAPAAPGKWTPQTLR
                     TGLIARKRGMTALWDADGRRWPVTVLQVDANQVVRHSPPPPTSPYHTLQIGASPRREK
                     TTTKQQLGHFKKAGVEPKYRLKEFQVSEDAVVPVGTELSAGHFVPGQFVDVQGVTIGK
                     GFQGVMKRHGFRGLKASHGTSVKHRSPGSIGQNQDPGRVIPGKKMPGHMGNVTRTTQN
                     LLIHRVDHVLNLLYVRGCVPGSDDSFLYVKDSKKLVKSKAQLALKKGKPEEEWLPKGV
                     VSLPTPAGTVERVKEEGWPEVVEWKGDGWAEK"
     gene            complement(719677..721533)
                     /locus_tag="CNE02700"
                     /db_xref="GeneID:3257526"
     mRNA            complement(join(719677..720167,720224..720315,
                     720365..720616,720666..720741,720801..720843,
                     720901..720932,720989..721533))
                     /locus_tag="CNE02700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570978.1"
                     /db_xref="GeneID:3257526"
     CDS             complement(join(719775..720167,720224..720315,
                     720365..720616,720666..720741,720801..720843,
                     720901..720932,720989..721183))
                     /locus_tag="CNE02700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570978.1"
                     /db_xref="GeneID:3257526"
                     /translation="MLPHLILSLASLFALPAVFAATTCNGHSELCSRLYSNVTFIGAH
                     DSYAVGSSVADDQDKDVTSQLNDGIRTLQIQAHNASDGIHLCHSSCSLLDGGLMSDYL
                     STVASWVNDNPNDVITIVIVNSDNLPPTSFSPVFESAGLSSKVYTPASQPTQLSDWPS
                     LSDMIDAGTTVVAFMDYEADTSSVPYLLDEFAAMWEDAYGVTTQEFGCAVNRSSGDTS
                     SQPFLINHFLDSTYSFSSIQVFVPNKDKLNETNAETGTGSIGYHVNNCRQLWGRNPNH
                     ILLDFYDSNGNSPFNVAASLNGVSAPTNTVTAGTASATSSGTAAVVSTQSLSGSVTSI
                     EGIAKGITLGLGVMLGVGMGVGRVFL"
     gene            721938..724139
                     /locus_tag="CNE02710"
                     /db_xref="GeneID:3257569"
     mRNA            join(721938..722600,722659..722788,722839..724139)
                     /locus_tag="CNE02710"
                     /product="lipase 2, putative"
                     /transcript_id="XM_570979.2"
                     /db_xref="GeneID:3257569"
     CDS             join(722162..722600,722659..722788,722839..724033)
                     /locus_tag="CNE02710"
                     /codon_start=1
                     /product="lipase 2, putative"
                     /protein_id="XP_570979.1"
                     /db_xref="GeneID:3257569"
                     /translation="MGTTLSPFRYIQLVRYAVNRWIDIIPAVKGKGKAHLDNLHARAG
                     DYLLKSETASNAPPPPANAGQAEAGPSRLAGVNENRPHQHRHYENQQKEHHQHYRHPP
                     RYPKLAPDPKWPPGPKEIYNLMNDERLFVPGSIKPPREVVVLCHGLYGFSTATPIPLF
                     PSLKLHYWASVLEVLRDKMGVKVVVVGVKGTGSIKERAEQMHEFLKKTLPRGTGVNFV
                     AHSMGGLDCRHLISTIKPTSYTPLSLTTIGTPHRGSPFMDWCAANIGVGSAAAVAASL
                     TAEKLKALPYSLKSPLLARPPPTQTKPDTITSIAAGLTSYLLSIFDSPAYSNLTTAYL
                     RDHFNPATPDDPFVKYTSVAGRISKMSVLHPLWFPKLVLDAAAENGYAEDTSNMVYGP
                     EGKPRYEGNDGLVSVSSAKWGEYIGAVDECHHWDLRGEGGLFPSNVSSISLGDDNKKG
                     EDKHGGGWELDKESAPGAGGVHEHLGLAAKERDMVELKKKGKDSGAEASPKSSESSIV
                     TPSSWDIAQVGQVVDWVTDFLPGGKTTEAGKRQLEEARMEKEGQVELEKEKEREKKRK
                     DKFDLERFYGGLMIKLRDDGF"
     gene            724325..725225
                     /locus_tag="CNE02720"
                     /db_xref="GeneID:3257893"
     mRNA            join(724325..724691,724758..725225)
                     /locus_tag="CNE02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_570980.2"
                     /db_xref="GeneID:3257893"
     CDS             join(724365..724691,724758..724973)
                     /locus_tag="CNE02720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570980.1"
                     /db_xref="GeneID:3257893"
                     /translation="MSSNVSSSPSAETSSLRARRSTTLDPQTPTSSLHSVPSPNSTVV
                     GTSTSPSEGVELSLPPKSVTTNGEPSSTASTNVYFPGGLPLPAVKGVISGIDSPRHGR
                     GSPSIGNRRDIPGSPVTPTTSTTVRAEPAQQRPTGEVVVQQEEYRPRVVFRSDPTVKS
                     CLLGLKMEKKDEIAKLFGVI"
     gene            complement(725180..727744)
                     /locus_tag="CNE02730"
                     /db_xref="GeneID:3257495"
     mRNA            complement(join(725180..725590,725661..725856,
                     725921..726242,726307..726717,726772..726995,
                     727056..727147,727221..727401,727454..727744))
                     /locus_tag="CNE02730"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_570981.2"
                     /db_xref="GeneID:3257495"
     CDS             complement(join(725404..725590,725661..725856,
                     725921..726242,726307..726717,726772..726995,
                     727056..727147,727221..727401,727454..727613))
                     /locus_tag="CNE02730"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_570981.1"
                     /db_xref="GeneID:3257495"
                     /translation="MFFKKNSDAPKKPRHAPDRDDVPSLEDLGVELHPDTARYVADSQ
                     ALADAIGGNGLKDIFSSGLVLIAAFSTCMGGLLFGFDQGILSIVLTMSQFLGQFPDVD
                     ANVSSSAAFNKGIMTALLELGAFIGALQAGFVADRYSRKKAIALGSVWFVIGAILQTT
                     SYSFAQLVIGRFVGGLGVGLLSAVAPMYISEISPPNIRGSLLAMEAATIVSGIVIMFY
                     ITYGSRYIPGDWSFRLPFLVQVAPCILLTIGLWKLPYSPRWLAQVGRDEDSLHALMRL
                     RGFPVTDPRLQAEWITIRAEAIQNREVIVKAHPSLQGKDFMSELKLEIASWVDMFKPK
                     LIRRTIIGPILMMFQQFSGINALIYYSPTLFEQLGLDYEMQLDMSGVLNIIQLVACVL
                     AFFVIDRVGRRPLLLFGSTANTICHVIVAVVMAKFSHDWVRYSKEAWVAVAFIFIYIF
                     TYGVGWAPVPWAMPAEVHTSSRRAKGVAITTCANWLGNFIIGLITPPMLQNIKYGTFL
                     FFGAFTFLSGLYVWFFCPEPMGKTLEQMDQIFHSNTAHEDNLAKSDIQAVILNSPVAG
                     PLSGTASAEKINDKDTQQEWVETV"
     gene            728453..730631
                     /locus_tag="CNE02740"
                     /db_xref="GeneID:3257782"
     mRNA            join(728453..728836,728899..729487,729556..729636,
                     729716..729873,729996..730631)
                     /locus_tag="CNE02740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570983.2"
                     /db_xref="GeneID:3257782"
     CDS             join(728477..728836,728899..729487,729556..729636,
                     729716..729873,729996..730523)
                     /locus_tag="CNE02740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570983.1"
                     /db_xref="GeneID:3257782"
                     /translation="MPRPPLPRNLNLPRWNPPKPHLAKYHPPPPHPTTAHAHFLPPTS
                     PQLPPRRKPAFNPGGFGLQSQPAPAPAPTSAWGKGKEREMQVDEIQKKDDELRREEER
                     IEGKSPKEGREEAEACYVPPPATLHYVASHSLPLLYSPSPLPPFTIAYETWGTLNADA
                     SNAILIHTGLSASSHVASRGNDVSPSTSSKPGWWEDFVGPGKSIDTDKFFVICTNVLG
                     GCFGSTGPSSPYPPGDGQTRWATRFPLLSVHDMTRAQISLMDYLGINKLYASVGSSMG
                     GMQSLSLAYLAPERVGRIVSISACGRSGLNGVGMRYAQRSVLMADPNWNRGFYYDGVP
                     PHNGMKLARQIATITYRSGPEWEQRFGRQMISEQDAQLDAQGNPGVPRLSPDFLIETY
                     LDHQGERFCLTYDANSLIYISKAMDLFDMTGPALTSLAKRFNDAYPDQPPFPYPDDPV
                     SISCCAPRGAAEAHDHNTPEEQEKLEKETKKKLARFIPTSKSPHLADLAQGLQRLKDI
                     PTLVLGVQSDVLFPVEQQRELSDALKLTGNSRVTYYELGGVWGHDTFLLDVQNVGGAI
                     RGFLH"
     gene            complement(730580..732378)
                     /locus_tag="CNE02750"
                     /db_xref="GeneID:3257960"
     mRNA            complement(join(730580..730737,730803..730904,
                     730972..731677,731729..731888,731966..732087,
                     732143..732242,732290..732378))
                     /locus_tag="CNE02750"
                     /product="autophagy-related protein, putative"
                     /transcript_id="XM_571138.2"
                     /db_xref="GeneID:3257960"
     CDS             complement(join(730692..730737,730803..730904,
                     730972..731677,731729..731888,731966..732087,
                     732143..732242,732290..732325))
                     /locus_tag="CNE02750"
                     /codon_start=1
                     /product="autophagy-related protein, putative"
                     /protein_id="XP_571138.1"
                     /db_xref="GeneID:3257960"
                     /translation="MSRLAKRHPDLLSCNFNQDYSCIAVGHKKGYTILNCDPFGKVHS
                     NNDQGATGIVEMLFCTSLVALVGAAENQPSNSPRKLQIVNTKRQSTICELIFPTSVLA
                     VKMNRKRLIVVLENEIYIYDISTMKLLHTIETGPNPNAVCALSSSSERSYLAYPSPVP
                     SASSTPLSSSAIPAPPPAPTTGDVLLFDTISLTALNVIQAHKTPIAALALNSTGTMLA
                     TASDKGTVVRVFSVPDAKKLWQFRRGSSSARIFSINFNLMSTLLAVSSDTSTIHIYRL
                     ASSRKGGKDADDASTEEARSPTPSETPLASSPPLAAGKLDSHSAASSLRRRSYHLGKS
                     FVGGVGGYLPKSVSEMWEPQRDFAFIKLRGNHGRTVVAMSATVPQVMVISSEGLFQAY
                     NIDLENGGECSLMKEFALLGSEDFGNGSNGI"
     gene            complement(<732477..733999)
                     /locus_tag="CNE02760"
                     /db_xref="GeneID:3257669"
     mRNA            complement(join(<732477..732728,732784..732916,
                     732958..733033,733085..733200,733251..733375,
                     733436..733836,733893..733999))
                     /locus_tag="CNE02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_570985.1"
                     /db_xref="GeneID:3257669"
     CDS             complement(join(732477..732728,732784..732916,
                     732958..733033,733085..733200,733251..733375,
                     733436..733836,733893..733974))
                     /locus_tag="CNE02760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570985.1"
                     /db_xref="GeneID:3257669"
                     /translation="MDIDPPVYNTDRLDAFVYKHNDGPARKRLHTELEHQPFHPQPTQ
                     GFAQFNSSLNSAPLLLAALNTPKKAPAYDPSQWYSQGARTPATSLVTQEVDMDSPARR
                     GPSSEAAGSVDETERGGEAEDKENATEEKKPRKFAKGAVTRTNRKRQQSKKEQVRSDN
                     EDRGAVRHSDSATPAFTKSEHHYSVHMAAPSLRHSEIPALLLGYLQFFVNTSIVLFCI
                     YLAILFVLTVRRDVKDKMNEYSVEILQEIAECTNMYLTNMCSSNRIPHMDAPCRAWEA
                     CMNRDPTVVGRINIIAETFAGVINSFVEPISWKTMSFTLVTLTFLVILTNSALFNLRA
                     RASQHDTSAPAAPAFWPPHGQFMPQLPANMPQAPTVHAPGEGGERDARQIGWRGEKGK
                     GW"
     gene            734081..735734
                     /locus_tag="CNE02770"
                     /db_xref="GeneID:3257975"
     mRNA            join(734081..734149,734199..734287,734344..734390,
                     734439..734528,734596..734678,734730..734778,
                     734839..735068,735136..735286,735361..735601,
                     735671..735734)
                     /locus_tag="CNE02770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657225.1"
                     /db_xref="GeneID:3257975"
     CDS             join(734140..734149,734199..734287,734344..734390,
                     734439..734528,734596..734678,734730..734778,
                     734839..735068,735136..735286,735361..735601,
                     735671..735688)
                     /locus_tag="CNE02770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512910.1"
                     /db_xref="GeneID:3257975"
                     /translation="MSSDQVLQPPVDGISSVAFSPDSSRLLVSSWDGTIQLHDLSGSP
                     QPPKIFPHPAAVLTACFGSTPNVGFSAGLDKRVRRWDFDTGLVQVLGKHDDAVQSIVW
                     SPQHNVLISASWDSTIKVWDPLSDTPLKSTQPLPARAYNLAYAPSASRLLVSMAHRHV
                     YVYDVAKLAAATEKIPASQERESALKFMTRSVATMADGKGWASGSLEGRIAVEYIDPA
                     DQGSKYAFRAHRQNVDGTDCVFPINALAYHPIHNTFASGGSDGFISIWDHNAKKRMKL
                     FPKYPAPISALAFSPDGTKLAIGASYEHDNAVTKPEEQATVMVLIKNTVMDDCKPKAK
                     A"
     gene            complement(735760..737929)
                     /locus_tag="CNE02780"
                     /db_xref="GeneID:3257563"
     mRNA            complement(join(735760..736221,736280..736301,
                     736380..736516,736573..736721,736777..736818,
                     736874..736962,737045..737156,737223..737278,
                     737339..737625,737687..737929))
                     /locus_tag="CNE02780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657226.1"
                     /db_xref="GeneID:3257563"
     CDS             complement(join(735761..736221,736280..736301,
                     736380..736516,736573..736721,736777..736818,
                     736874..736962,737045..737156,737223..737278,
                     737339..737625,737687..737795))
                     /locus_tag="CNE02780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512989.1"
                     /db_xref="GeneID:3257563"
                     /translation="MLPRSITASALHVGTSRSMLARSIATAVPLLRQQERLPRGHVRP
                     TRRPIRQIPFRTGTGTDEHYQSTAAGPQAFHAYEPYDPLSTPIHASGPVDIPPDPSGV
                     LGDSHAAREILGHESLVIVRQLEMLNVFMGFEQANRYAIHSPDGQLVGFLAEQEQGIL
                     STISRQALRTHRPFKSIVMDRHGKPVLWIQRPFAFINSRIFVHSSEDRDSRLVGEAQQ
                     QWHPWRRRYNLFQSRESETFRQFAKVDSGFLAWDFWLKDKDDRLLASINRNFRGIGRE
                     LFTDTGQYVIRFDAAGTELDLAPGSNINVQGQTLVLPRSSDSGLTLDQRAMTLATAVS
                     IDFDYFSRHSGSGGLGFPFFFWGGGDGGADAQSGGRPSDVQPSPDGGAGAGGVAAGAA
                     AGAAGTGGMTEDELIYGRQPAQPGSPNDPVPPPPGESAGGWEQFPQGLEGYDEQSAGW
                     EQEDVMQDPWGNQGGDDSGWFGGGGGGGGGDWGDWGQ"
     gene            complement(737994..739332)
                     /locus_tag="CNE02790"
                     /db_xref="GeneID:3257633"
     mRNA            complement(join(737994..738574,738630..739044,
                     739095..739332))
                     /locus_tag="CNE02790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571212.2"
                     /db_xref="GeneID:3257633"
     CDS             complement(join(738035..738574,738630..739044,
                     739095..739204))
                     /locus_tag="CNE02790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571212.2"
                     /db_xref="GeneID:3257633"
                     /translation="MKLSDLKLIGYDHGILSVTGWFTDGLVALHTELGLPWWAAIAGT
                     TVLIRLCLTRLVVNTQKHSVRLAAVNPQIQELMAEAKVASANKDTHMQTLISQRLRDL
                     MKEHNVNPLRPLLLPLVQMPIFLTFFSIVRGLANLPLPQLKEGGLGWVTDLTAADPYY
                     ILPATSLLFTNLVFKFGADGVPTAAKAGSPMTTAHMRNFIQLTTFLSFPLIMYFPSAL
                     LFYWTFSTGFTLLQSIILRQPIVKRYLGLPVTKAQALEPGAEPLKSPSYMDTFNAAKE
                     YFQKSVKQASEDSANRAHAEQKAKHASVQRKQQQGAFVERIQEPGPEVSDAQTVKRPE
                     GREAEKQRRIEEARRRRARS"
     gene            739618..740794
                     /locus_tag="CNE02800"
                     /db_xref="GeneID:3257699"
     mRNA            join(739618..739715,739779..739817,739880..740138,
                     740189..740316,740365..740503,740557..740794)
                     /locus_tag="CNE02800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657227.1"
                     /db_xref="GeneID:3257699"
     CDS             join(739685..739715,739779..739817,739880..740138,
                     740189..740316,740365..740503,740557..740650)
                     /locus_tag="CNE02800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512911.1"
                     /db_xref="GeneID:3257699"
                     /translation="MSPFLPALRSAARPAAFRPALALARPLSSTAVAPRPHTPTSAIN
                     SYDHSPSTTLPDTTIAQQKSNQLSLETPRNGAEYVLSTLDKIVNWGRQGSMWPMTFGL
                     ACCAVEMMHMAAARYDQDRLGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEP
                     RWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGMLQLMRKMR
                     RNRQSVRWYRR"
     gene            740969..745512
                     /locus_tag="CNE02810"
                     /db_xref="GeneID:3257540"
     mRNA            join(740969..741148,741216..741349,741488..741591,
                     741661..742062,742131..742576,742634..742858,
                     742931..743114,743202..743541,743608..743731,
                     743790..744218,744281..744433,744484..745023,
                     745093..745512)
                     /locus_tag="CNE02810"
                     /product="tRNA binding protein, putative"
                     /transcript_id="XM_024657228.1"
                     /db_xref="GeneID:3257540"
     CDS             join(741002..741148,741216..741349,741488..741591,
                     741661..742062,742131..742576,742634..742858,
                     742931..743114,743202..743541,743608..743731,
                     743790..744218,744281..744433,744484..745023,
                     745093..745296)
                     /locus_tag="CNE02810"
                     /codon_start=1
                     /product="tRNA binding protein, putative"
                     /protein_id="XP_024512912.1"
                     /db_xref="GeneID:3257540"
                     /translation="MAATSPHLTSIPQAVRVAASIDPSIDPGLKQQAIDYLTKVKQLS
                     EETWQDCLQLYLQGAGAPGPSTTGRDGKEKLETDMRMFCLQVVDTVLIQKPEVMGADA
                     VQGMYEAIVEFIQVEYIGGSCEGGQGFLRNKLAFTISQLFLRAFPSHIPTFLHPFFAL
                     LSPPTSSPPNLHPQLLTIRLLLEIAQEIHDTTLKTARIMTKERQERDGVVRDVIRSSG
                     DDKTAVQGMLGIIEKGLEQMNSGNSSDKWAEAVDATLKTLSAWIPWIDLGVALNPTTL
                     PFYHRLLHQPILSFRTATAGIYRTLVAKGIQDPSSRLQVLRVLAPVAVIDPLETETRG
                     GKSEEVATFRASLGVVLSAYGVALIGISDNTEVAEQLRNEAEEMMNPALPLLLRFLSD
                     RQYEVPLSVSPFVSDLLRIYKRMYKPPNPSTKAGQAPSPPSTLPQLSPERRQFLASML
                     DILIRQLAWPEDTEWEAPGNEDELDEDIAAFKNFRGSCRSFIESIAQIDKSLHTEVVA
                     RIVIATLDAYASGGGAAAVPWQQAELAMHLVYTFGEVSKNSTRAAFYELPPEMATKAA
                     RNKLRAAQGSGRTTPSSSDNVDLGPSSNNDRLEYEQFPLSPLGQLLTRCMTSGISSYP
                     HPSVTLQYFEIIVRYIEFWKAKPETLPGLFEALLDGQGIHNSDEGVRRRCFYLFSKLC
                     KDCRNDTVEGMVSPILDSMRDMMVINAELPPTDTPDEDPLIKATTGKSYVADQLYLFE
                     ASGNLVYLTKADPAKQMALLEAVAGPLLSGLGSGVERARVDENDLQAVLQVHHHLMAL
                     GHFAKGFPIVPDKLVELLPYTGPFKQMAEALLQAIEILKRRRVVRDAARFAFSQFANA
                     IGTPVAELVPRFVSAVVTEFEPSELVDFLLFLQLLMHRLQGSTFETMDMLLLPLLSRI
                     FTVLQQPVTGTDEAQVHARLKDAYLAFFTSLMNENLDGIFITDRNKPEFENVLTTLFN
                     LTQDYSDGASQRLAFGFFSRSVIAWGTSPEAAARPSVFAESAMASQSKMVSGGGTAQP
                     NAHAVTQEQRAKQCLPGYENFIYQRLLPAAFEVPANSQFNIRGGQLIVHEAAVLVRNT
                     VQARGQEAIDFMLSDLLRRLNCPSDIANQLIASLTTQQAKDFKKTFFDFIKAMRG"
     gene            745703..748933
                     /locus_tag="CNE02820"
                     /db_xref="GeneID:3257655"
     mRNA            join(745703..746158,746213..746446,746514..746817,
                     746869..746905,746965..747281,747343..747440,
                     747514..747643,747711..748000,748061..748833,
                     748884..748933)
                     /locus_tag="CNE02820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657229.1"
                     /db_xref="GeneID:3257655"
     CDS             join(745826..746158,746213..746446,746514..746817,
                     746869..746905,746965..747281,747343..747440,
                     747514..747643,747711..748000,748061..748513)
                     /locus_tag="CNE02820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512913.1"
                     /db_xref="GeneID:3257655"
                     /translation="MIRKNVSRAVGQRLHLPSSNPSLSSGTRTTRTTNLLGATQTFPL
                     CLRHHIHCTSLKNATPLISEVKLPHDHASNPPAALPPAPTDLLELYRGLVAAGRLNWD
                     DEQVRCVMKLRQLLDTLRDYSPPLELVAKLNPSAPYIAQQKEQTSWWKGNRNMGEHLG
                     FSKTNGEVEKRLVKVLSGEEELANLKTPKGILLTGPPGSGKSLLLSLFYQLLPISKKR
                     IHYHAFTLALYKEVFSEMNRRKSSDEEEWERKARNKELAGKKGWKSVFAGGRWDEEGK
                     ERLVWAKEEGMAFNIARRMILEYTVLYFDEFQLIDASSAALIRDVLSWYWRLGGVIVT
                     CSNRVPEDLYHHGVQKERLAGFLDALKARCEVVQVDGGRDWRREIERGDQIRWFHSKQ
                     QLDFERAWSAVLETQESKQKQIQVYGRTLTIPQAAGNTCRFTFSQLCEEALGPADYLA
                     LVSTFSTFFIDEVPTLYLRHKNEARRLINLIDALYESRCQVFLRSPSTPSTLFFPDAL
                     NLSSQEEETLTNERMMSAESLSATIQVPYRPNVSYYNNLSPAQRDREATEEKRKGTSF
                     SVLGIWTGEDEKFAYKRAVSRLIEMTSSPSYAVEEWAPLEPTLRSWEGQPHPPGGASK
                     TYKQLAPSPSYEVEDETNINIDSRVVIERCDSYHHPINNESEERKKLFKKDGDRKPPT
                     PIHEQHIWGVVDQWGEKAGRWGRGVRAFSPDPAASGVSCSCGKEKSCGQ"
     gene            complement(748522..750147)
                     /locus_tag="CNE02830"
                     /db_xref="GeneID:3257781"
     mRNA            complement(join(748522..748868,748924..749351,
                     749401..749497,749545..749630,749682..749695,
                     749757..749779,749840..749850,749906..750147))
                     /locus_tag="CNE02830"
                     /product="expressed protein"
                     /transcript_id="XM_024657230.1"
                     /db_xref="GeneID:3257781"
     CDS             complement(join(748656..748868,748924..749351,
                     749401..749497,749545..749630,749682..749695,
                     749757..749779,749840..749850,749906..750044))
                     /locus_tag="CNE02830"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512914.1"
                     /db_xref="GeneID:3257781"
                     /translation="MTTEQQNIPRAVLYSWPSSVWSTVPRLCLYEKGYSEDEYIVKYV
                     DITKGENFSPSYLKININGTVPTLIVPTLETIGAGVNTRYRSLRDTVSICDFLDQARS
                     SHTANTSSDKPAPTLTPATIDGKALSDSVIELVHRPIVDPNFIALSALNNEELKRKLR
                     SGPGKSLAIRREALQSYLAEAQKIASESSVASKEGSFTFEQKIVQFLEDKLRSSEDVW
                     QLYHGQAGEEKLRQFFDISLKTWTERLPEVFGKLEEMIEEPYFLGDQISLADLHVITW
                     LTRLVSIADGSPTKDGLSALEAKMDKPLGDKLRNFWALWTERESFQEVLIPTCSAFQQ
                     MK"
     gene            750388..757432
                     /locus_tag="CNE02840"
                     /db_xref="GeneID:3257682"
     mRNA            join(750388..751429,751485..751610,751666..752066,
                     752113..752255,752305..752369,752422..752545,
                     752597..752747,752796..752872,752993..753276,
                     753338..753638,753692..753741,753810..753863,
                     753915..754459,754514..754535,754584..754650,
                     754697..754772,754846..754933,754983..755102,
                     755154..755244,755294..755445,755496..755562,
                     755609..755631,755683..755875,755943..756051,
                     756105..756514,756566..756610,756688..756755,
                     756811..756828,756886..756956,757031..757052,
                     757107..757183,757255..757432)
                     /locus_tag="CNE02840"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_024657231.1"
                     /db_xref="GeneID:3257682"
     CDS             join(750517..751429,751485..751610,751666..752066,
                     752113..752255,752305..752369,752422..752545,
                     752597..752747,752796..752872,752993..753276,
                     753338..753638,753692..753741,753810..753863,
                     753915..754459,754514..754535,754584..754650,
                     754697..754772,754846..754933,754983..755102,
                     755154..755244,755294..755445,755496..755562,
                     755609..755631,755683..755875,755943..756051,
                     756105..756514,756566..756610,756688..756755,
                     756811..756828,756886..756956,757031..757052,
                     757107..757183,757255..757338)
                     /locus_tag="CNE02840"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_024512915.1"
                     /db_xref="GeneID:3257682"
                     /translation="MSHVLPIASTALIPFTTLTSFTIYLTTHSSSPIKRIIRQQDIAL
                     PVHNGEALDGTLDDKDAFDIDDPVVCEDGTPVEPQQFWISMWKRKLAVIGLMIPPLIC
                     NVLLLIFSLLAPSNDVENRQRNIILPALLLPSQAVTLLVGFWHLSQNEVSSHWPTTIH
                     NAIDIFTQFIILAFLALLPSSPLPSSPASPEVFGAALPNTYSSSLAFMKALLPVLYLP
                     PLVAILSVRRGPPLYLPFDAIYPSKIVSSVPPDAQSLDPQKANVSPEVQATIPEWLLF
                     GYATDVIRKGYVSESLDVWDLPILPRTLRALYQYKRMKRAYGKTKGRRGRMEGFNLLL
                     TVARVNSGLLWAQTLLAAATAFGYYLPHYLLKLFINFLENDPARAEPAWGWLLCFGLF
                     TSNALIFIASGVTWSICTTYLQGKIRLQLNTMLFKKTLLKKDIAASSGDKGQVGGVQE
                     EAAKDKKKKEENGESNAEDEETVTSKTQIMTLFTVDVDRVTEFVFHRMLVCYCVWPIP
                     IADNLILVFAVIDAPLEIVVASVFVFKLLDISAMYGLLTAILSLPLNHLASKIVVRAQ
                     ENLMKTRDQRTALMNEILQGIRMLKFMAWERSFESRVQTIRRNELSWQARNYQIEVAF
                     NCIWALTPVVVTVVSFLHYTLVRGQQLTPSVAFTSVAVFAELSPETFIQALQGFVSCR
                     RIEKYLCLDEVAAIEENDGEGDIVLSSATFTWPRDETAFENGLVIDAVSNAATPKTAF
                     TLADLNLRFPKGKLSLICGRLGSGKSLLLAGLLGEADLLTGHVVCPRSAPDAMSKGSA
                     NPSEDLWIVPNMVAYVPQQAWLQNASIKENIIFSSPWDAERYQQVIEACSLLNDLDIL
                     EDGDETEVGEKGLNLSGGQKARVSLARAIYSRAGVLFLDDVLSAVDAHTAHAIMTNCL
                     QGPIVEGRTILIVSHHTALVSPAAAYIVALENVGSGFSFTTVVIFLTKRCQGDVKFSG
                     TREEFVASNLSDELDEEDAQARPTDSEQKEEKTVEENSIQLTNKSVLNLSGACAESAA
                     PDSETSSLAPEDDKTIVNSKQKTPRKLIEDEKRARGRITWTVWKTYFSALGGPIWWSL
                     FILSLGMAMLVPVAEKGWLGYWTGSSLSSSEGGHTTRYYVMGYSVITIAGVFASNLQY
                     CIIYFGSLQASRRLHNSMLKSVLFSTLRFHDTTSRGRLLNRFGKDIEGLDSSTADNFV
                     RSAAYGLNVVVTFISITYVGGLPFVIAGCVVLIVYYQAGSIYGQTSRDMRRLDSVTRS
                     PLYSLFGETVSGVAVLRAFGASNMALKNMMKLADTNLLAFAWSWTVNRWLSARFNLLS
                     AVLVGLTAVAVLIAPNVDAAMGGFALAFAGTICHDLLFVVRRFVQLEQSMVAIERLKE
                     FTELQQEAPEYIEPRPAASWPEHGSIKVENLVVKYAPDLPSVLHNISFEVSPRQKIGI
                     VGATGCGKSTLALSFFRFVEAAEGRIEIDGVDISKIGLTDLRSRMTIIPQDPTILSGT
                     LRSTLDVFDEYDDVDIYAALRRVHLIKDENPVTSLDEQNDVENRNKNVFEDLSNPVSE
                     GGDNFSSGEKQLICMARAILKRNKILFMDEATASIDYETDALISKTIREEFSDSTIVT
                     IAHRIHTIIDFDKVLVMDRGNIAEFASPADLLRDHKSRFYSLCKATGRTEFKNLKEMA
                     LEAERKRKSV"
     gene            complement(756866..758816)
                     /locus_tag="CNE02850"
                     /db_xref="GeneID:3257759"
     mRNA            complement(join(756866..757437,757492..757569,
                     757619..757689,757743..757792,757833..757991,
                     758046..758149,758191..758283,758338..758371,
                     758428..758816))
                     /locus_tag="CNE02850"
                     /product="expressed protein"
                     /transcript_id="XM_570998.2"
                     /db_xref="GeneID:3257759"
     CDS             complement(join(757414..757437,757492..757569,
                     757619..757689,757743..757792,757833..757991,
                     758046..758149,758191..758283,758338..758371,
                     758428..758768))
                     /locus_tag="CNE02850"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570998.1"
                     /db_xref="GeneID:3257759"
                     /translation="MSPRYDDPYNDPYSHQERQYASDASFADARAQYGQSYAYHDANP
                     YEAELQYPSYPTDPSSGEYLNDSSTEKVPGNVRYESTERAQPGRSGLRRPATSFAGLG
                     PPPRSTGILRVWRKDERGKQWSRGGGIRTSLRFCCCCVTIAILVIVSIILAILLYVRP
                     PSVALNSVTVGSDPVSLTSDGLTVSFDLSISVSNPNWFDANFKEITATARYPGNNTNT
                     FGGGTLYNLDFKGYTQSTFNFPFTLNYTLAKDPNKVILNDLIEKCGISGGSAQDITVD
                     YDLNLKLKILGITIDPTVSNSASFECPITASDIESIIGSSS"
     gene            758924..760735
                     /locus_tag="CNE02860"
                     /db_xref="GeneID:3257688"
     mRNA            join(758924..759063,759119..759154,759204..759376,
                     759429..759559,759609..759814,759873..759971,
                     760024..760044,760089..760208,760270..760320,
                     760389..760412,760462..760494,760558..760735)
                     /locus_tag="CNE02860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571208.2"
                     /db_xref="GeneID:3257688"
     CDS             join(758998..759063,759119..759154,759204..759376,
                     759429..759559,759609..759814,759873..759971,
                     760024..760044,760089..760208,760270..760320,
                     760389..760412,760462..760494,760558..760569)
                     /locus_tag="CNE02860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571208.1"
                     /db_xref="GeneID:3257688"
                     /translation="MSGPPEESLRHLILAKQREKEAAEHQRQKEALLKESQRDHTADR
                     FVGVSENLDERLIKTTVGLVTLSDFKKTKDDLEEQQRKLAAQVQSEKIASAAKVKKAR
                     KKERTSKLSFADEEEENEDETSTGGVKRLREDEGDAHVRKKFTKNPGVDTSFLPDRNR
                     ELQEAEERERLRKEWLEQQEKIKAESIEITYSYWDGSGHRKAVECKKGDDIATFLAKC
                     RQQFPELRGTSVENLMYIKEDLIIPHHYTFYDFIINKARGKSGPLFNFDVHDDVRLIQ
                     DATVEKDESHAGKVVERSWYNRFKHIFPASRWEVYDPDKDYGSYRIA"
     gene            762207..764224
                     /locus_tag="CNE02870"
                     /db_xref="GeneID:3257708"
     mRNA            join(762207..762694,762749..762756,762811..762901,
                     762957..763031,763087..763165,763222..763254,
                     763303..763640,763711..764224)
                     /locus_tag="CNE02870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571210.2"
                     /db_xref="GeneID:3257708"
     CDS             join(762334..762694,762749..762756,762811..762901,
                     762957..763031,763087..763165,763222..763254,
                     763303..763640,763711..764201)
                     /locus_tag="CNE02870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571210.1"
                     /db_xref="GeneID:3257708"
                     /translation="MRKLFRSIRLFPRPYLQPSGSVFPISSMKMAPGTTRGASPVIDS
                     EHQSKRPRLKAEDTQIPNPSGIEVQGSSSDCNHSIMSEDDLIEEQMRLPIEYVRSYDN
                     EINYKNKLVLAPMVRTGSLPMRLLSLYYGAGLVWSPEVVDRAIIGAERSVDPVTGVIT
                     YHKGQGPIFSTHPAEKPFLIFQIGSSNPELAVKAAQTVQQDVAGIDLNCGCPKPFSTH
                     AGMGAALLSTPELLLDILRALLDSIPLPISCKIRLLPTQPSTLYLASRILRTGVRNLT
                     VHCRTRQMRPGERALWERLSSIVELGKRRGISVICNGDGEGWSNWDRIRNETGADSVM
                     LARSAERNPSVFLPSGPLNTVTDIIPKLLALSDYLKNPWGNTKFLLMQFKPSPPPLSS
                     MSKAERKRIADIFSQSKSTQEAAVGLGISLVDGDRLFREIQRKINVDTNRNIWQARTE
                     MKLNNAGDVEGKEAIEEEAIIDGFEVGVGPAQEQKMTACRS"
     gene            complement(764324..767045)
                     /locus_tag="CNE02880"
                     /db_xref="GeneID:3257864"
     mRNA            complement(join(764324..764628,764685..764795,
                     764839..765018,765055..765408,765455..765643,
                     765689..765754,765791..766081,766123..766172,
                     766213..766540,766597..766722,766760..766827,
                     766891..767045))
                     /locus_tag="CNE02880"
                     /product="expressed protein"
                     /transcript_id="XM_024657232.1"
                     /db_xref="GeneID:3257864"
     CDS             complement(join(764479..764628,764685..764795,
                     764839..765018,765055..765408,765455..765643,
                     765689..765754,765791..766081,766123..766172,
                     766213..766540,766597..766722,766760..766827,
                     766891..766930))
                     /locus_tag="CNE02880"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512988.1"
                     /db_xref="GeneID:3257864"
                     /translation="MQDITQWFLEECDGLLWGELVKPSALTMMDAMKAIQLLDPKMDT
                     GILSNFKSPYMFRPEDPLTPEELCWIMDKMTALEISWYRGATLCQSVYTCLYYHNLYL
                     MDPSFEPKQSTQEDVFSSQILRAYLLLYCKTIDLVYTELSKGNTVEGEDCWLDHYGLP
                     VKVNDDVETIVEFANEALAWLENVKADSLDSFGEQLINRLVFRRNYLRYLDCAASVDI
                     SLEQTLLVMRLTAQDTSPSAIQPSEITRLGFDPKIPSYLRQCMPLPEFRQPTFKQSWE
                     CMINMTEELLHVERLLGTGDWIQWKAFFWGMTLNDRERLPIVRSLIQSRFTAFCYDSH
                     QGHRNIDRLAKEAILYECGDRNEVVKVLDTLDDMIDGPNMQQLKMWRALITKDIMMDL
                     IMPLQNPPRQRRSLISLSTQWQHRMMMGSRLSSQHEFSPILVSVLEVFRLDCLLEAAL
                     SAIELNLIHFSEEREVWWWISEVAVTRASAHISSSSFKAIWAQVWTYIGSAMQILLVL
                     VPLPFDDSILSKPRFALRHKHLLYATHVSGDSVTDVGLTPKYEKWISQRRRLDRKQDS
                     CGLKEVTKLFSKARESLDDLLLQQSRNLRTANHIVSLRLALEHNIRLISEIGTERNLM
                     WDLNTNDRKGRWIMLLLAPDTVTLNE"
     gene            767254..768628
                     /locus_tag="CNE02890"
                     /db_xref="GeneID:3257924"
     mRNA            join(767254..767388,767459,767535..767539,767597..767624,
                     767692..767715,767769..768028,768083..768125,
                     768198..768235,768288..768334,768385..768511,
                     768570..768628)
                     /locus_tag="CNE02890"
                     /product="RAN small monomeric GTPase, putative"
                     /transcript_id="XM_024657233.1"
                     /db_xref="GeneID:3257924"
     CDS             join(767338..767388,767459,767535..767539,767597..767624,
                     767692..767715,767769..768028,768083..768125,
                     768198..768235,768288..768334,768385..768511,
                     768570..768587)
                     /locus_tag="CNE02890"
                     /codon_start=1
                     /product="RAN small monomeric GTPase, putative"
                     /protein_id="XP_024512917.1"
                     /db_xref="GeneID:3257924"
                     /translation="MENTATFKMVLCGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVH
                     PLTFHTNFGTICFNVWDTAGQEKFGGLRDGYYIQGQCGIIMFDVTSRITYKNVPNWHR
                     DLERVCENIPIVLCGNKVDVKERKVKTGNVTFHRKKNLQYFEISAKSNYNFEKPFLWL
                     ARKLVGNQSLEFVAAPALAPPEVQVDQALIAKYEEELKAAANAPLPDEDDADL"
     gene            complement(770933..772463)
                     /locus_tag="CNE02900"
                     /db_xref="GeneID:3257562"
     mRNA            complement(join(770933..771065,771127..771349,
                     771411..772045,772096..772463))
                     /locus_tag="CNE02900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571002.2"
                     /db_xref="GeneID:3257562"
     CDS             complement(join(770957..771065,771127..771349,
                     771411..772045,772096..772247))
                     /locus_tag="CNE02900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571002.1"
                     /db_xref="GeneID:3257562"
                     /translation="MTTPKIQREYLFKDDPRQPEVHCSTIQAACGVEYVTWFGGTKEG
                     TSDVKIWFSKCTNGCWTPPRVIAGSGDIVHWNPVSFLPDPKGAPGHLYVFYKTGTPIP
                     TWKTYVIETIDGGNTWTEPRELVPGDHSGGRGPQKNPPIVLSNGDWLSGASKEVTLEG
                     GKGLWDAFADIAPTPKEGDTFKQGERWVKAEFIKLPADRGVEGGSFPGEGIIQPSLWE
                     SADKPGHVHMMCRSSIGRIVRADSEDYGRTWTPGYATDLPNNNSGQCVTRLRDGRLVA
                     AVNDVYKNWGPRTPLVLKVSFDDGETWSPWCTLEDQAPPASFQRVIALETGIVNDGKS
                     EFSYPTVTPTAETDEIGVWVSYTWQRRGIAVCKVTDGE"
     gene            772977..775697
                     /locus_tag="CNE02910"
                     /db_xref="GeneID:3257991"
     mRNA            join(772977..773139,773205..773244,773395..773577,
                     773635..773739,773805..773933,773989..774011,
                     774076..774283,774372..774566,774670..775073,
                     775142..775230,775321..775697)
                     /locus_tag="CNE02910"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_571004.2"
                     /db_xref="GeneID:3257991"
     CDS             join(773098..773139,773205..773244,773395..773577,
                     773635..773739,773805..773933,773989..774011,
                     774076..774283,774372..774566,774670..775073,
                     775142..775230,775321..775540)
                     /locus_tag="CNE02910"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_571004.1"
                     /db_xref="GeneID:3257991"
                     /translation="MGFHIIEDRPTPPAVYNWRVYMMGCCIAFGALTFGYDAAFIGTT
                     ITRPGFTAAFGIDEMSASEKINNSANLTSSFTAACFFGAVFAWPMMEAWGRRPALQVS
                     AAIFNIGAIVMTAATHQLSMIYAGRVLTGLGVGIITAVVPSFLAELSPPPIRGVLTGL
                     FEIAYQIGNLVGFWINYGVTHTIDLNSSNSYRIPIAVQLIPGGLFAIGCMFFKESPML
                     LIKRGREAEAIANLEWLRMLPGDHLYIQEELRMIHTRIEEENKVAGGEGKGIKNYFVG
                     CIREMKVPSIRHRFALVLGMMFLQNFSGAITINYYSPSIFKAIGLTDVTLWTGIYGVF
                     KASGAILFFMFGIDRFGRRNPWMLSAACCGLCLIYLGAYIKVGHPGTAEVLSESTKKG
                     GNAATAIIMLYALFWSFGGNGLPWIVSAEIFPVRLRSLAGSWAGVNQWLASFAATQAF
                     PKMLSKMDWGVFIFFAGICAATVIFTFIWIPETKGIPIESMDLLFGGPTRHMQWRQKR
                     AYPPDGVPALTIDLPHHVETPYDGKKEADDFIEHNSV"
     STS             776053..776845
                     /standard_name="Pst23"
                     /db_xref="UniSTS:470806"
     gene            776299..779047
                     /locus_tag="CNE02920"
                     /pseudo
                     /db_xref="GeneID:36392870"
     gene            779060..783869
                     /locus_tag="CNE02930"
                     /pseudo
                     /db_xref="GeneID:3257531"
     gene            complement(783903..790121)
                     /locus_tag="CNE02940"
                     /pseudo
                     /db_xref="GeneID:3257867"
     gene            complement(791090..794746)
                     /locus_tag="CNE02950"
                     /pseudo
                     /db_xref="GeneID:3257866"
     gene            794789..799429
                     /locus_tag="CNE02960"
                     /pseudo
                     /db_xref="GeneID:3257760"
     gene            complement(800944..804006)
                     /locus_tag="CNE02970"
                     /pseudo
                     /db_xref="GeneID:3257868"
     gene            805360..810228
                     /locus_tag="CNE02980"
                     /pseudo
                     /db_xref="GeneID:3257952"
     gene            complement(810264..815174)
                     /locus_tag="CNE02990"
                     /pseudo
                     /db_xref="GeneID:3257948"
     gene            817251..823712
                     /locus_tag="CNE03000"
                     /pseudo
                     /db_xref="GeneID:3257988"
     STS             846221..847063
                     /standard_name="Sal1"
                     /db_xref="UniSTS:470803"
     STS             848732..849154
                     /standard_name="Hae4"
                     /db_xref="UniSTS:470804"
     gene            complement(854321..857601)
                     /locus_tag="CNE03010"
                     /db_xref="GeneID:3257536"
     mRNA            complement(join(854321..854498,854552..854662,
                     854707..854756,854795..854862,854914..855161,
                     855241..855425,855500..855546,855617..855762,
                     855818..856309,856360..856439,856499..856781,
                     856835..856897,856950..857083,857138..857253,
                     857293..857401,857458..857601))
                     /locus_tag="CNE03010"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570847.2"
                     /db_xref="GeneID:3257536"
     CDS             complement(join(854403..854498,854552..854662,
                     854707..854756,854795..854862,854914..855161,
                     855241..855425,855500..855546,855617..855762,
                     855818..856309,856360..856439,856499..856781,
                     856835..856897,856950..857083,857138..857253,
                     857293..857401,857458..857476))
                     /locus_tag="CNE03010"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570847.1"
                     /db_xref="GeneID:3257536"
                     /translation="MFVLKSLLGKMWGNPANPELIQIPAGLLYLVRPDSIKGSRECIF
                     QDAVATIRRTGTEYQYQLVVTRAYEEGEEQLLDEDAETDDERVFLIDQSLQFRFGTLD
                     GDATCSWKDLSGEEGDLWEFVSSKSVPRATNSLFELTLLHCMFERKYLRSHEEATDEQ
                     LQALKYTEEHDTLKTAARPEDITVEDQLSSLGLEDPEDPFQDVPILHRASADLYVFDT
                     ETELFVIQGSNVSADLAENAEFDTWIIVRQGTTPFISAPVDAELNAHFDMANHAFMFT
                     FREGDGVPAMTWCLRFKADCFCEWKDKFTIYMWEGKNKVKYAKAKADEQKYIQEAYED
                     IEMAEPEEEEVNEDGGEIEGEEGHEDSAHEDEDNDSGEESFAQGSKNQHLAVGYKNDL
                     SYVTRGDMIGVFAHNGDRLKFRTAIDRIKNVQGKTFSPHKMMLHNQDSDMLLLDPSNK
                     GSVYRMDLEYGKVVDEWKVSDAVAVNNIIPDTKYAQMNPQQTLIGHSHNGVFRIDPRV
                     SGNKLVESQFKQYASKNDFSAATTTESGKLVVASNKGDIRLFDQIGKNAKTALPALGD
                     PIIGVDVSADGRWLVATCKTYLLLIDTLIGDGRYKGSLGFDRSFPAESKPIPRRLQLK
                     PEHVAYMEDPVSFTPARFNTGINEAEKSIVTSTGNYVITWNFRMLKQGRTDTYQIKRY
                     DSRVVADNFKFGADKNIIVALEHNVLVANKKDMAKPTRSSLAPNTLLSTPARKIHQSH
                     NDIVNSPY"
     gene            857743..859562
                     /locus_tag="CNE03020"
                     /db_xref="GeneID:3257827"
     mRNA            join(857743..857816,857870..857935,857997..858920,
                     858974..859028,859082..859225,859263..859315,
                     859376..859426,859464..859562)
                     /locus_tag="CNE03020"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_570849.2"
                     /db_xref="GeneID:3257827"
     CDS             join(857814..857816,857870..857935,857997..858920,
                     858974..859028,859082..859225,859263..859315,
                     859376..859426,859464..859484)
                     /locus_tag="CNE03020"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_570849.1"
                     /db_xref="GeneID:3257827"
                     /translation="MGQAPSSGAGNNKKGNSKDNKDKPKWEPPVPTRIGKKKRRGPDA
                     SSRLPAVYPTTRCKLKLLKMERIQDYLLMEEEFVSNQASQSGEDRTAADRTRVDELRG
                     SPMGVGTLEEIIDDDHAIVSSGGGSEYYVGIMSFVDKDLLEPGCSVLLHHKTHAVVGV
                     LADDTDPMVSVMKLDKAPTESYADIGGLESQIQEIKESVELPLTHPELYEEMGIRPPK
                     GVILYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKLVRELFRVAEENA
                     PSIVFIDEIDAIGTKRYDSTSSGEREIQRTMLELLNQLDGFDTRGDVKVIMATNKIEN
                     LDPALIRPGRIDRKIEFPLPDTKTKRHIFKLHTSRMSLADDVDIEELVMTKDELSGAD
                     IKAVCTEAGLLALRERRMRVTRTDFTTAREKVLYGKDENTPAGLYL"
     gene            860074..861226
                     /locus_tag="CNE03030"
                     /db_xref="GeneID:3257710"
     mRNA            join(860074..860168,860233..860362,860426..860552,
                     860611..860643,860717..860780,860831..861003,
                     861050..861226)
                     /locus_tag="CNE03030"
                     /product="ubiquitin conjugating enzyme, putative"
                     /transcript_id="XM_024657234.1"
                     /db_xref="GeneID:3257710"
     CDS             join(860313..860362,860426..860552,860611..860643,
                     860717..860780,860831..861003,861050..861130)
                     /locus_tag="CNE03030"
                     /codon_start=1
                     /product="ubiquitin conjugating enzyme, putative"
                     /protein_id="XP_024512863.1"
                     /db_xref="GeneID:3257710"
                     /translation="MFGNNNSRSQSSTATRRLMKEYRDLTADPLQDTITAGPVSEDNM
                     LEWEALIQGPEGTPYEGGVFAARLVFPSDYPLNPFTMTFDPPLLHPNIYPNGLVCISI
                     LHPPGDDPMQYESASERWSPVQGVRSVLLSVLSMLAEPNIESGADIECCKLYRDNKPE
                     FERRVREQVKNLLGI"
     gene            complement(861118..865075)
                     /locus_tag="CNE03040"
                     /db_xref="GeneID:3257694"
     mRNA            complement(join(861118..862494,862547..862696,
                     862762..862911,862987..863760,863799..863935,
                     863996..864180,864219..864430,864468..864610,
                     864648..864665,864716..864876,864924..865075))
                     /locus_tag="CNE03040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570853.2"
                     /db_xref="GeneID:3257694"
     CDS             complement(join(861187..862494,862547..862696,
                     862762..862911,862987..863760,863799..863935,
                     863996..864180,864219..864430,864468..864610,
                     864648..864665,864716..864876,864924..864925))
                     /locus_tag="CNE03040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570853.1"
                     /db_xref="GeneID:3257694"
                     /translation="MFGRHNADYDDYPTVRAAASGSSHQPTRPVDKEKTEAELSVNIK
                     KATSPEETAPKQKHVRKCIVYTWDYHSSLSVWNGLRTQPILADEVQTFKALIVVHKLL
                     QEGHPVTLKEAHAQTGWLETCGRTVGDSGKGYGALIKAYTSFLLAKLRFHRHHPEFNG
                     LFEYEEYISLKNIDDPNEGYETITDLMTLQDQIESFQKLIFAHFRGSANNECRISALV
                     PLVKESFGIYKFITSMLRAMHRRTDAADALLPLRERYNAQHFNLRRFYYECSNLKYLT
                     GLINVPKLGQEPPNLIDNGVAPELPERPTTDKRPERKETPRPSSPQATQGEIDEQRRM
                     LEEYERKQSALVAQRESDQRRQEEEKRRHEAEYAEQQRLQQEREAQAQHQLQEQLLRD
                     QMSQQWTQQQAGQAAQLQQEMLTMRGQYERDQMLLEQYDRRVKALEQELGSIGVNIGA
                     QMSAKDELIAQLQQQIETWKNKYEALAKLYSQLRTEHLDLLNKTKGFQLKANSAQEAV
                     DKMERMERDVKAKNLELADMIRERDRARYDLDRLKSSHREETDRIKRDLAFANERAED
                     ASRHKSSEVSDVMSRYNRQLTELEDSLRAKQLQIDDLLRKLDEKQSEVQHVMDEKEQE
                     LAIMQEGMDSTLKQLGDLKLAQGETNQALDAQIDTLILDHRKELNVIIDSILQACMQK
                     VDDAIYELEAPMQTGNTTATPEYTLSMIEKAMTNATEFASTFNLYLSKKSGGGQVDVI
                     KTANEFCQALCETLVSSKGITRFAETDDSSEKLVKVAKDAGDAGYRFFLNLQSFRLLA
                     GGKNEEAALRNNAETRSALSKLSDTVEKFVPKAKTTLAQANGDIGDIVTQEMQNAAKA
                     IEEATQRIQVLMARPKNVSKYDSLDIQVHDAILQATLAITNAIGRLIQAATESQEEIV
                     KEGKGTSTTQQFYKRNNRWTEGLISAAKAVAYATGLLIESADGVISGTHSLEQLIVAS
                     NEVSAATAQLVAASRVKASLMSKSQQLLELAAKAVTDACKALVKQVKLISNKQSDDEV
                     VDYKSMPSHEFKVREMEQQVEILKLEKELGAARRRLGEMRRAGYHQETD"
     STS             861942..862723
                     /standard_name="Eco13"
                     /db_xref="UniSTS:470805"
     gene            865289..867095
                     /locus_tag="CNE03050"
                     /db_xref="GeneID:3258004"
     mRNA            join(865289..865681,865725..865849,866056..866324,
                     866370..866531,866576..866660,866712..866744,
                     866802..867095)
                     /locus_tag="CNE03050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571206.1"
                     /db_xref="GeneID:3258004"
     CDS             join(865444..865681,865725..865849,866056..866324,
                     866370..866531,866576..866660,866712..866744,
                     866802..866822)
                     /locus_tag="CNE03050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571206.1"
                     /db_xref="GeneID:3258004"
                     /translation="MAPFDLDACIDRLRNKQLLGEALIREICEKTKEVLMRESNVVHV
                     SSPVTVVGDIHGQFHDLIEIFRIGGAAPNTNYLFLGDYVDRGLHSVETISLLTCLKLR
                     YPERIQLIRGNHESRAVTQTYGFYLECTRKYGSPAVWQYFTDMFDYLTLSVVIDDAIF
                     CVHGGLSPSIHQIDQIKIIDRFREIPHEGPMADLVWSDPDPEKEDFAISPRGAGYTFG
                     ASIVKKFLHLNNMNHVLRAHQLCMEGYSVLYNDQLSTVWSAPNYCYRCGNMASILEVS
                     PGGRRFFNVFSAAPENERDGPSQQQPGKQIEYFL"
     gene            complement(866353..867925)
                     /locus_tag="CNE03055"
                     /db_xref="GeneID:36392871"
     mRNA            complement(join(866353..866785,866835..867090,
                     867158..867272,867328..867664,867730..867925))
                     /locus_tag="CNE03055"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658533.1"
                     /db_xref="GeneID:36392871"
     CDS             complement(join(866852..867090,867158..867272,
                     867328..867664,867730..867863))
                     /locus_tag="CNE03055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514381.1"
                     /db_xref="GeneID:36392871"
                     /translation="MTDPNFPPNLDIKPLLLSHDHPHGQIQSENQTNAIAAYGIAGRV
                     WEATKPLLDYFTPSQAYEPPCSLFASCGPHCVVELGSGQSVASLHLAAHLAPQDTIVL
                     TDLPAVIPLCEKCIDSWRPPKCHAKVVARPLAWGQNTSHLREEFGLISHILMCDLIYF
                     PHLYPLLLHTLLSLTEPSSVADVEDETFGPEVILSYTTRTLALEESFFDALAYYFKTT
                     PVRGGTWEAKVFIGKRWKVTKDWSLPDIKDVMNGSKEVIRGRSYGLIDELFGTLDW"
     gene            868178..871253
                     /locus_tag="CNE03060"
                     /db_xref="GeneID:3257527"
     mRNA            join(868178..868196,868250..868331,868410..868710,
                     868775..868985,869039..871253)
                     /locus_tag="CNE03060"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_571207.2"
                     /db_xref="GeneID:3257527"
     CDS             join(868250..868331,868410..868710,868775..868985,
                     869039..869152)
                     /locus_tag="CNE03060"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_571207.1"
                     /db_xref="GeneID:3257527"
                     /translation="MARSKPLAPHVGRLSRSQVAAKRGLFKGQKAGAAPAKTETPAFT
                     EKKVGGKANGEKRLVPTNKASKYYPAEDVRKPKVSRKNPGKTVLRSSITPGTVLILLA
                     GRFSGKRVVFLKQLDSGLLLVSGPHKLNGVPLRRVSQAYVIATSTKVDISGVSIPESI
                     NDAYFAKAKAAKSSKEGEFFGEGKEKKAFPEEKKAEQKAVDAALIASIKKVDNLSKYL
                     KSSWGLSKSDRFHELKF"
     gene            complement(869154..877013)
                     /locus_tag="CNE03070"
                     /db_xref="GeneID:3257797"
     mRNA            complement(join(869154..869236,869319..869480,
                     869519..869634,869676..869760,869815..869902,
                     869965..870090,870142..870233,870300..870424,
                     870461..870658,870696..870939,870982..871176,
                     871214..871280,871357..871488,871544..871609,
                     871660..871757,871799..872559,872596..874303,
                     874342..875046,875086..875338,875376..875663,
                     875700..876423,876461..877013))
                     /locus_tag="CNE03070"
                     /product="UVSB PI-3 kinase, putative"
                     /transcript_id="XM_024657235.1"
                     /db_xref="GeneID:3257797"
     CDS             complement(join(869201..869236,869319..869480,
                     869519..869634,869676..869760,869815..869902,
                     869965..870090,870142..870233,870300..870424,
                     870461..870658,870696..870939,870982..871176,
                     871214..871280,871357..871488,871544..871609,
                     871660..871757,871799..872559,872596..874303,
                     874342..875046,875086..875338,875376..875663,
                     875700..876423,876461..876932))
                     /locus_tag="CNE03070"
                     /codon_start=1
                     /product="UVSB PI-3 kinase, putative"
                     /protein_id="XP_024512866.1"
                     /db_xref="GeneID:3257797"
                     /translation="MAPLATQYNIQGADLQSLLPRLLREGLTPSGDQQQSSPGDLVQV
                     LLEHCILKPLSTKSTVDAQQSTYTLAIIKRQATISPRFLTETYNQAPFYQWLIPRLLK
                     IACSSIASVPTDELVQVVVYIIQILGRDQPDDEDTWAKGPGRAAQILSQLTLFCQDVI
                     DGHKSKLYDFAELPSNISALLSIVSAILQLDLPFALSFVATACVQLSEASCLINTPES
                     QLLYIQTVNTALGRNIYQGLTKACSYVSSIDIIDGADGKTALMMFYEKMASAHETLKY
                     DVWWSLLRQCGNLDIKDDSIGFPAICHLLTPVAPRLSRETIKQIVGLDQIKDWEKTAK
                     EISVQTGNSVKLDTVSAFLQKDVQKSRKRKRRTSENLIADLRELLPDLPDPPEGSSIL
                     DILLQDSLSLSAIAHLMPQIVRFAVGEHDRPRCPTSSAFDPKILELWIKVDVFNLSMM
                     NALSSIVEHAPSGKIVAEFQNLEIIHEKVVMGLNARERPMRVAAGRTLSLLFMAQNAG
                     VDHIIAGKNQQRYIEAASTPLRSPATAETAVLLLGDLGRLAQGESLCFVLQLLLRQLG
                     SYNAPLRSLAYTELVALAKHHRKTPYTLLSPFLDRISVLLADNIIRSPYMISETMQFI
                     GSTRQNFLHTTLPHILPALVLSRNREALIHVASIVKQRLGRLFMDHTAGILAQVFLHP
                     QQTAESLVFLVDLIRTMTHGYSEHEPLITVESLMGSCMVDLMVILVVELGDQDKAARR
                     AAKLGLSKAMAYQRTNTDLGAFLKPYMLGVISQLNDMLHDVLGKKSVEYKKKIIRSMG
                     VLIKLVGDSMSSFSPQIMASLQSTLGIKELRHETLNTWAVFTSTLKYADIGPFVGRTT
                     GALVANWPTFDKTAKSVAIRIINEIADSANDLSQFVEEVVGMDHIDELQRAASLLTAQ
                     RKKWPIDIRITKVLDRVASKNIAISLASIRELRLLLVTLQGSIQDLVKGDTFNPVAAR
                     LMSTLLSIATRDGDCQELRDLSYECLGIIGALDPDRLGFHVESNTLTIASNFADHKES
                     LDFALHLVRDLLVDAFRATNDTKHQNHLAFAIQELLRFCGFSLKVIHPASKIDPSIRQ
                     RWQSLPKDLLETLTPLLESRFTLHDVSFRTFSHPIYVTAPTYREWLQRWATDLISKVM
                     SMPDTDRSVSDSKAIFGVFCGVLRNQDVSVAHHILPHLVLNVLLSGVQEYRDEICLEI
                     KTVLQDQVQPTSPADRRSLSAQVIFDLMDHLSKWLRLQRVKGNHLDRGEKSKIVEGVL
                     SSIETELMAHAALQSKAYARSLRSFEERIIQLRKERKDTAELQTYFERLHQIYAELDE
                     PDGMEGVSAFVISPSLEHQIREHESTGRWTSAQSCWEVRLQQSPDDPTLHVGLLKCLR
                     NLGHYDTLRTHIRGVITRHPDWSLQLAPFAAEAAWIIGDWDTVRQVGPDCPPIGQALL
                     ALHEDGDLSSVLTRVRREVGAGITGKGYTPVYEALLQLHLVQEIAMIQDTKKEIQIVS
                     KSKNRHKVVQQHVRQLTASLDSRFYTTSPAFRVREAILSIRRTALGLMNTPSLNPEIG
                     DAWILSSKIARKAGYEQTAYSATLQAREADAPFAFVQEAKLRRAQGSVFKALTDLQNT
                     LAPLATDSKASESIEHESFRRSRDLAKAVLLLARWANETDRFDQNEIVKRYTQAITLC
                     DTLESPYYHLGHFYDGQAGDPAQKIIYNYHTCNYYSLALRHGVKYIFQTMPRMLTLWL
                     DLGDTKDTKKKKFISKIHSVVGEAAHDLPAYQFYTAFPQIVSRIVHPSVDVSRILRSI
                     MVRVISEYPQQALWPMVGVMKSCQDERRHACIAVFQKATSISTTIRDADTFSTILLQF
                     TDHKVDGRKREKSIQSHFPYVKYAFPTKMILPLQDALTCSLPTSSDTVKTHNPFPNTP
                     IEIHDVEDRVDVMPSLQRPKKLVFIGSDGKAYPFLCKPHDDLRKDARVMDLNSMINKL
                     LKSASESRRRQLYVRTYAVMPLNEECGLLEWVTNTHGFKGILETNYGRQNKKIFTNEV
                     IDLLTTTRKQCQPEVLTAIFKDKVLPLYQPTVFHEWFLTSWPEPSAWLSSRLAYSRTL
                     AVMSMIGYILGLGDRHGENILFDGLSGDTVHVDLNCLFEKGKTLEIPERVPFRLTQNM
                     VDALGVTGVEGVFRKAAEITMSILRSNSDSLMSVLEAFVHDPLVEWTSRGRGKSDPRD
                     IRSNADKNLHPIKRKLRGVMNEGTVVSVPNQVETLIKEATSPRNLSAMYVGWAPWL"
     gene            877175..878833
                     /locus_tag="CNE03080"
                     /db_xref="GeneID:3257572"
     mRNA            join(877175..877460,877498..877829,877879..877968,
                     878049..878270,878315..878497,878537..878833)
                     /locus_tag="CNE03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_570857.2"
                     /db_xref="GeneID:3257572"
     CDS             join(877229..877460,877498..877829,877879..877968,
                     878049..878270,878315..878497,878537..878800)
                     /locus_tag="CNE03080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570857.1"
                     /db_xref="GeneID:3257572"
                     /translation="MSKKSDLLVRVRYLNPLPNPPFPPKLLNVNTNISRLGEPAYLDQ
                     LAATTPLPMLVDSEMGMPLDLNAYDGAWDGKDQSLNPIPDSDRVHHPVDLTLLAPFNP
                     PSTSNGDLKSVPSSNEVSWMRNSSYLTRRNNAKRKDAAEIREEVAVDASEAAQLLMIE
                     KTFLDITSQDVNQLQHPNPKKRHLKVVESYDVLPDDEAWPNNYILLRFPERPSAATAI
                     NPAAGASSPRLSKSILRPIVQDDQQMMEFYLPQEEDLPKLDEAYGRAVDEEPLEKIMR
                     LNEENPNDPEIDHIFSNVYYDRIRTYEVVSTSAPKKEILVSFQEGEENDNEPATKKRK
                     GVYYKEINFRTLLRKTRTKPHDEVDGQSDRWDKSRVGFRLPSQADIDHRDEAKSQVAD
                     PTWANEELRRIHGGDNMAEGQGEAIDDEEVGVDEGAIEAERGAHDESE"
     gene            complement(878807..880039)
                     /locus_tag="CNE03090"
                     /db_xref="GeneID:3258000"
     mRNA            complement(join(878807..879532,879582..879809,
                     879866..880039))
                     /locus_tag="CNE03090"
                     /product="NBP35, putative"
                     /transcript_id="XM_570859.2"
                     /db_xref="GeneID:3258000"
     CDS             complement(join(878858..879532,879582..879809,
                     879866..879973))
                     /locus_tag="CNE03090"
                     /codon_start=1
                     /product="NBP35, putative"
                     /protein_id="XP_570859.1"
                     /db_xref="GeneID:3258000"
                     /translation="MIATQRPFPIPSPVPLAPSSTVLPTTVPENAPEHCPGVESSQAG
                     KADACEGCPNQSVCAEGPKGPDPDLPLIRERMSSVRRKILVLSGKGGVGKSTFTAGLS
                     WALAADEECQAGIMDIDICGPSIPLLMGLESSTIHTSASGWSPAYALDNLAVMSIGFL
                     LPSSSDAVIWRGPKKNGLIKQFLKDVEWGDLDYMVVDTPPGTSDEHLSIVQYLKEAGI
                     DGAVLVTTPQEVALQDVRKEIDFCKKVGIPILGLVENMSGFVCPNCKNESQIFAPTTG
                     GAEAMGKELGIELLGKVPLDPRIGMTCDQGMSFLDEYPESPATMAYLDIVQRIREILD
                     DE"
     gene            complement(881349..885294)
                     /locus_tag="CNE03100"
                     /db_xref="GeneID:3257551"
     mRNA            complement(join(881349..881777,881846..881877,
                     881941..882282,882327..882385,882423..882554,
                     882617..882722,882781..882811,882860..882972,
                     883019..883154,883204..883292,883343..883554,
                     883601..883892,883928..883969,884033..884092,
                     884137..884230,884292..884353,884409..884505,
                     884551..884609,884664..884765,884827..884917,
                     884990..885294))
                     /locus_tag="CNE03100"
                     /product="phosphoketolase, putative"
                     /transcript_id="XM_570860.2"
                     /db_xref="GeneID:3257551"
     CDS             complement(join(881540..881777,881846..881877,
                     881941..882282,882327..882385,882423..882554,
                     882617..882722,882781..882811,882860..882972,
                     883019..883154,883204..883292,883343..883554,
                     883601..883892,883928..883969,884033..884092,
                     884137..884230,884292..884353,884409..884505,
                     884551..884609,884664..884765,884827..884917,
                     884990..885156))
                     /locus_tag="CNE03100"
                     /codon_start=1
                     /product="phosphoketolase, putative"
                     /protein_id="XP_570860.1"
                     /db_xref="GeneID:3257551"
                     /translation="MPTLDAVTPPKPSSLPPDIVTQLLINLDGKVDQLKSSKGGLDIE
                     GLIAFQRVANYLAAAQIFLQHNGLLTQPLETKHIKSRLLGHWGTCPGLNFVYAHTNNL
                     ITNHETDPDVPEFMFLTGPGHGAPALLSTLFMEGSITRFYPEYPMSREGLEHFIRSFS
                     LPGGFPSHVNAETPGALHEGGELGYCLAVAYGSIMDKPNHITVAVIGDGESETGPTAT
                     AWHAHKFIDPAESGAVIPILHVNGYKIGERTIPGTMDDLELACLYTGYGYQVHIVEYG
                     SKSPEKASDHEHDIAVQYDMAAAIEWAYQEIKNIQQCARSGRPITKPRWPMIIMRTPK
                     GWTGPKKAEGHLIEGNWRAHQVPLPKAGDEGEEFELLKKWLHSYGPEELFHVEVDSNT
                     SQAHEAVNKAKGIIDSRALRIIPKDQQRRMGMVNATYRGFIPLKTPEWKEYGHDMEEE
                     VSNMKAVGDYVAKVIEMNPSTFRIFSPDEITSNKLDAVLDVTQRNFQWDPETANKGGR
                     VIEMLSEHTLQGWMQGYTLTGRHALFPSYESFLGIVQTMIEQYAKFLKMALETKWRSD
                     VSGLTYIETSTLWRQEHNGYSHQNPGLIGSFISLPRHLARIYLPPDANSSIATIDHCL
                     RSKNNINLVIGSKNPTKGFLTIEEAERHCIAGASVWEKFSSNRGIDPDVVLVGCGVEV
                     TFEVIAAAAILRNQGVKVRVVNVTDLLILGRDGVHPHALDQDAFDSLFTVDKPVVFNF
                     HGYPKDVEALLFSRRAHVGRSRFDILGYIEEGSTTTAYSMLRLNNTSRYSLADIAVRR
                     VGRNQPNHPINVRSHELSSCWRHQLVLHDKFTKEYGKDPQWCAEIPELEKNAA"
     gene            885615..887199
                     /locus_tag="CNE03110"
                     /db_xref="GeneID:3257654"
     mRNA            join(885615..885849,885924..886035,886094..886208,
                     886260..886364,886426..886734,886782..887199)
                     /locus_tag="CNE03110"
                     /product="pheromone maturation-related protein, putative"
                     /transcript_id="XM_570861.2"
                     /db_xref="GeneID:3257654"
     CDS             join(885847..885849,885924..886035,886094..886208,
                     886260..886364,886426..886734,886782..887148)
                     /locus_tag="CNE03110"
                     /codon_start=1
                     /product="pheromone maturation-related protein, putative"
                     /protein_id="XP_570861.1"
                     /db_xref="GeneID:3257654"
                     /translation="MVTSTYIPMSQRQSWADIKPIIQDDGPNPVVPIMYSEEYKDAMD
                     YFRAVAAKEEKSERALELTEVIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFA
                     VQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHESLLPDPKNYHTWAYLHWLYSHFSI
                     LGRISEAQWESELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSHNLQDELIYIL
                     KSIHFIPHNVSAWNYLRGFLKHFSLPLTPILPAILPYTASKPNTDMETVGTFHFPVPS
                     DPLPEDTPLPVPLALEYLADSFIEQNRLDDAAEVFEKLSSKYDKMRAGYWEFRRRECV
                     EE"
     gene            complement(887160..888211)
                     /locus_tag="CNE03115"
                     /db_xref="GeneID:36392872"
     mRNA            complement(join(887160..887386,887439..887539,
                     887640..887776,887886..887954,888073..888211))
                     /locus_tag="CNE03115"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658534.1"
                     /db_xref="GeneID:36392872"
     CDS             complement(join(887365..887386,887439..887539,
                     887640..887776,887886..887954,888073..888130))
                     /locus_tag="CNE03115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514382.1"
                     /db_xref="GeneID:36392872"
                     /translation="MATTTPPLDRLSPAQAQPAEKILYDRTTVLALEEYKKKDPTKVV
                     VRFKSIGSAPIMKNNVFKATAGHKFQAVIMFLRQQLGMKKEDSLFTYINAAFAPAPDD
                     TVGSLYKSFGTEGHLIVNYSNTQAWG"
     gene            888331..889810
                     /locus_tag="CNE03120"
                     /db_xref="GeneID:3257537"
     mRNA            join(888331..888453,888504..889224,889276..889810)
                     /locus_tag="CNE03120"
                     /product="expressed protein"
                     /transcript_id="XM_570863.2"
                     /db_xref="GeneID:3257537"
     CDS             join(888379..888453,888504..889199)
                     /locus_tag="CNE03120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570863.2"
                     /db_xref="GeneID:3257537"
                     /translation="MKANRNYPTVRNVPLPFYTLAGSPSKMPHSRTLVHYFRRLIQLL
                     SIVVGTSSAVAALWSLLLLPLLHATFSARKSLVEGQMQPMVTLLEKVIGLRAKLSHFS
                     SLQSDKGVEGECVEADLPTVTPIREIESFAASTGSRTDSGMSTAIFPSLGLRALSQSI
                     HNLTAMLDATSTTRISLISTLESYTSHVHRQLFLAKPPGYTNDRFMVGLGTLSENLKK
                     EGEHEKKGEEWDAVRKEVRAVKGQLLNRRAFTSNFGSK"
     gene            complement(889313..890642)
                     /locus_tag="CNE03125"
                     /db_xref="GeneID:36392873"
     mRNA            complement(join(889313..889767,889819..889848,
                     889904..890053,890116..890268,890344..890460,
                     890519..890642))
                     /locus_tag="CNE03125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658535.1"
                     /db_xref="GeneID:36392873"
     CDS             complement(join(889414..889767,889819..889848,
                     889904..890053,890116..890268,890344..890460,
                     890519..890545))
                     /locus_tag="CNE03125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514383.1"
                     /db_xref="GeneID:36392873"
                     /translation="MESVNHIQLTIHPSRVRPILRALLLAIFFHRTLDAMEPETLELL
                     ESHISCVPNSIISREISNKIEEFARQYLEGDQDGGEIAVVFLQKKSKKGWFAVTEELV
                     PWEEHLITLSFSHSSKTPSNPLPRALLQIATFCLEQKAMVPPLTGTTESQSSNVSYQI
                     MIAPPAPNDLFAPSSPPSHPIRLASPPPAPAPSTTPATAVARDLAVSHRPTLENRNSA
                     RRTSSPTSATLGYFEQAKDGLRAVGAKAGAGVGWGGRAMGAAFGRSAGATEIKYNVQR
                     "
     gene            890707..892307
                     /locus_tag="CNE03130"
                     /db_xref="GeneID:3257599"
     mRNA            join(890707..890908,890969..891026,891076..891158,
                     891223..891360,891458..892307)
                     /locus_tag="CNE03130"
                     /product="expressed protein"
                     /transcript_id="XM_024657236.1"
                     /db_xref="GeneID:3257599"
     CDS             join(890885..890908,890969..891026,891076..891158,
                     891223..891348)
                     /locus_tag="CNE03130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512870.1"
                     /db_xref="GeneID:3257599"
                     /translation="MSFPTLKHFIVQAELLQAYRSAVRATKPLPDPQTRRETLDFLRS
                     DLERLRQEHDLDTLQSHLSSFRKLVKQMRPSFSFSGNESGSRLIGQRRRAQG"
     gene            complement(891655..894027)
                     /locus_tag="CNE03140"
                     /db_xref="GeneID:3257910"
     mRNA            complement(join(891655..892074,892130..892249,
                     892308..892348,892407..892500,892542..892643,
                     892695..892743,892804..892858,892909..893044,
                     893127..893237,893301..893464,893523..894027))
                     /locus_tag="CNE03140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657237.1"
                     /db_xref="GeneID:3257910"
     CDS             complement(join(891812..892074,892130..892249,
                     892308..892348,892407..892500,892542..892643,
                     892695..892743,892804..892858,892909..893044,
                     893127..893237,893301..893464,893523..893737))
                     /locus_tag="CNE03140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512871.1"
                     /db_xref="GeneID:3257910"
                     /translation="MPKSSLAALPTDVQSHVNQAIDSLRDLVPPDPSFVSEDIQDTIF
                     KTVDELNDDMRKLSLAIHDNPELGFKEFEARKNLVTALKKLGFDISNPSDLETAFVAT
                     YTRGSGGRTFGFNAEFDALPDIGHACGHNLIAVIAVVGAAALKAAMEASDMSGTVKVI
                     GSPAEEDGGGKILLLKQGIYDDLDACGMAHPFGGMGGAAGSCPIGGPATLSRSGLEIE
                     FHGRGAHAGSAPWMGINALDAAVQGYTAVSMLRQQLEPTMRVHGIILGSEKWVTNIIP
                     SYSKVSFGTRALDTKLCIDLREKVIACFKSAAESTGCSCKIKAPDDAVYAETRNNEKL
                     AHSYQIFMDRAFGDKIELEGVTTASTDFGNVCYKLPGFHPMFDIPSEEGSSNHTPGFA
                     EAARTPEAHSRAMKVAKGLAVIGAKFMIDDNFAKETREAYEKLQEEVRNSGGQSKTE"
     gene            894511..896668
                     /locus_tag="CNE03150"
                     /db_xref="GeneID:3257541"
     mRNA            join(894511..894968,895028..895199,895250..895411,
                     895463..895511,895570..895682,895726..895985,
                     896039..896235,896314..896668)
                     /locus_tag="CNE03150"
                     /product="cellulase, putative"
                     /transcript_id="XM_570869.2"
                     /db_xref="GeneID:3257541"
     CDS             join(894822..894968,895028..895199,895250..895411,
                     895463..895511,895570..895682,895726..895985,
                     896039..896235,896314..896509)
                     /locus_tag="CNE03150"
                     /codon_start=1
                     /product="cellulase, putative"
                     /protein_id="XP_570869.1"
                     /db_xref="GeneID:3257541"
                     /translation="MRSLIPFFIVPLAVATALPAFQTVDLEKRSVNVGWPYGSDKIRG
                     VNIGGWLVTEPFITPSLFEATGNNDIVDEWTFCQYQDYDTAQAALKNHWDTWFTEDDF
                     AKISEAGLNHVRIPIGFWAYDVQGGEPYIQGQAEYLDRAIGWARNHNLAVIIDLHGAP
                     GSQNGYDNSGRRGAADWATDEANVERTKNVIALLSTKYSDPQYYGVVTALALLNEPAT
                     YLNNQLLQTARQYWYDAYGAARYPFGNSDKSGLALVLHDGFQPLSTFENYMTEPEYED
                     VLLDTHNYQVFNDEYVAWNWDEHISNICNKASTYSGSPLWLVVGEWTLATTDCAKYLN
                     GRGIGSRYDGSYQGSSYVGSCDDKSNDVSRFSEEYKAFMHRFWEVQTQVYEQNGQGWI
                     HWTWKTESAADWSYEAGLDGGWIPWNAGSHDISLSSLCG"
     gene            complement(896635..898191)
                     /locus_tag="CNE03160"
                     /db_xref="GeneID:3257683"
     mRNA            complement(join(896635..896909,896949..897047,
                     897106..897244,897293..897465,897512..898191))
                     /locus_tag="CNE03160"
                     /product="expressed protein"
                     /transcript_id="XM_570871.2"
                     /db_xref="GeneID:3257683"
     CDS             complement(join(896676..896909,896949..897047,
                     897106..897244,897293..897465,897512..898081))
                     /locus_tag="CNE03160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570871.1"
                     /db_xref="GeneID:3257683"
                     /translation="MLPKNLFSLTRRGLHSKTRTFYSPTPDFLHEYLSQDSLPGGSVS
                     VFMLSTSLPNLPGHLSVLQAAFPTSIGSFSVSSPGSEPTVSLATFWGTDIKVFKSDQT
                     GRAPAEVGRFQRPERQRNVPPEDRRGSTSRDVEAAFGQGWENLWNGEVENKRIAELEG
                     VQADTFLLLSDSRPAPVLKALDSMFPKAIKTGILTAPTPFITNRPNTLLLNGTVIQSG
                     TIGIAIKGLPSVYKTDFGLEPMLEPVTITSAKGNMLLEIDGANSNPTQVLINAIQQRG
                     GTGLTKEEEFYLGFLDNGDVKRVIRILSGDPSRGAMSLDMEDSIITGQVVQFMHRAAT
                     PRNNLPLVDSIIFTSLSRSEQMDNHSMGVPRVMDGFIASSEDGFVYSNPLSSICTAPD
                     ATTTISWVPAVI"
     gene            898362..903975
                     /locus_tag="CNE03170"
                     /db_xref="GeneID:3257698"
     mRNA            join(898362..898707,898762..899456,899509..899589,
                     899644..899827,899892..900062,900121..900244,
                     900293..900458,900513..901728,901775..901873,
                     901931..901938,901993..902076,902123..902204,
                     902262..902300,902351..902488,902542..902619,
                     902677..903248,903304..903821,903885..903975)
                     /locus_tag="CNE03170"
                     /product="signal sequence binding protein, putative"
                     /transcript_id="XM_024657238.1"
                     /db_xref="GeneID:3257698"
     CDS             join(898504..898707,898762..899456,899509..899589,
                     899644..899827,899892..900062,900121..900244,
                     900293..900458,900513..901728,901775..901873,
                     901931..901938,901993..902076,902123..902204,
                     902262..902300,902351..902488,902542..902619,
                     902677..903248,903304..903821,903885..903916)
                     /locus_tag="CNE03170"
                     /codon_start=1
                     /product="signal sequence binding protein, putative"
                     /protein_id="XP_024512873.1"
                     /db_xref="GeneID:3257698"
                     /translation="MSISPRQYASLSLLHPPSPKTTWTMLLLFIIASILSVAPLSVLA
                     GDPEVTVSRIDNLPNRLFYFDDTPVVMYHDPVKLTVHRSADEGKTWEQVSGPQEGDAA
                     RLIEHPHNNEMAFIIGRYSVHWVTYNRGASWQSFETPRDASLTGKTLSFHAEKDEWIL
                     FQGVACENTGSGKWGEGKTCWDETYYTTDAFRSEPQLLLSQTSQCLFARSSESFKSAP
                     ESLIFCVAFDQSQKPGSGGMHSYKESRLFSSEDWFATKKFVDLGIGKRARGVVGLGVV
                     SKFMVVALRAEGTATKRASGGDPMSLYVTTDGLEWRQTQFPHSALPDLKENAYTVVES
                     TTHSIAVDILTSPSANIGTLFVSSSEGTYFVEALADTNRNEYGIVDFEQLVGLEGIGI
                     ANVVSNREQVVGWGEAKKIKSKITYDDGSSWRPLKAPAKMMNGDDWACDTSDLESCSL
                     HVHSVTVPHNIGRVFSSTAPGYVMAVGSVGNSLLPYEDCDTFLSTDAGLTWRMVREGA
                     HKYEFGDQGSILVTVDDEQATDHVHYSYDGGNSWIPLDLGITIRGIVLTTIPDSTSQK
                     FLLLGTLPRKDSNGGRHAMVFLDFAPLQTRQCTDSDFERWYARSADGKECLMGHRQWY
                     QRRKLDAQCYVGHKFEDPVGHEENCACTDDDYECDYNFVKQDGECVAVGPETVPAGTC
                     HKEGDKYLGSPGYRKIPGNTCEVRSGQAKDSPIMKDCSSARPESGKPSHVVHEFTSDI
                     ASHSYFPLSQTILLQLADSTVWQSSNEGFSWKQLYPDETFLGVVIHEHSPERAYLLTP
                     TRKIYYTTDTGRSWNTIDAPADPNNLGIAILDFHPTKADWLIFVGAIDCKDPLSSSCR
                     AVAYYSTNHGRGWNKIDEYVRTCAWARDKRLKIDEREIICESYKNKKGSQVSGEYNPM
                     ELIAGASYYSKKIKLFDAVVGFATFSEYLLVAQLHEAQGTLSLQVSLDGYNFAEGQFP
                     PNMKIDNHAYTILESSTGSVFLHMTMNSAVNNEWGSIFKSNSNGTYYGLSVEYVNRNS
                     AGYVDFEKMLGLDGIAVINIVANPSEADISRRKKLQTRITHNDGGSWKPLNPPAKDSL
                     GQEYDCQWTSCSLQIHGYTERRDPKATYSSPSAIGLMLAVGNVGEELAPYTDSDTFLT
                     RDGGYTWEEVHKDAHMWEFGDSGSIIVLVNDEEPTDHVLYSTDEGLTWSEYPFGQTLR
                     VRTIQTVPDDTSRRFFLIGTPPSSPDKTTLVHLDFSAITQTKCVLSIEDPNHDDFELW
                     SPSESREDKCLFGRQTMYHRRIREKNCYIGERVEQPKTIVRNCTCTPSDFECEFNYRR
                     DSSGKCALVDGATALSWNTEEEQCDGYTEFWYERTEYRKIPYSSCEGGERPDRGKRHE
                     CPGLIIGGARRGVLVWGSIVILPFAFAGLAGYWWYKKGSRAGSIRLGDHRAFGGDSSS
                     GVLAVVASVPMFLIAIGQEGWAWVARRVPFIEDLFTRRSSSYRSVPIDEDAEILGNYE
                     DE"
     gene            complement(903930..905283)
                     /locus_tag="CNE03180"
                     /db_xref="GeneID:3257650"
     mRNA            complement(join(903930..904358,904414..904951,
                     905016..905050,905101..905283))
                     /locus_tag="CNE03180"
                     /product="phosphopantothenate-cysteine ligase, putative"
                     /transcript_id="XM_571205.2"
                     /db_xref="GeneID:3257650"
     CDS             complement(join(903975..904358,904414..904951,
                     905016..905050,905101..905247))
                     /locus_tag="CNE03180"
                     /codon_start=1
                     /product="phosphopantothenate-cysteine ligase, putative"
                     /protein_id="XP_571205.1"
                     /db_xref="GeneID:3257650"
                     /translation="MASTPTSFSTESYFHTQKSPPNIHDTTAKVLQFVDKWRAVDGKK
                     VVLVTSGGTTVPLESNTVRFLDNFSAGTRGATSAEYFLSQGYAVIFMHRLHSLRPFSR
                     HYSHSLNPFLDLLSIVPSSSGDSSIVVSPDHTKELLPILEAYHEAQASGTLLSIEFQT
                     VNEYLWLLKGVTGAMVPLGRRALFYLAAAVSDFFLPEDKMAEHKLQSGKGTLALEMDQ
                     VPKVLKPLVQEWMPEGYIVSFKLETDPALLIPKSRAALARYGHQLVIGNELHRRKYEV
                     VFVERTKSPSHLRLQATNENNSATETPPLEKSETQNEEFIERWLRLDDIQPGAAEPGK
                     AVGGKGKDGEVEIEELIVKELVNRHQQWIEAKA"
     gene            905471..907240
                     /locus_tag="CNE03190"
                     /db_xref="GeneID:3257956"
     mRNA            join(905471..905597,905647..905722,905781..905891,
                     905942..906285,906342..906556,906611..907240)
                     /locus_tag="CNE03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657239.1"
                     /db_xref="GeneID:3257956"
     CDS             join(905501..905597,905647..905722,905781..905891,
                     905942..906285,906342..906556,906611..906835)
                     /locus_tag="CNE03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512874.1"
                     /db_xref="GeneID:3257956"
                     /translation="MPIVLLLLQSAAMFAASFLVGILPLSFKSATSGRTLKAISVTGM
                     GLLVGAALTIIIPEGVATLYSAMPQDGKDHDEKAIHAIGLGLLSGFSLMLLIESLIPH
                     ESHQSQPSSSYASPSPPGSPLSIESSSRPPPQHINSNTPIVSKPKRMSVDDSESEAAT
                     RMSTIHGLNATLGLVIHGAADGIALGASSLASGSRSLSLIIFLAVLVHKGPTALGLTT
                     TLLSLGLPISSIRQRLIIFSFAAPVGAILTFILVSAFGTSKVGGANAGGDALGWWTGV
                     ALLFSGGSFLYVATVIQPLSSHTDAHSHPQQSHHLESGHGPEDHADPQDRPLGTYQRT
                     ALLVFGMGLPVILSWLVGDAH"
     gene            complement(907019..911385)
                     /locus_tag="CNE03200"
                     /db_xref="GeneID:3257723"
     mRNA            complement(join(907019..907395,907456..909272,
                     909329..909528,909580..909680,909728..909873,
                     909922..910116,910173..910447,910497..910569,
                     911083..911385))
                     /locus_tag="CNE03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657240.1"
                     /db_xref="GeneID:3257723"
     CDS             complement(join(907305..907395,907456..909272,
                     909329..909528,909580..909680,909728..909873,
                     909922..910116,910173..910447,910497..910524))
                     /locus_tag="CNE03200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512876.1"
                     /db_xref="GeneID:3257723"
                     /translation="MYPPESIWSNQEQLASYYVNYAVPIRTQPGVLVASIIVSILGSY
                     ATLIVLGRRTSSRGWRNHFLLLLAAIVFAACAIWGMHFVSMISIRLKASPDVVWYIRF
                     NDGMTAMSLLVPMVATALAFWVIGSELEFSVLRVLIAGGIMGLTVGLMHYSASFKLPY
                     LTVSYTAVTVVFALILAVVAATVALFLFFRLRAQWQDSWWKRGLCALILATAVCGMHY
                     LGLGGASYYTKPSVDWHELTKSSQSIRLTIAISVMCAAIVLLCFLVALFDAMTRRSIR
                     NKARSIVVASASFDKTGKLLVKNDGTIPMQVISTDADLQRVLRELDPRQSTFQWLYQL
                     SFNWSLVTPFVPRVLRSVVDRSRGIVKRASPLERGLPHSYWETLLFRSRFIEASVLLA
                     QQLDLSVESLGAMFDRVLTTGTRAPSPEDKSGKAVEEGKASMKGDDESSIHGITLRMH
                     NSEGVMLFLVREIGDGHPAAWDNPSADKSQLRSVDNVDSYTARGYRLAETRYFSKAMA
                     DHFGVSKQEMDVFLSACKTYAKRGTRPVVQSGGAYLGLFGVRPTGEKNNLDVLVYNFA
                     RHQIPAYRLPDVSYPLTSTMKAWVRELSNCPMGEVLQRCNDAVLQAEKSDDGISLHSQ
                     VDEALYEFQAALAVAIEALSTALRCWPTLHQIATLSPEILEIPASDNDDKPPAQMVVI
                     EVILPAPDARLTPVQSRASGVQAPSLASGRHESDKPPAPFVYTPFSLFTKSQAMLLRA
                     RAFQEFSKNTSMDLNKVYPLVPTDVAAELDAHDRNEKRADRNSNPFKKLYHPSKAGNK
                     GLIVDVGEENGIDESGHFPLSPMGSNTTGDMNEKSFSTLSPTLQSFSLNTARGGSRPG
                     TGQSDNSATALQAPVESMKKGLSHLVHKTAEATGYHGEEDENEGTMQEGSIGMPVYSN
                     IRNKTDGWFMRSMRDLERADRTGMLDGVEWQPKGRQ"
     gene            911860..913393
                     /locus_tag="CNE03210"
                     /db_xref="GeneID:3257581"
     mRNA            join(911860..912559,912616..912797,912853..913047,
                     913103..913393)
                     /locus_tag="CNE03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657241.1"
                     /db_xref="GeneID:3257581"
     CDS             join(912245..912559,912616..912797,912853..913047,
                     913103..913187)
                     /locus_tag="CNE03210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512963.1"
                     /db_xref="GeneID:3257581"
                     /translation="MTTFREQDFSNGPAMAQAIGRHLPQAMTDLIEIMNKINWLNSCL
                     RSSRAVARCYQKAFVSVMEDMEELKVQMSALERANNIQGIEEDRMRKRRKTSAWPKNR
                     ELEDWVHANVRRIIDMPPSGDKSLYSKDKWPNYDPEEAPNGYVEDPESRKVLWRPNWE
                     NLRNAFFGNLVDVAVKACEDDRKSLKLECPSTEETRDRVVAYLKNIAKRKCGKQSKKE
                     ADEKRILGRTRTVSVSGSRKTGSHSLSANAARRLMTLCRR"
     gene            915403..917953
                     /locus_tag="CNE03220"
                     /db_xref="GeneID:3257802"
     mRNA            join(915403..915515,915592..915618,915662..915712,
                     915786..916258,916328..916418,916475..916553,
                     916600..916722,916793..916871,916939..917001,
                     917057..917620,917677..917953)
                     /locus_tag="CNE03220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571203.2"
                     /db_xref="GeneID:3257802"
     CDS             join(915480..915515,915592..915618,915662..915712,
                     915786..916258,916328..916418,916475..916553,
                     916600..916722,916793..916871,916939..917001,
                     917057..917620,917677..917695)
                     /locus_tag="CNE03220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571203.1"
                     /db_xref="GeneID:3257802"
                     /translation="MPDPAPFWLCHECGAQMRPVTIDGTPHCASCNGEFIEILDPEVN
                     PDPDYELPPPPPTRPGQQTPSRFDPHFLSNFPPPQSEGSSSPARQRDTNNTGNFLSSL
                     FSMLGTGSRQGSEETPRRPPPSFHGEPSASQRNGQSQNTDRPGMRTYAFNFGNARGSV
                     TIGSFGSNLGRQGYRMNNDPTSPSGNLFNDPDPFRADPFDARFRPPGDGNRDINGDMP
                     LPLGANEALQLIAALLDGNPPPNMGNLGDFATSDADFMRILQETFMEAAGPQGPVPAN
                     ETVIEGLPRFTFDSGSLAKSQFRDCPVCKDDFEIGNEVMLIPCGHIYHPDCLVPWLRQ
                     NGTCPVCRFSLVSEDEQPNNQRTPNVGTEHTRNAEEERPATPTIPAAVSNFFRNLFGG
                     SESQPSTPRAAAGGGHGSNASQDPHSSVNVVSESTISADASSRHSPTIHGATRREQVQ
                     PCDEVASEGSSNDSLVRVYPEHSSGETHGDGATDGEAGRIAEQEQQVASRDRLADRVN
                     RDFNERWQRLRREREEDDTVYHPDLD"
     STS             917834..918019
                     /standard_name="AAT17"
                     /db_xref="UniSTS:470807"
     gene            complement(917898..921262)
                     /locus_tag="CNE03230"
                     /db_xref="GeneID:3257898"
     mRNA            complement(join(917898..919728,919785..920277,
                     920328..921262))
                     /locus_tag="CNE03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657242.1"
                     /db_xref="GeneID:3257898"
     CDS             complement(join(918035..919728,919785..920277,
                     920328..921179))
                     /locus_tag="CNE03230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512878.1"
                     /db_xref="GeneID:3257898"
                     /translation="MFSPATPIAGPSNPSHLRPSFSSPAFRRGGSIFPYEYGASNQPF
                     SPHYSAPFTTTGVRIRSGSVFSREQWKKEELARRRQESRDKLKSSWDLLFEKYRDVED
                     DDEIDLATGTIVKDRGKLRALQQPMWFGQKEGDDGESTGGGGHDFESDEDELGDWDEK
                     AGLDPQLPEWEEVEGFHQAWTEEDDADFREFMRAEQRRKSTFGSDNEDEDSLSEHDSK
                     KPAGFEEYLDVSPRSRGTQILPLPTLDDLFASDNKASSEDELEAISDSDAEEKGVRDN
                     LSALSSLHGTPIVSRRPKRRTIIEVVIPPRPRSKSTGGMEEKPSEHHLLDCVPKSIST
                     PTLADLFTPPPARIRRSLSGSSATSGSSALSKSKGKKRMPGERPMEDTSSGNHSIIQL
                     RKPSNSTETIKRYDEKLFRCDSCRAAGGTRKDQAPFCPGRTDSCIFEDSSGSFEQFAR
                     KSATHSRPSGKSFAADTRLVEGAGPTKQRTCRLCREAGGERAKTAGVCLGRHSYRRCN
                     WRKRAIHSSTANTHTVTPVDVAKGESNPSQVNVSTDTPQLRTKHSPLLNMKVPSLRSS
                     SAIRKHRRRVIESVSDDDDPRFTTDTALPPREPSSNFIRKPQETAPLPSPPPTSSVAP
                     SSPPIASLHKPSRSPLLSLPPSSPPRPDIFSPVPTQAARPTPSPSVSLTHPISSNYVT
                     DAYKQTGVMYHPTPPPSTDGMRSASLSSDNVATSLPHKSALRRPSDTLGLQSSSSSIK
                     RTRFSLIRSPMRHPSSDEEGSEDELDLLSNIDSSSIIACSSSPKHSSSPIRTEWSVRA
                     ADVGIKLGPEHTGRLPSDMVKTLVPSMGLFRPTLGSSSQASSKYTLPTPPSSYRPSQP
                     RPVSDPQNPSSGSGGNPQARLMLPPPLPAKRSTHPNSLSTPKELKNSTSTFSTSSPAP
                     SHIRLTSLPAVVVRARARSRSLSMAPPGALRTPKAQRSIMSPGSKIPKTAPTRKGKVL
                     MDLQRVAKEIGDEAGLEWGLDEETDDGGRMWREGSVAAYK"
     gene            complement(921437..925844)
                     /locus_tag="CNE03240"
                     /db_xref="GeneID:3257490"
     mRNA            complement(join(921437..921677,921733..922026,
                     922085..922180,922233..922397,922460..922501,
                     922560..922685,922744..922810,922865..922983,
                     923035..923149,923226..923233,923290..923370,
                     923422..923575,923628..923703,923769..923860,
                     923914..924046,924179..924335,924384..924455,
                     924509..924701,924756..924834,924898..925016,
                     925074..925095,925145..925197,925253..925435,
                     925492..925844))
                     /locus_tag="CNE03240"
                     /product="chitin synthase, putative"
                     /transcript_id="XM_024657243.1"
                     /db_xref="GeneID:3257490"
     CDS             complement(join(921624..921677,921733..922026,
                     922085..922180,922233..922397,922460..922501,
                     922560..922685,922744..922810,922865..922983,
                     923035..923149,923226..923233,923290..923370,
                     923422..923575,923628..923703,923769..923860,
                     923914..924046,924179..924335,924384..924455,
                     924509..924701,924756..924834,924898..925016,
                     925074..925095,925145..925197,925253..925435,
                     925492..925754))
                     /locus_tag="CNE03240"
                     /codon_start=1
                     /product="chitin synthase, putative"
                     /protein_id="XP_024512879.1"
                     /db_xref="GeneID:3257490"
                     /translation="MTRHHDPFTNSARVDSSFTPSVNPNTPYPQSDQYQSYYPPQLTH
                     YQGQQGYQYDHTGDVGYGGRSRRHGSWAAVNNEDNEELTPLTTGPASSSTFLTTDPYL
                     SGGPDLPLASSASISSAGADFLTRQTAPRRGATTKRIKLTNGNFIADYAVPGPVSSSV
                     EAKWLIDKASNEFSHMRYTAATCDPDDFTPENGWKLKTTSYNRETELLIAITSYNEDK
                     ILYARTLHNVMLNIRDICNTKASKFWRRSAEEGRPGWQKIVVALVADGLDPMDKQVLD
                     VLQTIGVFQDGILKKEVDGKKTAAHIFEYTTQLSIDATPQLVQPHPGEPNNLVPVQII
                     FVLKQENSKKINSHRWLFNALGRQLQPEICVLLDAGTKPGHKAIYHRGACGEIHAMIK
                     KGVKLFNPLVAAQNFEYKMSNILDKPLESSFGYVSVLPGAFSAYRYKAIQGRPLTQYF
                     HGDATLAARLGKKGIYGMGIFTKNMFLAEDRILCFELVAKKGEKWVLQYVKPSKAETD
                     VPEQAAELISQRRRWLNGSFAASVYSVFHFFRLYRSGHGPIRMLFLHIQAIYNVFSLI
                     FSWFALANLWLTFSIIIELLPESANINLFGTADVTHWINLVFTWVYLAFLMLQLVLAL
                     GNRPKGEKGLYILTLWVYAFLSLYLIICSIILSVVAFKGALRDGGSIDAKLGNLFNST
                     NGVLVAAIMSTIGIYLIASFLYRDPWHMFSSFPQYMLLAPSFTNILNVYAFCNLHDVS
                     WGTKGSDRAEALPAISSSKEKDGETAVVEEQQRSQGELDESFKQVVQRAVAPYKPEEA
                     DEKPNLDDQNRTFRTRLVVVWLLSNAALAISIQTLNGLDTTKQLVEACLPSSYNPDNG
                     TVIVSTNGTCITQALEHDGDKLQDKQQIYFQAILWATFALSMVRFIGCVFYWAMRQMG
                     RCWRRN"
     STS             922828..923629
                     /standard_name="Hind10"
                     /db_xref="UniSTS:470808"
     gene            926866..933266
                     /locus_tag="CNE03250"
                     /db_xref="GeneID:3257777"
     mRNA            join(926866..927525,927577..928468,928522..929480,
                     929537..930977,931028..931416,931468..931636,
                     931689..932071,932124..932747,932798..932886,
                     932945..933266)
                     /locus_tag="CNE03250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657244.1"
                     /db_xref="GeneID:3257777"
     CDS             join(927076..927525,927577..928468,928522..929480,
                     929537..930977,931028..931416,931468..931636,
                     931689..932071,932124..932747,932798..932886,
                     932945..933083)
                     /locus_tag="CNE03250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512987.1"
                     /db_xref="GeneID:3257777"
                     /translation="MPKANKSSASAGTRKKHAAKKTHREHDDDSDHQPESGTPQPSRK
                     QRGEKKLSKAQKRAMPKVKQYIPPPKPPAPPILDPLDGQGLARTLPADLVVVLRRLGK
                     KDAVTRRKGLEEFRDGWVKYILKEKPTEEEETEREVKEIALLAAIPVWLHNLSGLLQS
                     PFHRAIALLIHTDLLSVPALRASILESLNLGLLPGTQNRDVLGSWMIAALEEGRRAGG
                     LGLRGWESSILWKASGEEVGGDTDIRIDLKEHLSTLIEYLTLSTLNPSILHEDIHPIP
                     VAATPVSSIPLGKKGTNKQGKSKTSSAPPSRQTETPVPPPEDHEILEERMTRYRVGGL
                     IGLSWLLQQLPQVGLTSLPEDLVTLLRHPALWLSLSSEQVDTVNSPGSLGTAQPPVRK
                     AGYGLLDVLVNSYESIVAEPEMLKMVSNAVLSSCWREKEAVVWESAGSAIAKFIRKWP
                     ECWTLTTESAADHRDGRNDGRNDGEEEVDSEDENVQNADDEDGANPATLLQLSSPYYS
                     DFLDFTSTICPYIPHITYPIILVVLSTLPPSLLLLVGPSLQLQTLFSHLWAPLDSRLL
                     STHCLPGQKSAFQVFFQAILECTIFLIGKSWKEKDGKEAAMWLVKEQLGNRAWKEGVL
                     LMGGRAGGRHVPRGCTEESEASAFGSTLGRLASIDQLLLDQIRVVLTQTLSDACFPQE
                     NPESGPMEVSILPRSLSILSAIRDAIAASQVIGLVDQLMEDLIEKLSEVFVGSSKSDN
                     PSHAIMAETLVDALKNHHHLVHSDTIEKLLGQVKDSSHELLIILHPPLFIAYLDSLCS
                     KLPSAERHVCQQALSTVLQSSEIDSSQRFTVANAVLILDHTQLLQSGSLDQIVKEATH
                     DALAGGSPIAIPVVTASLKSLCYLSKSTLDEVLSVTCSVIRESTKKLLTTDFVELGVP
                     QAAFEIFAAYATNHLQEVIESEHLISGLVGVHHVLFVLPRLPGHIASAESKASGLLSL
                     WSKLGELVVEYQEKVLQRVYSALKGEMGDVEVRVDPEVLIDVALATTLGSHSAPSLQA
                     LVLALLPEVISIIQDLAPHTSQPPHPSLPIVDPLIPFVPHGDDDLDSIQPEFDSLGRA
                     QTARYAEAAVALLRADRSLVKDEPALLQMILAVSRLAQDALTVPGASRGLFSKETPST
                     RLADLVREVEGAVSFALGYVDEVEPSWHHATIHALKSGSVPHDSDLLQSLMVALQKEV
                     TANGNDVDARSFRDVLYKHMRQIGAGVQEGEAWLNYAMSLVDRSPQLSLAIITAIKPL
                     MLDTQAFATAQTRLASALTTIPPSKCHTALNLLRIFNASAPEVDSTSVFLPQQRALFV
                     LRHVAGWLTSDDVDEDKLPEDMEFRVLELEGSVAPIVQDVGGAHWDGIFDLVENGLEN
                     SGMDDSSSLCLLYHSLSVLQQIRDLCQTNKSLRASWTSKTNHMKLVLDLFLQCRSANS
                     VPLQLIQNLILDLLPDVPEQVMKEASLTSLCNLISLSTSSAIQTAAYRIISQVIRHQT
                     VGLVLEVEASVAQAQEGHAERTIEMAKELVDVVKIGSEVNWHGELGVSLVLGQLLAWM
                     SILDYFEDASRTLRWAYLDQLNTSKLITDGLVPMLFSILGVSEMGAWNFPASQYAVDE
                     FFTEFLDPESLPDLSPLASHLFYRALVTIPSSVRAYYESLKDRQLSMSMLSFTARHYS
                     PVIIAHEFSALREPSAMAQLTEEGLNVRIAQGGGATIAAGAGSAEAIASYVVDEQPME
                     IGIRLPAEFPLKGVDVRDLRRVGVPENKWRGWLMGLQQTITSRNGLILEALTMFKKNV
                     SLHFEGVVECAICYSIISLTDRTLPTKPCRTCKNRFHASCLFKWFNSSHSSSCPLCRA
                     LF"
     gene            complement(933127..934084)
                     /locus_tag="CNE03260"
                     /db_xref="GeneID:3258009"
     mRNA            complement(join(933127..933444,933515..933652,
                     933712..933822,933889..934084))
                     /locus_tag="CNE03260"
                     /product="transcriptional activator, putative"
                     /transcript_id="XM_024657245.1"
                     /db_xref="GeneID:3258009"
     CDS             complement(join(933262..933444,933515..933652,
                     933712..933822,933889..934032))
                     /locus_tag="CNE03260"
                     /codon_start=1
                     /product="transcriptional activator, putative"
                     /protein_id="XP_024512880.1"
                     /db_xref="GeneID:3258009"
                     /translation="MSEHTNLKSLAPLGNQPEPSANSAGVGPSKPFTEAQVEEFREQD
                     RWLPIANVARIMKSSLPTSAKVSKEAKECVQECVSEFISFITSEAAEKCLNEKRKTLN
                     GEDILTSMRALGFDNYEGVLRVYLAKYRDSHHSIPKRNAQHEDDDEEVQDGRKKRGRG
                     RQPAGGTISTNGHAEGTKSKRKRSDDGKGVR"
     gene            934157..935542
                     /locus_tag="CNE03270"
                     /db_xref="GeneID:3257511"
     mRNA            join(934157..934350,934427..934487,934551..934651,
                     934749..934815,934873..935542)
                     /locus_tag="CNE03270"
                     /product="ubiquitin conjugating enzyme, putative"
                     /transcript_id="XM_570886.2"
                     /db_xref="GeneID:3257511"
     CDS             join(934240..934350,934427..934487,934551..934651,
                     934749..934815,934873..935426)
                     /locus_tag="CNE03270"
                     /codon_start=1
                     /product="ubiquitin conjugating enzyme, putative"
                     /protein_id="XP_570886.1"
                     /db_xref="GeneID:3257511"
                     /translation="MPKLNLRSTAVKRIMQEAAELAAADVDDDGFVAAPLEDDIFEWH
                     CTMRGVPDSEYDGGLYHFRIVLPPSYPMSAPDIILLTPNGRFELGKKICIDGLTSFHA
                     GSWQPAWGVRTAIVGLRSFWMQSGEALSAIGALDHSKEERKRLARLSAEWKCPTCGIK
                     NEEIMPRYPAAVDEKEGGKGGNEDVKQYMDSGDTVDYAAACALKAEHIEEAGDRGLDS
                     EHLESRPTEPEPQAEATDLRASASPEVISTSAVQTSPSSTQITLEPCRTVPLWLDHLI
                     GGFCIALGLAICKRVGTYILS"
     gene            complement(935564..937673)
                     /locus_tag="CNE03280"
                     /db_xref="GeneID:3257945"
     mRNA            complement(join(935564..935872,935943..936408,
                     936462..936612,936661..937314,937382..937514,
                     937570..937580,937626..937673))
                     /locus_tag="CNE03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_570888.1"
                     /db_xref="GeneID:3257945"
     CDS             complement(join(935715..935872,935943..936408,
                     936462..936612,936661..937314,937382..937514,
                     937570..937580,937626..937648))
                     /locus_tag="CNE03280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570888.1"
                     /db_xref="GeneID:3257945"
                     /translation="MAASLQHLGRGALRVAKNYTKGYTDTQTKVREATSNDPWGPSGT
                     MMNEIAQLTYNQNDFVEVMEMLDKRLNDKGKNWRHVFKALTLLDYCLHAGSENVVIYF
                     KDNIYIIKTLKEFVYVDDNGKDVGSNVRQKAKDITNLLQDESRLREERRSRGAMRDRM
                     LGTIEASGLRGDRDYGEPRSPARQNESPRPAQQNESPRPTTRPNRSRDEEDDLKKAIE
                     ESKRMSEDEARRRSMLTQEEDDLQRAIRLSEEEEAKRKREQESATQNALFDDSLNLQS
                     QNAYTQQPDLFAQQTQQMPVQPTSGWPLVDVGWGQQQQQLQPQYTSYNPFYAQMQEQQ
                     MQQQQQEEYMRQQMALQEQQRQQQEWIQQQQYLQQQHTSLLAQPTGYGSNNPFAPSLG
                     SQQTGQISSPQPQQPSFLPVPNVTAQSQSPAPQAQMPEQQPLEPQATARPAWTPQTKT
                     NDVEHGQLASLLARGREDGLDTFGNMGNLRIPVGSTFHNSNRIAMQQTGAGGLGANNP
                     FGQKQAQQGQQQGQSREQPFFSI"
     gene            937911..941220
                     /locus_tag="CNE03290"
                     /db_xref="GeneID:3257636"
     mRNA            join(937911..938002,938049..938128,938180..940416,
                     940470..941094,941134..941220)
                     /locus_tag="CNE03290"
                     /product="eukaryotic translation initiation factor 3 110
                     kda subunit (eif3 p110), putative"
                     /transcript_id="XM_024657246.1"
                     /db_xref="GeneID:3257636"
     CDS             join(937964..938002,938049..938128,938180..940416,
                     940470..940972)
                     /locus_tag="CNE03290"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3 110
                     kda subunit (eif3 p110), putative"
                     /protein_id="XP_024512883.1"
                     /db_xref="GeneID:3257636"
                     /translation="MPPIYVKPENALKRSEELLALGTPQSQQQAFDNLVEVFQSKRFK
                     QTPINVLEPIVTKFIDLCVVLSRKAHAKSGLLVFKSAAQTTNVGAIERVLNHFIAKAE
                     ARLAAAVEQAKKEVAALPDVPVVDDDLPLQPASLMLDCFVDSAGDRERIERRLIAPAQ
                     KFCWDSYDICLDIAKSNDRLEVIYQSIAHRAFHFCKIHQRKADFRRLCEQRLRKDLAN
                     AAKYSHQQHAINLSDPETLGRFLDTRFLQLETAVELELWQEAFRSIEDVHGLIAGRKG
                     TKPSMMANYYEKLTQIFKAEGGKQTAVFHAAAWARYFQHAERAGIVNDKASGCVLLSA
                     LAVPLGEVEVKQRLVALLNLPKTPTREALVQDAAAKHLKRVPADIRQIYKILEVDFEP
                     TTASKVLAPLITSLSPEYQPYLPALRDVVLSRLLQALAQVYDSVTLSHILDLVKPLDN
                     TPWATDMSSLEKFLVTACRRGDIRASVDHVAQTITFVSTPPDANGLQTLAVCLYNTIQ
                     YLNPSRLAPVSRSDAFAAAIAQAEEERKAASHKRQIVIRRRELLEEAKLRREKEASTA
                     LAERLKIKAEEDARRAKEEAKQAEIDRVRKQIHETKQAEAKQLAASLAAQGALKVDIS
                     SIEDLDSSKLVAMQVEQLAKEKKELSERLRIVGKRVDHLERAMRKEERPLLAQDYERQ
                     KAEDRAAHDRANQIAREQAIEQQRAARELKQRLGRMLEDYEAVKERIESQMQEELKAA
                     KEEARRKIEEEKAQLREKVIKRKREEKERKLKEAREAEERKRKEEEEAAQKAEEEARA
                     AAALEAEAAAAEQRRAEREAQRQSDLERIRAQQEREEEALRRRQAEKAAATSGGSAYR
                     PPARAGTTPPTASPAPSSGGPSWLARRKAMEAQSAGGAPVASSPKPVPSNSAAASAPA
                     SNGPESIAGEAEKPALTGSVWRRGMGARRGMPSTRGGA"
     gene            941347..942748
                     /locus_tag="CNE03300"
                     /db_xref="GeneID:3257852"
     mRNA            join(941347..942060,942128..942504,942557..942748)
                     /locus_tag="CNE03300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657247.1"
                     /db_xref="GeneID:3257852"
     CDS             join(941455..942060,942128..942504,942557..942656)
                     /locus_tag="CNE03300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512964.1"
                     /db_xref="GeneID:3257852"
                     /translation="MSYKPPTGPPPNRNTSNNPFADGGSASSSNANPIPAQGLPEDQI
                     PSDPPPAYTPSANMSGSTTVASGPSHVDFSGPPPMPDRIANQQTGVGVNVTGVGMGYG
                     HGGGHHGWGGGSEDYSGPTNTEGLSKPHLPPRNNSSASSRPPPPLPSRAQPQNLTPTE
                     VPTPGRPLLRRGQLLVYPKGHWCPKCQNTGYKSSDPSNPHESDWRKYGKPYNSALAHS
                     YTSMISNSDPAQGVNASTAASSNFQRPLPSYSPAGSSSAGSNTYAHLPPPPGKWNTYP
                     GQSTPRPPPPPPPPNWGAPPMQGQQVFVQRSAGPVPPGALVVRPGDPRIGGQLCWRCS
                     GSGREISFFGFDDGRCGECRGLGRLF"
     gene            complement(942717..944831)
                     /locus_tag="CNE03310"
                     /db_xref="GeneID:3257609"
     mRNA            complement(join(942717..943289,943339..943990,
                     944041..944523,944571..944652,944721..944831))
                     /locus_tag="CNE03310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570892.2"
                     /db_xref="GeneID:3257609"
     CDS             complement(join(942752..943289,943339..943990,
                     944041..944523,944571..944652,944721..944768))
                     /locus_tag="CNE03310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570892.1"
                     /db_xref="GeneID:3257609"
                     /translation="MAAPKIKPLPPVSVQFLGTSSGGGPIQSRNCSSLAVDFGNEIWL
                     FDAADGTLNRLHQSSLKLANISRIFITHLHVDHVLGLVPVLTTIMNGTMATEEATQKI
                     KELGLKKQPTFHLYGPSGLRNLVRTILNITKANISGAFAIHELLQDGEGPSAGCREDE
                     IHPNEAVGMDMRADEDGVWKMVLQEGNGKSGKGWKVSAGPIHHRVPSLGYVLQEPTPR
                     LPLDTATLIPLLQSNSEALSALNPPVKHPLSLLSHLTSLPPPPPLTLPSGDIISPPEP
                     SGVLPRKIVVFGDCSGGTKNHVFRSMCEDPSLLVHECTNAAIPQAIQREEKGQKARTR
                     DLEPSLMLSRGLSAGQSTCSSGCSSANPPSTPNGFHARNGDKENADEVKRNEVKKKAQ
                     SRGHSTPDEVGEFAREIRARRVVINHFSAMFPSPRYPTAAALPSILSSICSFPYPVPR
                     PLPHTSLPPPLPISLTSKYPSELHVRVIMQSLADQILEKCASFSLSDEDLDKPPRGKT
                     GMVIPARDFMCLPIPSHELSALEIEDVRSYKEIADKVTEEWKKHGGIWIKNGEEEWIG
                     VEKEVKKAGWRFKKVVKERDEWVADKAEEDSNGN"
     STS             944443..945026
                     /standard_name="Sal2"
                     /db_xref="UniSTS:470809"
     gene            945446..947624
                     /locus_tag="CNE03320"
                     /db_xref="GeneID:3257711"
     mRNA            join(945446..946019,946070..946533,946592..946883,
                     946936..947064,947118..947624)
                     /locus_tag="CNE03320"
                     /product="small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_570894.2"
                     /db_xref="GeneID:3257711"
     CDS             join(945513..946019,946070..946533,946592..946883,
                     946936..947064,947118..947480)
                     /locus_tag="CNE03320"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_570894.1"
                     /db_xref="GeneID:3257711"
                     /translation="MSGSLTHVLFEGPSGYGLFTVNLQEEVAAKSKQLQDSIADLGIF
                     SRMVQLASFAPFTSAAQALENANDVSEGVLNPHLQALLNLIVPDAAGKGNKKQSGVLL
                     GVAERGLAGAIQGEMGIPCDTSERALELIRGVRLHQEKILIKGGMQKGDVTVAQLGLG
                     HSYSRGKVKFNVNRSDNMIIQAISLSDQLDKDLNTFFMRVREWYGWHFPELYKLVPDA
                     HQYALLAVLIGDRTALSEDSLEEMQEILDDDETRAKNVLDAARASMGSDISEVDLINI
                     SNFAERVVKLAEYRKSLRRYLTEKMNVVAPNLSALIGETIAARLISHAGSLTNLAKYP
                     ASTVQILGAEKALFRALKTKGNTPKYGLIYHSTFIGRAGAKHKGRISRFLANKCSIAC
                     RIDCFTDVPTNKFGEALRAQVEERLNFFETGAPVGKNSDAIQKALAAVAADLDDEDDD
                     DDDEGHLKEDDVADAVKQVEKDQAEAAVNRGPIDPELAKLASEATSSTPKKEKKNKKE
                     KKDKKEKEEKKKRKSEAMDVDVKEDEEEKKEKKSKKEKEEKKEKKEKKEKKEKKEKEG
                     REEKEGKKEKKKKRKSEA"
     gene            949006..952229
                     /locus_tag="CNE03330"
                     /db_xref="GeneID:3257890"
     mRNA            join(949006..949086,949170..949272,949328..949341,
                     949431..949442,949502..949609,949667..950107,
                     950158..951395,951447..952229)
                     /locus_tag="CNE03330"
                     /product="ribonucleoside-diphosphate reductase large
                     chain, putative"
                     /transcript_id="XM_570896.1"
                     /db_xref="GeneID:3257890"
     CDS             join(949230..949272,949328..949341,949431..949442,
                     949502..949609,949667..950107,950158..951395,
                     951447..952182)
                     /locus_tag="CNE03330"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase large
                     chain, putative"
                     /protein_id="XP_570896.1"
                     /db_xref="GeneID:3257890"
                     /translation="MVMWIYKRDGRKEPVAFDKVTARINKLSYGLDPNFVEPAEITQK
                     VVQGIHAGITTVELDNLAAETAAYLTTKHPDYAILAARIAISNLHKETKKVFSAVVHD
                     LHAWVNPKTGKHSPMIDDDVYKIVMDNKDILDSAIIYDRDFAYNYFGFKTLERSYLLR
                     INGKIVERPQHMIMRVAVGIHGSNIDKVIETYNLMSERYFTHASPTLFNAGTPRPQMS
                     SCFLVAMKDDSIDGIYDTLKTCAQISKTAGGIGLHIHNIRAKGSYIAGTNGYSNGIIP
                     MLRAYDATARYVDQGGNKRPGAFAIYLEPWHADVFDFIDLRKNHGKEEVRARDLFYAL
                     WIPDLFMKRVESDGDWTLMCPAECPGLADVYGEEFEKLYESYERKGKGRKTIKAQKLW
                     FAILEAQTETGVPYICYKDAANSKSNQKQLGTIKSSNLCTEIMEYSSPDEVAVCNLAS
                     LALPAFVDLERRVYDFKKLHEITKVVTKNLDTVITRNYYPVPEARNSNMRHRPVGLGV
                     QGLADAFMALRMPFDSPEARELNIQIFETIYHAALEASCELAEEFGTYESYEGSPISK
                     GILQYDMWGRVPTDLWDWTELKAKIAQHGVRNSLLVAPMPTASTSQILGWNECFEPYT
                     SMLYARRVLSGDFQVVCPWLLRDLINLDLWDDNMKQLIIAAGGSIQSIPNIPDDLKKI
                     YRTVWEISQKAVIDLAADRGAFIDQSQSLNIHLSNPSFPQLTSMHFYGWKRGLKTGCY
                     YLRTRPSANAIQFTVDASTLKTAKSLNSSAKPSPTPSPAPGASRATADSLVQPMRKVT
                     IATTASHHPPQPDETNDSRSRDRSPQPSEEEEITYEEAKKRAEERAEAALQCSIENKD
                     ACVMCSG"
     gene            complement(952364..953804)
                     /locus_tag="CNE03340"
                     /db_xref="GeneID:3257929"
     mRNA            complement(join(952364..952716,952779..952942,
                     953002..953080,953137..953575,953653..953804))
                     /locus_tag="CNE03340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657248.1"
                     /db_xref="GeneID:3257929"
     CDS             complement(join(952486..952716,952779..952942,
                     953002..953080,953137..953575,953653..953756))
                     /locus_tag="CNE03340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512965.1"
                     /db_xref="GeneID:3257929"
                     /translation="MVPLILLLTVRAVVGVDIINYDSGGPGLAWANNLWVPMAGFTGD
                     GTLISSYYNWSPYPVIPTSRHSSLYDVPFTFVPMLWGCNSTYFEPFLEQVASNFSDVI
                     LTPQRAILGFNEPDQAGQAECSPEEAAQTWIEVIEPLKSQGYRLGSPAVTSGYSGREW
                     MAQWYEACNGSCNPDFTAVHWYDLVAQNFIEHIQYYHSTYGKNIWVTEFAPQNFSVYN
                     TTTGTYDGQAIYTEIQRFMDVATAYMKSVSWVERWFWFGAMYDMQGVNALDTLFAESG
                     KQERTGALNELGVQYAGSNGSVLFSDHISWASSKMSERSYGIQELFIVGLIVMVSVRV
                     LQRI"
     gene            complement(954775..956867)
                     /locus_tag="CNE03350"
                     /db_xref="GeneID:3257809"
     mRNA            complement(join(954775..955366,955417..956020,
                     956078..956468,956521..956602,956654..956867))
                     /locus_tag="CNE03350"
                     /product="expressed protein"
                     /transcript_id="XM_570898.1"
                     /db_xref="GeneID:3257809"
     CDS             complement(join(955163..955366,955417..956020,
                     956078..956468,956521..956602,956654..956839))
                     /locus_tag="CNE03350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570898.1"
                     /db_xref="GeneID:3257809"
                     /translation="MPPYLYRLPTTSLITFSAILNDPSSSYTTILSDATASRTKLHLA
                     LKGIADNEPGASALAVLDAVQIYLPYLKGIIACLDADELLFKGEPTFQWRAPLTHFSF
                     SSPLLPLASIHSEHLMVVLTYALALSNYAHSILASLPAFEIPAGPKAMPHMSSEDEKR
                     TTAGLARAVDLLCQASGVAEWAAENVCLQVEPLKGVSSGRLGKGKWPAESSRETFKAL
                     SMILLADAHLTAIRKLLFPVLTYTLFAPPGPPLPPNHPSAPLQAKLYLYVHQLYSSAR
                     ALLSVHHQPTSSAPSNSSRKLFRSNTDKDVIEPEAVEGEIIPELKRYLAKEAQLALAL
                     AHKWLGIDAGENGKGAKVGEALAWVKDAQGRLEDLEDSKMRAKLKGLSIGKSRERKKE
                     ERRARMGRVERELEVVKAWVKAYQKMNDTVAFQPVPPVSSLVTPSGRPIFGPKAFIPP
                     PSKFSPSRIGHLNEEQGNDSPELGETEDTSYAGKGNYF"
     gene            complement(957012..958711)
                     /locus_tag="CNE03360"
                     /db_xref="GeneID:3257792"
     mRNA            complement(join(957012..957458,957509..957557,
                     957614..957680,957727..957827,957880..957910,
                     957966..958235,958296..958711))
                     /locus_tag="CNE03360"
                     /product="nuclease, putative"
                     /transcript_id="XM_570900.2"
                     /db_xref="GeneID:3257792"
     CDS             complement(join(957090..957458,957509..957557,
                     957614..957680,957727..957827,957880..957910,
                     957966..958235,958296..958503))
                     /locus_tag="CNE03360"
                     /codon_start=1
                     /product="nuclease, putative"
                     /protein_id="XP_570900.1"
                     /db_xref="GeneID:3257792"
                     /translation="MPTLGPSLLFVAGLTLGVGAGTLLPRKTSQPNVPLPPPPPEGGR
                     PDFKESKALVPTATGIVGPLQGGFPGPTPDIIKRVAYTAAYDRRLRHPAWTAEHITAT
                     SLAKISPPQIKGTPVPLEAARAADTSSQPEVIKVDRSKSVFKEDDGIPEMFRAKLSDY
                     FRSGYDRGHMVPAADAKISQQAMDETFYLSNIAPQVGDGFNRHYWAYVEDFCRRLTTN
                     FEDVYVFTVPLYLPEKHADGKWRVSYEVIGNPPSVSVPTHFAKVILASRPDFSYPQKP
                     SSASTAVSSPQTVKELALGAFVLPNKEIPDQADLRSFIVPVEHVEKAAGLKLFNEEVK
                     TKSRQLCAVTQCQVIVRRFDDARKQLGGKK"
     gene            958756..962509
                     /locus_tag="CNE03370"
                     /db_xref="GeneID:3257756"
     mRNA            join(958756..958848,958911..959013,959079..959316,
                     959368..959660,959712..960095,960142..960211,
                     960266..960419,960469..960556,960615..960843,
                     960898..960942,961016..961120,961174..961193,
                     961250..961349,961416..961517,961568..961769,
                     961832..961966,962048..962509)
                     /locus_tag="CNE03370"
                     /product="protein carrier, putative"
                     /transcript_id="XM_570902.1"
                     /db_xref="GeneID:3257756"
     CDS             join(958769..958848,958911..959013,959079..959316,
                     959368..959660,959712..960095,960142..960211,
                     960266..960419,960469..960556,960615..960843,
                     960898..960942,961016..961120,961174..961193,
                     961250..961349,961416..961517,961568..961769,
                     961832..961966,962048..962423)
                     /locus_tag="CNE03370"
                     /codon_start=1
                     /product="protein carrier, putative"
                     /protein_id="XP_570902.1"
                     /db_xref="GeneID:3257756"
                     /translation="MSTEHLLGDIGAVLTAFIASEDHPRREAEAHLQRLAVEQPAEVL
                     LVLAQVGAQGVGGFQLDHRLLALILLKRMAFKPLEGLFLNPQSQKPAAPFDVVRETIR
                     GRIETVICAGIKDEMDVRMRKGLGACAANWAHECAIRHRPLLPLPPVLLELTASPHPF
                     HRFTPFQLLDLTPTLLVDSVRDPIPAEQLAQMLQAGLNDPSVDVRVEAMKAVRSVLME
                     GVTGSERSEIGANLVLHSFETLRNLPPALVSHALIPLVDLASAHPSLFMTSLNPILSS
                     LLPLLAPPAQETNLPPFQFSPYPPHNMTFDEWEDISNPATEIILSLTELRPSHISEWE
                     NGRAVKEMIGLLLARQVVTFGNDSQEWLETKDLDAEADEYPVLAEESLSRLSMALGGE
                     LVLPTLSQQVQALLQQEDWRCRFAAISGISSIAEGCLDELQAGLREVLAMLSSAAKDP
                     HPRVRYEFLQCLGQLSADLEGALQENFADDVLQISLALLDDPVMRVRSHSAASLTNFF
                     QEASPRHFEKYLEPVVCGLLNLYQSQVLYAQDQALATLATVAAAAEKMFTPFYRNIMD
                     LCFMILSNPVITDVAQRKLQGRAMECGTLLGMAVGKNTFGTDAVKLSQLMITIQNQIV
                     DADDPRSGYLMDAWSNVCQSLGAAFEPFLQYVVPNLLKTASYKPSDSSNETGEDDTGG
                     AHTYEIDQKIMAFESLTTYAFQMRGKFAPWLAPCMQLSLNELSCSFSEDVREAAAFLV
                     PGLLQVAKDSKVWADAPYNLTQVFQQLVNVIVKTDDIGYTALLYKSFTDSLHVISAPF
                     PAELTTQLLKSGHAVLHTIAQTRADREAQEPYMDESDKEIYLEEQNEEEACLTQLRKA
                     LEMVIKVGDSNAGTEQGALANGLREELQGALEMVREVKKRGMKGDGEKRFG"
     gene            complement(962504..963412)
                     /locus_tag="CNE03380"
                     /db_xref="GeneID:3257976"
     mRNA            complement(join(962504..962967,963036..963131,
                     963186..963271,963336..963412))
                     /locus_tag="CNE03380"
                     /product="adenylyl-sulfate kinase, putative"
                     /transcript_id="XM_570904.2"
                     /db_xref="GeneID:3257976"
     CDS             complement(join(962566..962967,963036..963131,
                     963186..963271,963336..963363))
                     /locus_tag="CNE03380"
                     /codon_start=1
                     /product="adenylyl-sulfate kinase, putative"
                     /protein_id="XP_570904.1"
                     /db_xref="GeneID:3257976"
                     /translation="MATNITFHPGAVTQDERDTLLGQKGCTVWLTGLSASGKSTIATA
                     LEQHLLHKKLHAYRLDGDNIRFGLNKDLGFDQASRVENIRRIGEVSLLFALSSTISLT
                     AFISPYISDRQLARELHEKHSPAIPFIEVFIDAPLSVVEQRDPKGLYKKARAGEIKDF
                     TGISAPYEAPANPEIHIRTDEVDVTGAVEIITKYLADNGLIPA"
     gene            complement(963549..965707)
                     /locus_tag="CNE03390"
                     /db_xref="GeneID:3257828"
     mRNA            complement(join(963549..964048,964104..964166,
                     964220..964672,964722..965007,965051..965261,
                     965305..965707))
                     /locus_tag="CNE03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_570905.2"
                     /db_xref="GeneID:3257828"
     CDS             complement(join(963599..964048,964104..964166,
                     964220..964672,964722..965007,965051..965261,
                     965305..965338))
                     /locus_tag="CNE03390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570905.1"
                     /db_xref="GeneID:3257828"
                     /translation="MPTLRKTGDRPAGTGLAKPPSVPSPRAPSKPSAPPPPAPSGPPS
                     RTAPPAPPAPPAPPAPPAPPAPPAPPAPTRHVPPPARATPPAPPAPTSSRAPPRVPPA
                     PPAPSRTAPPAPAPPAPPAPAPPAPAPPAPPAPPAPPAPAPPARNAVHRKEPAPPLPG
                     RSPAPSLPNRPTNSVPARAVPPPPPRPSSMTGGRAPPPPPPRPTGPPTLPSRPASSYA
                     APNRALPPAIPSRTDSSNLAPPTPPRRPSSVSAPPAPPPPAPAPPAPAPPAPPAPAAP
                     APRRMIPPPARSIPSPAPRVVQPEPEPEPEPEYYGQEEETAPPPLPAGRPASRLPPPP
                     PSAPPPPPPGPSPASRAAPPAPARAPPAPARAPPAPARAPPSPALERNRPHPAGTAFA
                     PPPPPGISPAAGTNRSSLAPPILASRPRPQSLHASRTNVAQRSSEAVDSDGGADGDSG
                     AEDQVPEPPAVVGSWTFPMKGMFPAPRPWSGGRKTYVSGNMHGGGIGF"
     gene            965496..966493
                     /locus_tag="CNE03395"
                     /db_xref="GeneID:36392874"
     mRNA            join(965496..965712,965781..966065,966112..966162,
                     966212..966493)
                     /locus_tag="CNE03395"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658536.1"
                     /db_xref="GeneID:36392874"
     CDS             join(965697..965712,965781..966065,966112..966162,
                     966212..966435)
                     /locus_tag="CNE03395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514384.1"
                     /db_xref="GeneID:36392874"
                     /translation="MNFSPYQPPPDVPATDPPEVSKSKPRSKPWFTRDASYSASYQAG
                     GTLADPSAPRAYTNDPESPAFDPAGPDSDRANAWESRFGWRVDAMAAAAYLAGPLTAL
                     VFLILETRNDYVRFHAYQSALLTTPLLVLLLLFNLLLPLPAFLRTLFIVASVGATLYA
                     AFRAWRDAQEGLERYWLPYIGPIAERWVSEE"
     gene            966611..968293
                     /locus_tag="CNE03400"
                     /db_xref="GeneID:3257887"
     mRNA            join(966611..966788,966837..967210,967266..967454,
                     967511..967610,967660..967770,967828..967964,
                     968020..968118,968178..968293)
                     /locus_tag="CNE03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657249.1"
                     /db_xref="GeneID:3257887"
     CDS             join(966753..966788,966837..967210,967266..967454,
                     967511..967610,967660..967770,967828..967964,
                     968020..968118,968178..968232)
                     /locus_tag="CNE03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512885.1"
                     /db_xref="GeneID:3257887"
                     /translation="MLPLWARGGKPIVIPLPQKRHFTLPALPILLLLLATGFLLHPLF
                     FPPPPPTPAGKYTSSPFLVKPSDFIDPPPPDRPSYLPAPLEPKKKGMLVPDAVHYVYG
                     LKPVPQGQHGEELPYYAYLAMRSALINLKPKAIYFHYEHLPTGPWWDLIRPHLTLIKT
                     QVPESIYGRPLKHFAHKADVLRLLAMKYSGGIYLDIDIYVIRPFDDLLYYPTTLGMEA
                     SPDSRRSALDPEGLCNAIIISQPNSSFIDRWLASYETFDGGIWAHHSVVKPWQLAREH
                     PTEVQVLSERAFFWPMWHGDEIKKTHETSQHDFRASRQYAYHAWESLAMGYLSKLSPQ
                     SIRENENSFNKMVRPFIGPKDDETYNKWKGET"
     gene            968354..970032
                     /locus_tag="CNE03410"
                     /db_xref="GeneID:3257917"
     mRNA            join(968354..968587,968646..968902,968956..969039,
                     969091..970032)
                     /locus_tag="CNE03410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570907.2"
                     /db_xref="GeneID:3257917"
     CDS             join(968383..968587,968646..968902,968956..969039,
                     969091..969228)
                     /locus_tag="CNE03410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570907.1"
                     /db_xref="GeneID:3257917"
                     /translation="MPENPSSSPTEPPEQSAAFEKWRSGLAQFTGLGLSESEKAERER
                     LKAQGKLAKDWDKCEGWKRDLMNYSPMITFLLNHLKLAGCPFPSSAMQCHPCPENRAG
                     GFSPDHGILLCQDRFFNKKHMEDTLAHELVHAFDHCRFKVDWGNLRHHACSEIRAANL
                     SGDCRFTREVKRGFYAFNKQHQACVKRRAILSVLANPACTSPEMAEKAVNEVWESCFT
                     DTRPFDEIY"
     gene            complement(969291..970626)
                     /locus_tag="CNE03420"
                     /db_xref="GeneID:3257722"
     mRNA            complement(join(969291..969731,969821..969994,
                     970054..970209,970279..970393,970460..970537,
                     970588..970626))
                     /locus_tag="CNE03420"
                     /product="expressed protein"
                     /transcript_id="XM_570908.2"
                     /db_xref="GeneID:3257722"
     CDS             complement(join(969333..969731,969821..969994,
                     970054..970209,970279..970393,970460..970537,
                     970588..970610))
                     /locus_tag="CNE03420"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570908.1"
                     /db_xref="GeneID:3257722"
                     /translation="MSDKSPERLQGDPKPSASPVRSRPEPESEQPAPKRVRSNADDKG
                     RGRRLFGNLLGTLQKFKTEDKSSRVTEAAKRREELSERITKKLQSETALNHDIQETDR
                     ELKTLRIATDTAEALWRQKDIALSSRHALLRPTAHFLHTSLPLPHPPAFETNLLNPAP
                     IPISTGPTRDPPVKSDLPPLYFLPKILMPHQDDLIKSQVANIEELISEEVAALAAERE
                     QIRTTTRENRKRMEELSAKLSELRKQVRTTKDKDSTGPDHEKGESRMRTDDLGRAPRE
                     EMMEVDDKSKNEKSKDVRDEKEKGVKIEGDEGDIEVEY"
     gene            970797..972635
                     /locus_tag="CNE03430"
                     /db_xref="GeneID:3257836"
     mRNA            join(970797..970914,970967..971237,971290..971427,
                     971475..971592,971643..971893,971947..972042,
                     972088..972269,972317..972635)
                     /locus_tag="CNE03430"
                     /product="septin, putative"
                     /transcript_id="XM_570909.1"
                     /db_xref="GeneID:3257836"
     CDS             join(970845..970914,970967..971237,971290..971427,
                     971475..971592,971643..971893,971947..972042,
                     972088..972269,972317..972363)
                     /locus_tag="CNE03430"
                     /codon_start=1
                     /product="septin, putative"
                     /protein_id="XP_570909.1"
                     /db_xref="GeneID:3257836"
                     /translation="MASRPTRARKQAKKGVQLTLMVVGASGTGRTTFVNTLVESVLLE
                     HSTATLLSNPEDPHSALDISLVKQAAAQANVEQPIRIKPTNIELEEEGVRISLTVVDT
                     PGFGDGIDNEYCFQEISSYLERQYDDILAEESRIKRNPRFKDNRVHALLYFIPPTGHA
                     LRELDIELMRRLSPRVNVIPVIGKADSLTPSELRDFKKRIMEDIEYYGIPVYNFPYDA
                     EEDDEETIADNSALRALLPFAIVGSEEEILIDGEPVRGRRYPWGIVEVDNPDHSDFTR
                     LRSALLASHLTDLKEITHDFLYENYRTEKLSRSVGGNDPDSSIHPEDMANQSVRLKEE
                     QLRREEEKLREIELKVQREIQMKRQELLAKEDSLKVLEARLAAQNAAHSRESTPNY"
     gene            973685..976316
                     /locus_tag="CNE03440"
                     /db_xref="GeneID:3257544"
     mRNA            join(973685..974202,974259..975018,975071..975341,
                     975394..976316)
                     /locus_tag="CNE03440"
                     /product="replication control protein 1, putative"
                     /transcript_id="XM_570910.2"
                     /db_xref="GeneID:3257544"
     CDS             join(973750..974202,974259..975018,975071..975341,
                     975394..976264)
                     /locus_tag="CNE03440"
                     /codon_start=1
                     /product="replication control protein 1, putative"
                     /protein_id="XP_570910.2"
                     /db_xref="GeneID:3257544"
                     /translation="MTIPFTPRRSTRGQVFTPSPFPTPRISHPDTKYTWLSAASTPRL
                     SPGGSKTRTHYTAFSKVFAKGGKKNAAPKMTKFAIGDGVLVSVEGGNDGVAVLIDLWE
                     EERSEDDEEEDEEDEDGEEEKSPLMMAEVHWLLRRQDLPDVRRNFKVDDNEVLLTASS
                     TRRVTATIPISLLDDTVPVLSRTEFREKYPEEKSHYRGWAYVKEGIYWCQRAFDRFAK
                     GQNCWKIDIEEWKEVGKRGEGWTVPISKEEEEHPQEPGLESSDESDDGSEARVEEESD
                     GDEESEEESDDPAESISKKRKRPTKTAKTYAKRGRKVVTASRSKLPPRSKATPKSRKA
                     TKKPHPATSTSFLPTDFIAPELLPTDPFERALRMLHVGATPESLPCREEEFVDVLSKV
                     EEGVESGGGGCLYIAGVPGTGKTATVHAVVKELKRKAEDGEIPPFSYVEINGLKIPAP
                     QHAYTVLWEAISSSKGVGAKTALKGLERHFGKKGGGARGPRGHTFVVLMDELDQLLTS
                     KQDVVYNFFNWPTMRDSQLFVIAVANRMDLPQQLAAKIKSRLGLQTILFEPYDRAALV
                     SIVQSRLIPHPLMPSQDPKVLLPDAISLAAMKMAGTNGDARRVLDACRRAVEVALENK
                     SKPPSATPTAPPPQPGPQPVSAKAMAAVLQAMSSSPTTKFIQACSLQQKLMLAALVRC
                     VRREGVAEIVWKNIRNDHDALMRSLAFDTSEQGGREVAPNLLSNSELALVLTSLTSSH
                     ALVCSADISKGIDERKIALGMEIGEVGRVLMNEGDSWRKALAGV"
     gene            complement(976360..979113)
                     /locus_tag="CNE03450"
                     /db_xref="GeneID:3257488"
     mRNA            complement(join(976360..976518,976567..976998,
                     977046..977133,977183..977211,977272..977364,
                     977412..977510,977560..977709,977756..978085,
                     978131..978204,978265..978282,978334..979113))
                     /locus_tag="CNE03450"
                     /product="Ser/Thr protein kinase, putative"
                     /transcript_id="XM_024657250.1"
                     /db_xref="GeneID:3257488"
     CDS             complement(join(976459..976518,976567..976998,
                     977046..977133,977183..977211,977272..977364,
                     977412..977510,977560..977709,977756..978085,
                     978131..978204,978265..978282,978334..979045))
                     /locus_tag="CNE03450"
                     /codon_start=1
                     /product="Ser/Thr protein kinase, putative"
                     /protein_id="XP_024512886.1"
                     /db_xref="GeneID:3257488"
                     /translation="MFSRVLKSTNSQQQPSSQAPTSPTKSSRSGHTKSQSTAAPSPSK
                     IPVPSTPSSRSSFLPTGSKENLPAIPPSPSQQNNERSNYLSFLFSQNQAGTPTTPVKV
                     NKTAPSHVAPNPGHAHHGPETVAQREEKPVYPRDSEDVHMVTMKNTVNPVMLKQLASI
                     PQHNQAASSAPSVAQKQSNPPNSYAAQRGGAYQPDDVHMKTAARHDTRYEKERGLQLW
                     ERELLETPEVKRKATVAQIYFLDYYFDLLGYIANRRKRLETFKADTAARNVTGPDYVK
                     ELSSYNGRERVLLRKRRTKLRIDQFRIIAQVGQGGYGSVYLARKADTNEICALKKMRK
                     GTLAKMDEVKHVLVERDILTAVKTPWLVRLLYAFQDIEHVYLAMEYVPGGDFRTLLNN
                     SGVLKEEHARFYGAEMFVCVNELHKLGYIHRDLKPENFLVDGTGHVKLTDFGLATGSL
                     NPQKIEEMKSKLDQVKDENLVFRSTLERRTIYRSIRATEPRYADSVVGSPDYMPPEVL
                     RGKTYTYSADYWSLGCILFEFLCGFPPFSGSTPEETWANLKNWTRVLRRPVYDRPEDL
                     IFNLSDVAWDAVTALISHPKDRVASLQEVQSLPFFSSLPFASLRQLEAPFVPVLDGET
                     DVGYFDSFSSPEDMAKYAEVFKKQRDVEAVEERGIGKRNNWVGFTFGKNANVTVPYRG
                     IKPEGEALQTIF"
     gene            979270..980783
                     /locus_tag="CNE03460"
                     /db_xref="GeneID:3257932"
     mRNA            join(979270..979588,979642..979893,979941..980036,
                     980087..980176,980236..980460,980518..980783)
                     /locus_tag="CNE03460"
                     /product="expressed protein"
                     /transcript_id="XM_024657251.1"
                     /db_xref="GeneID:3257932"
     CDS             join(979297..979588,979642..979893,979941..980036,
                     980087..980176,980236..980324)
                     /locus_tag="CNE03460"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512887.1"
                     /db_xref="GeneID:3257932"
                     /translation="MAPTTYAVPPRPASLHFLLESSTSKNGVPSLDLRWEPFQRHIES
                     FLNAIDAYTQAARTEIVARATDHTAAVRDLKADKEEMERGIQLQRESEGEMLATLEAE
                     RHVVADLNASLSHLQSSLTKIKEKSSALDAELQSERKEVKAMQAEKERQTNVLNNMRE
                     RDTTELKQLEEALGWRVEGIKQDQLLMRFTLIDPEDPAREFSIIVDVSKQVYSVPNCD
                     PPIPSLPDLVRQLNFDRDLFAFIKRVRIAFRALIPNPPNPSTKFDDLTGPSRSR"
     gene            complement(980800..983587)
                     /locus_tag="CNE03463"
                     /db_xref="GeneID:36392875"
     mRNA            complement(join(980800..981434,981490..981534,
                     981592..982306,982356..982378,982424..982867,
                     982941..983587))
                     /locus_tag="CNE03463"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658537.1"
                     /db_xref="GeneID:36392875"
     CDS             complement(join(981493..981534,981592..982306,
                     982356..982378,982424..982741))
                     /locus_tag="CNE03463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514385.1"
                     /db_xref="GeneID:36392875"
                     /translation="MKALHYKTILSQRNTVPNACPAGKHTKKLFTAGLHKRSTIEKRK
                     NPQEQIRINDGLAICLFGFSAQIQNQRIEGSEEVSPQLSCQKQLNMYDLDYEEELRQQ
                     TVMAEVLPDAEMWRKWEKTEAPLRQGRGWYPRLDRHFLELLVISEIHCLSYPLDKINA
                     PPGHAERVHRHAIRVRRVACKRIGAERLQAYCERVKEAFEAYMMGGWARVQAHAQAQM
                     RGQMRGAIEVNHFEDAEDEETDENRGRKLGRGNGSMVREVSPVQKPSTGNSLTLNDPL
                     TDYEDEEDQSYLLEIDLKEVQLDGLSEEEFDEDFGDSASIKATLGTNSNEIAGTRMDV
                     DSECTYSSLAEGGKRGPQIRIQAPEIIKEAS"
     gene            complement(983589..984607)
                     /locus_tag="CNE03465"
                     /db_xref="GeneID:36392876"
     mRNA            complement(join(983589..983810,983870..983903,
                     983961..984077,984135..984394,984494..984607))
                     /locus_tag="CNE03465"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658538.1"
                     /db_xref="GeneID:36392876"
     CDS             complement(join(983694..983810,983870..983903,
                     983961..984077,984135..984361))
                     /locus_tag="CNE03465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514386.1"
                     /db_xref="GeneID:36392876"
                     /translation="MSAIRTSILRSFRATPTTSRAIVVSQKFTAFRQSLHLHPAYQTA
                     RRWNSSVPENPQLEAPENGSSPRQVGQIEPRLQMTFTCTADDCGHRSTHEFSKRSYQK
                     GIVLVQCPSCKARHLIADHLGWFKESLEGGKLKTVEDLLAAKGEKIKKGRINFDGDIE
                     IEDE"
     gene            984750..985465
                     /locus_tag="CNE03470"
                     /db_xref="GeneID:3257851"
     mRNA            join(984750..984856,984915..985030,985135..985307,
                     985364..985465)
                     /locus_tag="CNE03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657252.1"
                     /db_xref="GeneID:3257851"
     CDS             join(984820..984856,984915..985030,985135..985248)
                     /locus_tag="CNE03470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512888.1"
                     /db_xref="GeneID:3257851"
                     /translation="MHAFLGNPDRQLACAEFIQALEECHSRGYLARLVGVCNDQKAAL
                     GACLRQERLERTERNRNAAKERTAKKKAVWEALEREKAEETGKV"
     gene            complement(985371..987574)
                     /locus_tag="CNE03480"
                     /db_xref="GeneID:3257780"
     mRNA            complement(join(985371..985957,986010..986173,
                     986229..986286,986343..987574))
                     /locus_tag="CNE03480"
                     /product="Alpha-amylase precursor, putative"
                     /transcript_id="XM_570914.1"
                     /db_xref="GeneID:3257780"
     CDS             complement(join(985571..985957,986010..986173,
                     986229..986286,986343..987332))
                     /locus_tag="CNE03480"
                     /codon_start=1
                     /product="Alpha-amylase precursor, putative"
                     /protein_id="XP_570914.1"
                     /db_xref="GeneID:3257780"
                     /translation="MLTYQAALALIPFISFLPAYALDADAMRSRSVYQVVTDRFARNS
                     SSTGDCNVADRTYCGGTWSALADKLDYIQGMGFDTVWISPVVENIGGTTGEGEAYHGY
                     WTLDPESLNSNFGSADDLKTLSSSLHARGMYLQVDVVVNHVAATSSSTFQPSESYGPF
                     STSEDYHPFCWITDYNNQTNVEQCWLGDDSVALADLNTESDTVVSYWNQWITDLVSNY
                     TFDAIRIDTVKHVRQSFWPDFVNAAGVFNQGEVLLADVPYVAGYQKNASINPFNYPVY
                     YPLVRAFNGTGQSFSELINMVSYVNSNFTDPTLLGTFLDNHDNARFESFVTDPSLIKN
                     AQAYPLVTDGIPYVYYGSEAGFNGGNDPENREPMWTSNYDTSSDMYKFFTSLNAARSA
                     AGNASSTFYTDKMTLSQPSESTLLVAKKPLMSVFSNSGSSASNTSVSVDSSSSGWAAS
                     TNVIDALTCESFTTDDSGNLAVTIYQGEPRVLIEDSQKGSLCGGSSSNSSSTSNDSGA
                     GMTTKVSGWVALAGVFVAGLQVLL"
     gene            990294..991946
                     /locus_tag="CNE03490"
                     /db_xref="GeneID:3257671"
     mRNA            join(990294..990597,990666..991218,991273..991485,
                     991544..991946)
                     /locus_tag="CNE03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_570915.2"
                     /db_xref="GeneID:3257671"
     CDS             join(990712..991218,991273..991485,991544..991582)
                     /locus_tag="CNE03490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570915.1"
                     /db_xref="GeneID:3257671"
                     /translation="MTSPIPINPDATAARQASPPGLSTTTPGSSASSISPHTPFFPPP
                     GLAASATPTQPSSLFKWAASFGRSPPKPPMMGVDGSQKKAGTEGAEHENVPFEFGDFR
                     DTSAQSWANGRRAMSVSAPYGGPGQSGITELLKSNGSYSPTEPKGVMADKVARGQGVL
                     RRLSMGGYKGIISPPPQNSTLPPSPSQPATLPPPAPPAPTPVGSQGAAEINKAAALGA
                     NTRVRGRRYSETAGTRKRGVSPMGERLLREQGHF"
     gene            992211..993594
                     /locus_tag="CNE03500"
                     /db_xref="GeneID:3257816"
     mRNA            join(992211..992321,992383..992650,992708..992974,
                     993030..993147,993200..993594)
                     /locus_tag="CNE03500"
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /transcript_id="XM_570916.2"
                     /db_xref="GeneID:3257816"
     CDS             join(992281..992321,992383..992650,992708..992974,
                     993030..993147,993200..993312)
                     /locus_tag="CNE03500"
                     /codon_start=1
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /protein_id="XP_570916.1"
                     /db_xref="GeneID:3257816"
                     /translation="MSYDQVPSESHQFIQPDEDDLEALSFSHPNPNPTPSGSSSQQQP
                     QPSHVAGPSNPSGVSGKIGQDGPSNKPRAATSTTGWGGVRVETRYTGESTLDEPVSKT
                     IMRDLNSIYAKLILILYPPKGGHSQLLRDWDLWGPLVICLALAIVLSIDAPQDQSMQV
                     FSLVISLITVGSVVVTVNSKLLGGKVSFFQSLCVLGYAIAPILIASIVSFLVHNIFVR
                     IPVTLACWGWSVWASMNFFNGTQLPESRTFLAVYPMCLFFFVLAWMIIIQ"
     gene            complement(993333..994201)
                     /locus_tag="CNE03510"
                     /db_xref="GeneID:3257923"
     mRNA            complement(join(993333..993541,993600..993871,
                     993932..994201))
                     /locus_tag="CNE03510"
                     /product="myosin, light chain 2, 20 kDa, putative"
                     /transcript_id="XM_570917.2"
                     /db_xref="GeneID:3257923"
     CDS             complement(join(993419..993541,993600..993871,
                     993932..994136))
                     /locus_tag="CNE03510"
                     /codon_start=1
                     /product="myosin, light chain 2, 20 kDa, putative"
                     /protein_id="XP_570917.1"
                     /db_xref="GeneID:3257923"
                     /translation="MSNKPSLGKGLPSQVKKSSQGRREPSGGAYTMFTPQQVKQFKEA
                     FTMIDQDGDGRVTESDLREMLTNLGQTPTPELLHSLLTSRPGSSAATQSKPISPSDGV
                     NFTQFLSMMGERLIQLDPEQDLVDAFACFDDGDKGYVDVKTMRKHLGELGDRMEDWEI
                     ERLFSGPFTDRQGRFNYPEFAKVLRVNDGDPERKDKLST"
     gene            994350..996891
                     /locus_tag="CNE03520"
                     /db_xref="GeneID:3257931"
     mRNA            join(994350..994396,994594..994637,994705..994846,
                     994898..994918,994974..995571,995628..995685,
                     995741..995886,995942..996006,996058..996141,
                     996194..996379,996434..996891)
                     /locus_tag="CNE03520"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_570919.2"
                     /db_xref="GeneID:3257931"
     CDS             join(994720..994846,994898..994918,994974..995571,
                     995628..995685,995741..995886,995942..996006,
                     996058..996141,996194..996379,996434..996780)
                     /locus_tag="CNE03520"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_570919.1"
                     /db_xref="GeneID:3257931"
                     /translation="MNFYKSAALALDHLDKHQGSVKGSLAAAGVKASGAEAKRILALI
                     IETLKYRPVLQQLLKTVPILALERTTFPSRTPAKTPTSQSLVLVLLHDLLFSSRSRIE
                     ASDKWPPKPAVMRHQARLKAELVRIQIREGKTKKEDLAKTSGEGEAVRYIRYNPNAGR
                     PFEELGEYLKKKGYTKLDEPVYPIPEGKYFADPHLSDVLLAFPGSANWWVNDEWYEGG
                     GVILQDKASCFPARVLMEGWVEGEGECLDATSAPGNKTSYVSALMANRGKLHAFERSP
                     NRFKTLEKMLEKARCSNVQAQRADFTDTDPKSKEFKNVTRILLDPSCSGSGIVNRLDY
                     LVDDDAEESDSKTERLEKLASFQLQMILHAFKFPSAQRIVYSTCSIHPEEDERVVMAA
                     LQSNTAKENGWGLASRESVLPKWERRGRPEEMEGDEELANGVIRCLPEDKTNGFFVSC
                     FMRGDTGIRPKATKKAKDQRPPKRPLIEEQEEIAEEKGSPTVAVDEEGGEQAGKQDRL
                     AANIPRKEKTKAQLERAKRKKAQQKVKGKKRKVEL"
     gene            996951..998098
                     /locus_tag="CNE03525"
                     /db_xref="GeneID:36392877"
     mRNA            join(996951..997625,997686..997748,997803..998098)
                     /locus_tag="CNE03525"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658539.1"
                     /db_xref="GeneID:36392877"
     CDS             join(997608..997625,997686..997748,997803..997991)
                     /locus_tag="CNE03525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514387.1"
                     /db_xref="GeneID:36392877"
                     /translation="MPAFCKLCHGPLATSISSLKQVECHSTCIQFACPGCIKANKPSF
                     SILNLKNHIYDYHCAECMAEAPTHPLTTRFKAPPHPNSNSTTAIC"
     gene            complement(998081..1004407)
                     /locus_tag="CNE03530"
                     /db_xref="GeneID:3257993"
     mRNA            complement(join(998081..1000828,1000880..1001082,
                     1001133..1001650,1001706..1002718,1002769..1004407))
                     /locus_tag="CNE03530"
                     /product="Negative regulator of mitosis, putative"
                     /transcript_id="XM_024657253.1"
                     /db_xref="GeneID:3257993"
     CDS             complement(join(998107..1000828,1000880..1001082,
                     1001133..1001650,1001706..1002718,1002769..1004333))
                     /locus_tag="CNE03530"
                     /codon_start=1
                     /product="Negative regulator of mitosis, putative"
                     /protein_id="XP_024512889.1"
                     /db_xref="GeneID:3257993"
                     /translation="MLEASLLGPASSPGQLLSSRSFAGPSCDLLRSSFPVIFPAHDTY
                     DANEQSQNEKPKGRIIAAIGKESGRSDEWGEEELVWYDKTVVWSRGVELFRRFTFEHE
                     SEVVAYACFAWFKSEGGQNSLSKHNNVLARSSAASETFGPFHRSQHMAWGGPRSSSQP
                     QSQQPQLERTLVIFLQTRAHVYYQSGEDITVYLPFNVDCAWGLPDGGVLIQRELEKRE
                     LRMMNKDKRKAGSVLRGMDDQSSMSVLDDLIDLEDESGPSLPRLYILENPFDELKVAV
                     QGQVEGGYGSKPFLSSPAQPLGATSSVLYVSSEPYPFVITYNQESGEFVIYRHVRIHA
                     APEHPLSTPDPRTMRPEELLRQPDNHQLPVQPRHRRPSLHRNTSSFGPTAGDRRLSSA
                     ADPLDRTQRRAPRLSRGPLPDTASTDELQAVLEPPSNIPANSVGHRRSRGVSLMPTMT
                     PRPSFPENKRRASTAASFILHDLNAPQAKMALHVAAEKDLRETTMMMGLERDEVGIRS
                     EVVFHALATWKQPFTVDLKQINVFLSDNEDPRHVVINIHITSLSTLQNTSSQLCSFDA
                     TFRTGHSQRWVIKSLPPIPCRSAIPILCSRAPVFTSSPRQNIYDTIILPLGDGSDPQL
                     VTIGRRQYPFSLSTKLSKSYRSSLKPIKFVDPVGPRFTTVYANGESMRFSAAIYIRHE
                     LTQRCLEALSGILNENAFVEFKVELLSELLALPSCQRDDPDAVWNVFEETLTCMSGLQ
                     VERRTFSTMGRIVQDSALSVDAVTRRLAARLKSKEVHLSSPSEYQQASFKTSIYQSLP
                     GILLSLHLIAQDFRLSLSRRKDLSRVVKLIIKFALQIGNRDWVDYWERIMPVEIPNHV
                     RVRGRALDTHILDQFDTPPDIMLSLSRHLACPTKRFPIPGRLFKSSGRNINSAHTFKE
                     YPDEFDLLEPCPRIALITSIYRELGPSIGSRPQNLPLPRRARNALKVIISKVPNAEWL
                     HDLPYGVSLPILEILRACQCSPEDDWTREMYMLIGRPDMAMKAMKDTWYEDLTKDDWP
                     SGLGPERLPTIGQIMSQHQAGKMDAKTKKKAPLILPHVRFGTDRRLQEVERIMQTTKL
                     RIVSLSEPKGASADDVARYQQSFVNTLANRTLSITVGQGMFEYGTRVTTITDVWEIPF
                     IELSVKITPGNNVLKAEIVSDSAEWPCFHNGVAAGLSISPDCKGIDSSWIVFNRPQAL
                     NSEHGGFLLGLGLTGHLRSLLTYHAFPLMEPRHDFTSVGLLLGLASSYAGSGDLLITK
                     ILSLHTHALLPLGSMELNASPIIQSTALVGLGLVYVGSRNLRMAEVALSEVGRLDMPN
                     VQGFGEHQESYSFSASIAYGLIMLGRGGSTTSEIDRKMLAQLRRCIVGDITSLDSSKG
                     RSSFPGVDINITAPGATLALGLAYLKTMRKDVADLLDIPQTAFSLDQVKPEWLLLRTF
                     ARALIMWDSVVPTIAWVEAQIPAFILLAIKDAKQTRSPDLTTELAYLNILSGAGLAIG
                     LKYAGTATELAHNTIMSLYATLAKAVSGQGMNYEGRIKRTSARQGLNVITIALAAVMS
                     GTGELGVLRRLRVSHGQEGAGVNYGTHMAMHMALGLLFLGRGQYTLGNSNLAIAAMAI
                     AFFPRFLPNPSDNKAYPQAFRHLWALAVEARCLTARDVETLETVYLPVKLRFREGSSV
                     RQQSLISPTQLPSFDRLLTIEVDSPRYWPIRIDLSNPRDMENLIRTRTIYVKRKAGFI
                     DYNSDPKGNRSIFVRVGSMTGIDLHYDLISSGAPPSVAQEEVSELVRIHSGDASLVGL
                     ANHFTDVSDDFGSGIGTFLRTVIIECLALDKPHLIGVYLEIYLSLRREAARSRDPVLS
                     SSEIFDGMEDIVQSGLIKSFYDEHYEKNFAQVNAAGEKRFALVRHSFINAARRSVLES
                     SSEETEESHRAIEYMLKGLSAWESDARKIAKWLARNGVPPLPLLEALKQRLYRKGLAG
                     TEIELKMRRSAEKYWDSVVKSYDEGPAPVYKGDVWKLCSVQQIIDLWQ"
     gene            1004652..1006636
                     /locus_tag="CNE03540"
                     /db_xref="GeneID:3257640"
     mRNA            join(1004652..1004706,1004846..1005274,1005333..1005484,
                     1005535..1005612,1005665..1005783,1005839..1005952,
                     1006004..1006087,1006142..1006526,1006594..1006636)
                     /locus_tag="CNE03540"
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /transcript_id="XM_024657254.1"
                     /db_xref="GeneID:3257640"
     mRNA            join(1004652..1004706,1004846..1005274,1005333..1005484,
                     1005535..1005612,1005665..1005783,1005839..1005952,
                     1006004..1006087,1006142..1006567)
                     /locus_tag="CNE03540"
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /transcript_id="XM_570921.1"
                     /db_xref="GeneID:3257640"
     CDS             join(1005074..1005274,1005333..1005484,1005535..1005612,
                     1005665..1005783,1005839..1005952,1006004..1006087,
                     1006142..1006434)
                     /locus_tag="CNE03540"
                     /codon_start=1
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /protein_id="XP_024512890.1"
                     /db_xref="GeneID:3257640"
                     /translation="MSAITKGDLILVSGASGFIASHTVKEFLKEGFRVRGTVRSKEKG
                     EYLKHLFQGLGEFEYVLVDDITKDGIFDEAVKGVNAVAHLASPFYVTNVKDPRELIDP
                     AVKGTTGILKSVQKNNPKVKRVVITSSVAAIMCPISKKPPVTYTEADWNVDSIPHVEE
                     KGVEADGMHSYLASKTLAEKALWSFIEDEKPSWDAVAIHPPYVLGEVIHQCDKPESLN
                     TSVASFWSWPAGEKTEKDIPGPIGNWVDVKEIALGHVRALTVPEAGGQRFIISAGPFA
                     GQDYADILHKRFPEVKNVPVGKPGTHDEVCKELDIFDGKKAEKVLGIKYHTLEETVVD
                     MFESLRKRFNKF"
     CDS             join(1005074..1005274,1005333..1005484,1005535..1005612,
                     1005665..1005783,1005839..1005952,1006004..1006087,
                     1006142..1006434)
                     /locus_tag="CNE03540"
                     /codon_start=1
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /protein_id="XP_570921.1"
                     /db_xref="GeneID:3257640"
                     /translation="MSAITKGDLILVSGASGFIASHTVKEFLKEGFRVRGTVRSKEKG
                     EYLKHLFQGLGEFEYVLVDDITKDGIFDEAVKGVNAVAHLASPFYVTNVKDPRELIDP
                     AVKGTTGILKSVQKNNPKVKRVVITSSVAAIMCPISKKPPVTYTEADWNVDSIPHVEE
                     KGVEADGMHSYLASKTLAEKALWSFIEDEKPSWDAVAIHPPYVLGEVIHQCDKPESLN
                     TSVASFWSWPAGEKTEKDIPGPIGNWVDVKEIALGHVRALTVPEAGGQRFIISAGPFA
                     GQDYADILHKRFPEVKNVPVGKPGTHDEVCKELDIFDGKKAEKVLGIKYHTLEETVVD
                     MFESLRKRFNKF"
     gene            1007451..1008963
                     /locus_tag="CNE03550"
                     /db_xref="GeneID:3257940"
     mRNA            join(1007451..1007748,1007803..1007954,1008013..1008209,
                     1008258..1008371,1008430..1008513,1008570..1008963)
                     /locus_tag="CNE03550"
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /transcript_id="XM_570923.2"
                     /db_xref="GeneID:3257940"
     CDS             join(1007548..1007748,1007803..1007954,1008013..1008209,
                     1008258..1008371,1008430..1008513,1008570..1008862)
                     /locus_tag="CNE03550"
                     /codon_start=1
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /protein_id="XP_570923.1"
                     /db_xref="GeneID:3257940"
                     /translation="MTAITKGDYILVTGASGYIASQTVKEFLKEGYRVRGTVRSQDKG
                     EYLKQLFEGLGAFDYVIVEDITKDGIFDEAVKGIDAVAHLASPFYISNVKDPQELIGP
                     AVKGTTGVLKSIQKENPKVKRVVITSSVASIMSVRSRKGPVVYTEEDWNVDSIPYVEE
                     NGVNSDGGESYRASKTLAEKALWKFIEDEKPSWDAVAINPPLVLGEIIHQCDDPTKLN
                     TSVFHFWEWASGRKSEKDLPGGGANWVDVKDVALGHVRALTVPEAGGQRFIVGAGPFA
                     AQDYCDVLHKRFPEIPNIPVGKPNSHDEIVKGANIFDGSKATKVLGIQYSSFEETVVE
                     MAESLRKRFGQF"
     gene            1009414..1011186
                     /locus_tag="CNE03560"
                     /db_xref="GeneID:3257489"
     mRNA            join(1009414..1009544,1009640..1009781,1009844..1009899,
                     1009945..1010037,1010097..1010126,1010180..1010224,
                     1010274..1010359,1010413..1010559,1010630..1010713,
                     1010763..1010860,1010915..1011186)
                     /locus_tag="CNE03560"
                     /product="dihydrokaempferol 4-reductase, putative"
                     /transcript_id="XM_571198.2"
                     /db_xref="GeneID:3257489"
     CDS             join(1009483..1009544,1009640..1009781,1009844..1009899,
                     1009945..1010037,1010097..1010126,1010180..1010224,
                     1010274..1010359,1010413..1010559,1010630..1010713,
                     1010763..1010860,1010915..1011112)
                     /locus_tag="CNE03560"
                     /codon_start=1
                     /product="dihydrokaempferol 4-reductase, putative"
                     /protein_id="XP_571198.1"
                     /db_xref="GeneID:3257489"
                     /translation="MPAIQPGSLVLVTGASGYIAAHTIDALLKEGFNVRGTVRSQSKG
                     EYLAKLFKGAKARFEYVIVGDIAQEGAFDEAVKSVNAVAHMASPYHFNAVELDELFEP
                     AKKGTTGVLESLKKNNPDCKRVVVTSSVAAIVNSNIKPPHTFTEADWNPVSLKVCEEK
                     GRDADGVNKYRASKTLAEKVFWKFFEDEKPSFDGVAINPPLVLGPIIHECDSPESLNT
                     SVANFYDWMIGKKTEKNLPEAGGNYVDVRDCALAHLRALVVPEAAGQRFITGNGAYNG
                     NDFCIALAETCPDLKGVAKGNADPAYRKKLIDENNHMDGSKAEKVLGLAYRSKNETLR
                     DMAKSLRARFNF"
     gene            1011189..1016917
                     /locus_tag="CNE03570"
                     /db_xref="GeneID:3257548"
     mRNA            join(1011189..1011634,1011689..1011739,1011793..1012852,
                     1012906..1013376,1013430..1013825,1013873..1014256,
                     1014310..1014497,1014551..1014709,1014764..1014895,
                     1014950..1015447,1015494..1016011,1016057..1016541,
                     1016610..1016917)
                     /locus_tag="CNE03570"
                     /product="phosphate transporter, putative"
                     /transcript_id="XM_024657255.1"
                     /db_xref="GeneID:3257548"
     CDS             join(1011624..1011634,1011689..1011739,1011793..1012852,
                     1012906..1013376,1013430..1013825,1013873..1014256,
                     1014310..1014497,1014551..1014709,1014764..1014895,
                     1014950..1014956)
                     /locus_tag="CNE03570"
                     /codon_start=1
                     /product="phosphate transporter, putative"
                     /protein_id="XP_024512892.1"
                     /db_xref="GeneID:3257548"
                     /translation="MKFGTLLELNSNIEWWDYYVDYDALKKLFPSTPLDPSYRATHQN
                     DESSAILPLRRDLKKYASPENFKQALDKERSKVTEFYKSKFEELTGSFEQLEDEVARM
                     EERDLVQDDTIKEVDEENEDAEGGPDEQQDNPSTRETDNLLGPSSSPTRARSPLSRPR
                     PSFVGRLGSSFNFGRRKSAALPSSRDPDILEASIQPTYRPSRSPGATRTRMSDSMTSS
                     YFDESPSGRVPGPRSGRRVSDLESSVDDIRTTSGGHDRRTSVSSLSSHEGDFNWPRRL
                     YHSLGLVQMDPATVPDWAATSVGDVEEGRYGFLHGPNAKQAIFVWTANNDYATVLRIG
                     LKKRISKVWLDAYALKQYVELNMTAFEKILKKYDKNTDSKLKKQYISEMVLQSVPWTE
                     TSKKDLDELLARILFLYRRVVAGGDDDLAREQLRSQLREKVVIDRETVWSQMVSGRNR
                     SEGIFRSVTPDQIASSEPNKNVLRTPFGSLRVPTWLTMKAAMVILATVSSILIVQLQP
                     LDRVEESNCMAMLVFCIILWATEAIPLFVTSLAVPFLTVILRVIRSSDGEDERLSAAD
                     ATKYIFSQMFSPTIMLLIGGFTIAAVLSKTRLDVMTATRILNAAGSNPSVVLLVLMSV
                     ATFASMWISNVAAPTLCYALIKPITDELHPKSNFSKCLIIAIALAANIGGQASPISSP
                     QNLISLGSMDPPLSWLQWFAISIPVSSLSVVLIWAFLHINYRWESDLEIPKMRKNTDP
                     LTVTHYYVLAVSALTILLWCAEKSLEDWLGDMGVIAIVPLLAFFGTGILSKEDFHSFH
                     WSIVFLAMGGIALGKATLSSGLLDMLNNLLERLVEGMGLYSILIVFSMLALVIATFIS
                     HTIAAVLLVPIATRIGDSLEEPHPRLLIMATALICSAGMGLPVSGFPNMTAITQENKL
                     GQRFIGASDFLKNGILSSILAMFVIVTVGYAIMRGLGL"
     gene            complement(1015047..1018321)
                     /locus_tag="CNE03590"
                     /db_xref="GeneID:3257965"
     mRNA            complement(join(1015047..1015435,1015482..1015749,
                     1015807..1015979,1016048..1016404,1016454..1016529,
                     1016583..1016601,1016664..1016682,1016735..1016918,
                     1016973..1017179,1017233..1017305,1017354..1017490,
                     1017547..1017660,1017716..1017872,1017934..1018321))
                     /locus_tag="CNE03590"
                     /product="hemolysin, putative"
                     /transcript_id="XM_570927.2"
                     /db_xref="GeneID:3257965"
     CDS             complement(join(1015089..1015435,1015482..1015749,
                     1015807..1015979,1016048..1016404,1016454..1016529,
                     1016583..1016601,1016664..1016682,1016735..1016918,
                     1016973..1017179,1017233..1017305,1017354..1017490,
                     1017547..1017660,1017716..1017872,1017934..1018151))
                     /locus_tag="CNE03590"
                     /codon_start=1
                     /product="hemolysin, putative"
                     /protein_id="XP_570927.1"
                     /db_xref="GeneID:3257965"
                     /translation="MPPLVRRSTTSSIPTLLSLTKLVQLVPRSAQQWSSFGAATPPIE
                     PEDPPDSPKFWWKLGLSVVLVLAGGVFAGLTLALMGSDDLNLRVLSTSSCNPKERKAA
                     NKVLRLLARGRHWVLVVLLLGNVIVNESLPIFLDDVLGGGLSAIIVSTTMIVIFGEII
                     PQAICVRYGLSIGGVCAPVVWALMILFAPIAWPIAKLLDRILGKDEGHTYKKAELKSF
                     LQFHREGEEPLRDDEIVILNSVLSLNDKHAKEIMTPIEDCLILPSNKILNHDTIDEIL
                     LSGFSRIPIHEPGQKDNFIGMLLVKKLISYNPDDEWPVSKFPLLPLPEAKPEINCFQA
                     LDYFQTGRAHLILISDTPGQRGGALGIVSLEDLIEEIIGEEIVDETDRYQDNHSKKAV
                     KRSGTAAVMRGIIERRRVLNAFSRAPSRSDPQTPVGLSGPDGKGANSTNGILVQVSEG
                     SLIAETVDLSNDGATAAADPSRRLVISAAEPMSPIQEISTSPEIMYEAIQNGNRENGV
                     QEESKDVKDAKRSALDQEAKNGSNLESEAYPDHEIFEMACKALVDKYCLTKEGEVGPG
                     RTNKGWEWREHKFVAHQGYLYRRIVRYAPSTLFSYPLGQTHSDQSFNQTNEDEEDLED
                     AEDSALLPQQQDVLRSTKVEIEQYIVYSRTYRVPMYCFRAWDEAGAPLSISLLLKLNI
                     LHPPSPPQPLGFGDFGAALDTLMLPPENLPGEDTSPFPLVQSTEHPTTGELVFSIHPC
                     RIGGAVEEVLTTEGLGKGAQAGLEWLEVWMAMTSKIADLTYA"
     gene            complement(1018323..1021735)
                     /locus_tag="CNE03600"
                     /db_xref="GeneID:3257673"
     mRNA            complement(join(1018323..1018553,1018620..1019014,
                     1019066..1019276,1019337..1019506,1019563..1020107,
                     1020156..1020247,1020308..1020547,1020604..1020741,
                     1020792..1020962,1021011..1021735))
                     /locus_tag="CNE03600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657256.1"
                     /db_xref="GeneID:3257673"
     CDS             complement(join(1018431..1018553,1018620..1019014,
                     1019066..1019276,1019337..1019506,1019563..1020107,
                     1020156..1020247,1020308..1020547,1020604..1020741,
                     1020792..1020962,1021011..1021643))
                     /locus_tag="CNE03600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512986.1"
                     /db_xref="GeneID:3257673"
                     /translation="MSRSTTPAYQLRRPALNISSDPASSTTSRAGTPSSSNTAAKQVV
                     SLDEWESKSPLNGEQIGSIGTVKARFGERDLPEKFKNEGSSVSTPVLGNHLYPPSSSR
                     GPSLPSTPVPKVLSSSMIIPSPLYPKLISTPQQFLDHFTQLTLSTEHEQDSLYRDHLS
                     EIVGLKERCNGLIELLDAGEMEVKEMEKCLAYVEERSESLRGACEDLLEEQTHLLTHT
                     SQLAHRLTFFTFLESATRMLNNPGNDLVLNPQFLPMVKRLEECLTYLGEHRDFKDAEV
                     YLLRYQQCMTRSMALIRLYFVGVIKNLSQEVGRRLADQSLSETATQAFIYTKFISLSA
                     TLRPLLAELEQRVASNPDELGSLLVECHTAYLTTRKNLMGQRVNAEIGRMDPDKSDLV
                     DLARSGCSYLKQTCTDEFNLFKHFFLSGESQLYGFLESLCDYLYDHLRPRILHEPSLQ
                     VLCGVCTVLQALMVREVTDEEDDESAIFTPSSSPGSLHYPGSDDYFSSRPRMYRSGSS
                     RNILHSRSQSIRRVSSYGSHRSRSASPTALLSPSTRAAMVKSRKRKPLARLHIEVLLR
                     MVLQDAQTRLVFRAQALLSADVEYYVPKEGDLDYPERLKLGSQGNKLVPRQMAVSLDA
                     EDDDEPAILELPPPEAQKSWYPSLRVTLWVLSCLHTYVDAVVFEDLAQEAVTMCRRSL
                     SSASDMLVAKKGKNKNMDAKMFLVRHLLILKEMTTGLELGKARRQEWSGLGDFLKSLL
                     DNASSLLGYQRVTAQSNFVPDARTDIDRALKAACEDLISLVATRATSPLRAFLDKCTA
                     YIAKSAASSSSAKTDLSAQEFATSEKVKEVHEEFKSVCTTEVEEWKKELRMYLLDEDT
                     VAVLIPPAYNAIVDGYRQFHDLVRAEYDFSTAAGIMRPSGVMGMLETAS"
     gene            complement(1021846..1023956)
                     /locus_tag="CNE03610"
                     /db_xref="GeneID:3257901"
     mRNA            complement(join(1021846..1022185,1022237..1022300,
                     1022351..1022522,1022570..1022768,1022825..1023124,
                     1023180..1023263,1023660..1023956))
                     /locus_tag="CNE03610"
                     /product="protein phosphatase type 2A, putative"
                     /transcript_id="XM_570929.2"
                     /db_xref="GeneID:3257901"
     CDS             complement(join(1022177..1022185,1022237..1022300,
                     1022351..1022522,1022570..1022768,1022825..1023124,
                     1023180..1023263,1023660..1023752))
                     /locus_tag="CNE03610"
                     /codon_start=1
                     /product="protein phosphatase type 2A, putative"
                     /protein_id="XP_570929.1"
                     /db_xref="GeneID:3257901"
                     /translation="MAANDDVDAWIAQLMQCKPLSEPEVKKLCDKAREVLMEESNVQP
                     VRCPVTVCGDIHGQFHDLSELFRIGGNSPDTNYLFMGDYVDRGYYSVETVTLLVALKL
                     RYRDRVTILRGNHESRQITQVYGFYDECLRKYGNANVWKFFTDLFDYLPLTALIDNQI
                     FCLHGGLSPSIDTLDHIRSIDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFG
                     QDISEAFNHNNGLTLVARAHQLVMEGFAWSQERNVVTIFSAPNYCYRCGNQAAILEVD
                     DALKYTFLQFDPAPRAGEPLVTRRPPDYFL"
     gene            complement(1024292..1029767)
                     /locus_tag="CNE03620"
                     /db_xref="GeneID:3257877"
     mRNA            complement(join(1024292..1025398,1025463..1025939,
                     1025995..1026132,1026187..1026305,1026355..1026993,
                     1027047..1027191,1027244..1027365,1027421..1027574,
                     1027626..1028062,1028111..1028290,1028340..1028584,
                     1028630..1028829,1028875..1028984,1029036..1029339,
                     1029387..1029396,1029454..1029536,1029595..1029605,
                     1029657..1029767))
                     /locus_tag="CNE03620"
                     /product="Exonuclease II, putative"
                     /transcript_id="XM_024657257.1"
                     /db_xref="GeneID:3257877"
     CDS             complement(join(1024355..1025398,1025463..1025939,
                     1025995..1026132,1026187..1026305,1026355..1026993,
                     1027047..1027191,1027244..1027365,1027421..1027574,
                     1027626..1028062,1028111..1028290,1028340..1028584,
                     1028630..1028829,1028875..1028984,1029036..1029339,
                     1029387..1029396,1029454..1029536,1029595..1029605,
                     1029657..1029660))
                     /locus_tag="CNE03620"
                     /codon_start=1
                     /product="Exonuclease II, putative"
                     /protein_id="XP_024512894.1"
                     /db_xref="GeneID:3257877"
                     /translation="MGIPKFFRWISERYPLTSQLITPNSIPTFDNLYLDMNGIIHNCS
                     HPPSTENDPHFRITEEQMILAIFAYIDHLFTKIKPQKVFFMAIDGVAPRAKMNQQRSR
                     RFRAGKDARDQREKAEKNGEKLPDEKAFDSNAITPGTPFMARLSQHLKYYVRKRISED
                     ADWRSIRVILSGHDVPGEGEHKIQEFIRLNKAQPDYNPNTRHCLYGLDADLIMLGLLS
                     HDPHFCLLREEVTFGRKSRQNTELANTNFFLLHLSLMREYLDLEFSSLQTQISFEYDL
                     ERIIDDFILMAIFVGNDFLPHLPDLHINEGALERIWGMYKDILPTIDGYINEHGTISL
                     PRLQLLLDKLAEFEVKRFEDDLLDQVHFSGNHTRDTMVIEKARKKNRKVITKYQQKVL
                     NQLRSFIEKQQNQPNPTHRLELINTQDKRDNAFVQELADELHLHTTWDEVDDYGQSLI
                     VCTFNMEGVSQDGSADGKEEDGDWESDEMEDEGKLAVQRVFRNWSKAAVVDTYPEDVE
                     KSMDEKLKEAMDDIKRQYYHDKLEINYNDPAQMQDLVHHYIEGLQWILNYYYKGVSSW
                     GWFYKYHYSPRITDLKGVADMKFEFDYGKPFTPFQQLMGVLPVDSMDHVPLAYRDLMY
                     EETSPIIDFYPRNFELDMNGKKQDWEAVVKIPFIDQNRLLKAMAARDVRLTPEERERN
                     KSGVLSTQFVYDPEIDENYPSSFPGVFPELTRSHCRASPFNLPVLGGDVQLIFGLVEG
                     VQLGVSALAGFPSLDTLPHNGTLDYHGVNVFQSDSKNPSMVITIIGKDELPKTSEIAR
                     NVLGQRTFHSWPYLQEGIVAAVSDDMFKYTLQQVGKSLRVVHMPHQDAVKWRRQADHV
                     ERHYSRRYGVIIGGVEVLLHIRPLKGLKHLDNGALVKDYETPEKEIVQAYQVAVSQVT
                     FEDERFLERAPPDLKVDFPVGEKVLFLGDMHYGLAAQVSAVNEEAQTLSVILAYFEEE
                     TEETLRFMKAVAHRPAGKWWPSPILSRRLGISALALSRITSTLLVQLGDGSKTNIGLS
                     LKFESRGLKVLGYSKRNDRGWEFSEKTAQVLEAYKKAFPEVFKHLENRGGDLVKSKEL
                     CPTAEDPDTVIKGMKKWLKDEGLNDLESVSLFADQLEAETCQIVEKLADDILSKKTFQ
                     SIKKKRLDNVPRQTLLKPAQAIYRLQGQVFEPGHRVVMVQDPAAGGVPTGMRGVVVGL
                     GMRTVDVIWDNGFMGGSTLQGKCSPYRGSTVPFSSCLNLTRPQFTVSERAGPKPVPQN
                     VFRPQLGPRPAVPMQHYQPSVPGRQQTATTTHHILQKPKTVHSTQSTTVVGSNGHLKY
                     SGVAKGVRPQPVQQQPVSHRDQLSNLLGGLRLGPGPVVNDNRDSSHVTHVQAQGNLPV
                     VHSHASVHQAIPTNPPIRGKAQNMNNKSGIGAVRGRGAANGAPFAHRGTHNGVPASAR
                     GGAPNGGPRGRGGFRGGSRGFTRGRGVGSGGSAVVEE"
     gene            1029984..1032524
                     /locus_tag="CNE03630"
                     /db_xref="GeneID:3257839"
     mRNA            join(1029984..1030132,1030197..1030295,1030347..1030517,
                     1030575..1030693,1030751..1030943,1030994..1031271,
                     1031323..1031436,1031489..1031800,1031850..1032220,
                     1032274..1032524)
                     /locus_tag="CNE03630"
                     /product="Signal recognition particle 54 kDa protein,
                     putative"
                     /transcript_id="XM_570933.2"
                     /db_xref="GeneID:3257839"
     CDS             join(1030055..1030132,1030197..1030295,1030347..1030517,
                     1030575..1030693,1030751..1030943,1030994..1031271,
                     1031323..1031436,1031489..1031800,1031850..1032220,
                     1032274..1032314)
                     /locus_tag="CNE03630"
                     /codon_start=1
                     /product="Signal recognition particle 54 kDa protein,
                     putative"
                     /protein_id="XP_570933.1"
                     /db_xref="GeneID:3257839"
                     /translation="MVLADLGTRLHGAWNQLSKASVIDDKVIDGVLKELCAALLESDV
                     NVKLVASLRTKVKTKVKKSLEESEKAGGREANKKNVVQKAVFDELVALVDPGTEPYKP
                     VKGKTNVLMAVGIQGAGKTTTCTKLAVHYQRRGFRTCLVCADTFRAGAFDQLKQNATK
                     AKIPFYGSYTETDPVAIASLGVEKFRKERFDVIIVDTSGRHKQESELFEEMVAIGAAV
                     KPDMTLMVLDASIGQAAEGQSRAFKDSADFGAIIVTKLDGHAKGGGAISAVAATKTPI
                     IFLGTGEHLNDLERFAPQPFISKLLGMGDMQGLVEHMQDMARANPDRQKDLAKKLEQG
                     KFTIRDWREQLSNIMNMGSISKIASMIPGLPAGIMDGNEEEASAKLKRLIFITDAMRA
                     DELDSDGSIFVSYDKQGNPVGLNKRAKRVAKGSGTSLRELEDLLVQARMMAGMAKQAG
                     GQNGWMSAMQKMQAAAGGKPLGPNGQPSPAQIEAMRKAMPPELVRKLRAAGPQGAQKM
                     MQDMMGGMGGMPGMGGAGGPGGMDLGNMMRMLGGGGGGGGGGGGMPDMSQMQEMMKNM
                     GMGGGGGMGGMPDMSQLMKMMGGSG"
     gene            complement(1032493..1033518)
                     /locus_tag="CNE03640"
                     /db_xref="GeneID:3257717"
     mRNA            complement(join(1032493..1032842,1032892..1033102,
                     1033149..1033518))
                     /locus_tag="CNE03640"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_570935.2"
                     /db_xref="GeneID:3257717"
     CDS             complement(join(1032552..1032842,1032892..1033102,
                     1033149..1033474))
                     /locus_tag="CNE03640"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_570935.1"
                     /db_xref="GeneID:3257717"
                     /translation="MSRPSSTSTHVAVVPTVPQVLHILANPPPTLIDAQLPGYLLPPT
                     FNLLRESSAHVVRKKKREEDELRNEGLLPPLNEKDVKDESRLIEEELSKRIVRIGLMV
                     GGFIAEKLTLARPPISAHLDIIKFICKDLFLYVYSKQIDNLRTNHRGVYVLQSNAFPP
                     LVPLSSYKGSAADMDAANTHLIFPQALIQGALHRLGMNAVVSAESSSLPQCTFQIRTL
                     KPSNIPSTPMSGTPNPQPTTQRQAPVSVSAGGYGQAAPGSPAMNVTGSSTTGLGINQ"
     gene            1033714..1039949
                     /locus_tag="CNE03650"
                     /db_xref="GeneID:3257900"
     mRNA            join(1033714..1034245,1034295..1034820,1034870..1035305,
                     1035355..1036290,1036337..1039406,1039459..1039587,
                     1039637..1039949)
                     /locus_tag="CNE03650"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_024657258.1"
                     /db_xref="GeneID:3257900"
     CDS             join(1033833..1034245,1034295..1034820,1034870..1035305,
                     1035355..1036290,1036337..1039406,1039459..1039587,
                     1039637..1039775)
                     /locus_tag="CNE03650"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_024512895.1"
                     /db_xref="GeneID:3257900"
                     /translation="MPLNPFSRSANNPSRNERRDPHRGLSDLLNSAHLQHGARWSNNV
                     KASILRQLWQTVWQDPQWIQYFVPEGTHVPVYDNLWEWLVDTPDGPSKPWTLSEKQAQ
                     IEEERKSEGKKPIWTRRKGQICGKVMQRHDRTYTCKTCAITPSVSLCVDCFRASDHQG
                     HEVLFGQSFSFSASCDCGDPTAWKDDSHLGCTHHPRLPPGSPPPSFPDKFDLPDSLVI
                     SLQKTIAMCIEFIIHTIEHSHLPSEYGLLPKTETEMHSSDGPTGEPKDKRGTGPWAVV
                     LWQDDRHVLKELARQVRDGLGVKWEVAEQWVREAITVGRKIILVSPNPVIAFHAANML
                     QQIDAPVTLRPAADVFREEIVATLMDWLYDIQGSLIGGDDRLPKRLIFNALFEKRMLP
                     PGGHGTPLANDLSDLANGKMLGATQVVKRMDWLLQLDSRLWKKAKWQLRQIYCSVFLS
                     DVEARKAFASSFAFNYPRLAEHFLFQDREFDANIIFSSAYLVFTNGPATAHASAHANL
                     LTNVVQVAHAWYTGQVVTNEGCDRLVIPPVAFDPNDSTSQGRLDLDAHAFSGKKGLAI
                     LGHLRSMFRHEEMKKLVVKQNQLFGRVLGFINMFVGIQPQRRERGGHIEYEVEWLKSF
                     TVLGDLARICRDLGEVFSVASADALLQNMSLVANRIFCDMFLISNTLDKDRYTPLTEY
                     TINDVLVLGTSVTVIKQDVTTIEAFSFHHYLNLLFAGMLKCMRTGIPWENGKVNGMDF
                     NRIVEKFVLGSNDEQAMERMKLMLIEWPLQKHVVFAQLRANMWKKNGSALRLQHHHYC
                     DVSVRESTIDQEFFLLQFGLCILDPFTFIVALIDRFGLTKMFQGNVEKALLWYGEDPD
                     PRQIINLMEDLLLLIIHLVSYPAIINGWDRKTITRKLIIHLLAVQPMTYSELFKKLPE
                     RSQEISCTPILAEVANFRQPTETTSGQYSLKDEVYDEVDVHWRYYTRNDQRSVMDKLV
                     ARAKKNKPSNEEPLILPRPLEFPSTDSPFSGVSHFLHTHVVADLVHWALAHCMHIATP
                     DKWAEIVQQAYPQEYSNTPLIPSWDFVLDYTLHLAMIALGVAPQEFAQQSVFLKGVEG
                     SNSTFQNLWVMQSDPAFKAFKPRVDYVLDTIVANLPPHYTADYRAHKESENMLALSSL
                     AKPDPKAAAAARQKAIMAEFAKQQQDFVAMMEDMDDEDEDILVDEQKEEEESYGNCIV
                     CQEEVTAKNAGGMLTLLQPSRQLRDVVNTRDWFEESLLAPTSMDRPGRYQRYSYDPKH
                     PEPVGTQGYPCTNLRFGIHMSACGHYMHDTCMNSHFETTKIRHTQQVQRHHPENAVRL
                     EYMCPLCKSLGNVLIPVEPSHIAKKPAVSAKKDEDKPPSLSVMIRRVSSEGLLRVADS
                     QRIWEHHVETGEVVPWFSDCVFSLHSLDHNHRRGAMRVISKMVDRMGGLVRPLSEQSQ
                     RIRGKKTHMYLPDDMVAYTVSMAEITQRGLKTNSAEALTVAEQINETTLKLVGKLIGL
                     LQLELDLYFGPTFDRTSLRVGIFARFLPDWYRSSTLPSPLLIRQPLGMVIECAAIAPD
                     LLQAVIVMAYYAELTRCMLALSLSVKRCLGPRTRPSPRTQPPEDPSLTDALTVFSGFR
                     PVMQSILRHAGPFADTDGVLALLTDDMLSKLLYSYTLPFLRRCAIIYYSVTGTYPITQ
                     PSALSTFTPATSEYNRLLTILGIPRPTETLANSSSTETPIVARWITQWALHGRVMPVL
                     EFPGTYELARLPEKWEELVLAYSDRKCGKCKTKPSYPAICLFCGTMVCLAGDCCAEGE
                     QGECNLHMRECGAVVGMFADIKRWNLLYLYAGSGSFGPMPYLDTHGELDISMRRGHRQ
                     IMHVGRMDELRRGTWLMHNIPHITARRLELTIDHGGWGCL"
     gene            1040137..1043155
                     /locus_tag="CNE03660"
                     /db_xref="GeneID:3257502"
     mRNA            join(1040137..1040318,1040392..1040424,1040473..1040522,
                     1040577..1040685,1040744..1040946,1040995..1041374,
                     1041432..1041461,1041513..1041602,1041662..1041735,
                     1041782..1041851,1041902..1042106,1042174..1042313,
                     1042366..1043155)
                     /locus_tag="CNE03660"
                     /product="eta DNA polymerase, putative"
                     /transcript_id="XM_024657259.1"
                     /db_xref="GeneID:3257502"
     CDS             join(1040260..1040318,1040392..1040424,1040473..1040522,
                     1040577..1040685,1040744..1040946,1040995..1041374,
                     1041432..1041461,1041513..1041602,1041662..1041735,
                     1041782..1041851,1041902..1042106,1042174..1042313,
                     1042366..1043070)
                     /locus_tag="CNE03660"
                     /codon_start=1
                     /product="eta DNA polymerase, putative"
                     /protein_id="XP_024512983.1"
                     /db_xref="GeneID:3257502"
                     /translation="MSISVGSSRKKEGRVVPTYRHLLSLQALTPANPLRTIAHCDIDA
                     AYAQFEQVRLGLPDDIPLICAQWQSIIAVNYPARKYGIKRFTSIEDAKKMCPHLRIQH
                     VATYRNGESEAGYWDDVDPRTHKVSLDVYRRESLKILAIFKEKIPRGEIEKASIDEAF
                     LDLTPMVIERLLAAHPYLSKVPEDAPNGLDSPLPPPPPIDWSNAGSVFPIDGKEDGSG
                     TDHQEDKEEDERSEDGDEFDGRTSGSNRDSWEDWALCMGGELMSNVREEVYLRLHYTC
                     TAGIAHNKAMAKLCSAWKKPNNQTILRTAAVPAFLNGRDFTDIRSLGGKLGAAIAQQF
                     GAKTVGDMLTVSLDEMQRKFGEESIWVYNILRGIDHSEVTDRVATKSMLASKSIRPAV
                     TSPQQGHQWLSILAGELNVRLRQSREIMPGLWPKTLVLSYRQGIEPTRSRQIPFPFTR
                     NLSTDYIMKYAKKLWDEATQPMLKGNMKLNVIALSFTGLEKLEEGQQGIEGFFSNTKP
                     KAADESTIGPSSSTTMPRVISKLNNISKRTRSPSSDSSSTIPTAVEVLPSKKVRPMNQ
                     PLSKRKKGLDAFLIKKPSDVTSSSSHSNISTPSSASVSDLEITPIEPPQSSRISSHTK
                     TDMDSWTCPKCAQTFTVPDELDLGEEQVGLLRSMKQEHEDWHFAKSLQDGGDGNGGTS
                     APGQRRSNTTPSLGQKEKRNVEGIRAFFTPKPQ"
     gene            complement(1043086..1045525)
                     /locus_tag="CNE03670"
                     /db_xref="GeneID:3257504"
     mRNA            complement(join(1043086..1043398,1043462..1043513,
                     1043564..1044214,1044275..1044950,1045044..1045525))
                     /locus_tag="CNE03670"
                     /product="expressed protein"
                     /transcript_id="XM_024657260.1"
                     /db_xref="GeneID:3257504"
     CDS             complement(join(1043276..1043398,1043462..1043513,
                     1043564..1044214,1044275..1044950,1045044..1045311))
                     /locus_tag="CNE03670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512985.1"
                     /db_xref="GeneID:3257504"
                     /translation="MSLTLDVPPNRGIREKLEWELRDLRNFMLYLEYGIPFPQPSNSS
                     PEPSNRSNNDNFDEDNPYQIPSYERIASMGVFELAMYAAKYFLPKASSSPANEKAKQD
                     LYLQIWRRDELENLVDLTTPVHIFLGVTHCTPNAGHRYAQTRYVWSKTLEHNFHNESI
                     MHFVLPLLSILLEDAEIRRDDALKLCVYMEVAAPEKPRFSLPNDIARNTTKGLARLLD
                     KKSGDVRFLCLEHVYDQSQPSAAHDRAMEAESEEDVSSIVKRLRQSRKRILYAHSEIL
                     EEKSEYFKDLLTSGFSETQRYNTIIVDDASFSTLYWILHYLYTNELTFSEHEDYHYIN
                     DEHRLDNAHVDRILRPRTSTQNGLAEWNYQHLPLAGDWDTKVDPTSLQDEPLNVKSMP
                     SSKISPPLSIGVTNIPYPYGDKGTPQQPKRMKKDASSTSPSKIPTMAVPLNRTFATSN
                     NSKPHLVASHLSALGPPNNSFDAFARIGTENDPHPHPTPCPPPASALDVYMLAHRYRL
                     EELREMAMEQILRSLSYETCMSAAFVSYPYEELHSKVLAYIVKNWTQVKVSSAFLRCI
                     QEVREDVWGEYGPMVLHNIYLKI"
     gene            1045794..1047937
                     /locus_tag="CNE03680"
                     /db_xref="GeneID:3257751"
     mRNA            join(1045794..1046211,1046258..1046694,1046753..1046789,
                     1046845..1047345,1047399..1047937)
                     /locus_tag="CNE03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657261.1"
                     /db_xref="GeneID:3257751"
     CDS             join(1045900..1046211,1046258..1046694,1046753..1046789,
                     1046845..1047345,1047399..1047893)
                     /locus_tag="CNE03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512966.1"
                     /db_xref="GeneID:3257751"
                     /translation="MHSPPPNTPLTLRAILLTSSSPLSEPNLPSIRFRITPHFLVPDC
                     IISTLTDSYNIGHCVETIVPVGGQVEVGLTVDEESLAECGILVEGPSSRVIRGVIESF
                     RLNAQSLSLSTIAPIAQSRHDSSTFLLTPLSSTPSNNLLLTHMIPTGHPICYLKRFDV
                     HCSWTMTRTGGALKRLPEDDENEDGQAQEDIIDDLMIPNHYDFAVPHQMGSNEEDGGR
                     VELLLEDQHPRNWLDDQIRNACQKLLLKHFLRRFPLIFDGRFTETLPKYIVPSQLISS
                     VSHFARLSIAYDTPLSQKFGEIMEKVTRQQQEFLSFKVDQTVNLPARKDRKLEAARKR
                     QKRLKQVTQGKNQLDDTQQEKEQPDENDATVEINRRKQRYLEQVKASTDASDKYGMRC
                     KERRISRIIGDAIGLICRSDFEMKRNRSGRLSAAGTKFRYPTEDDAHQIPPTSDTQLF
                     LTSRTNPNTASDTSRDESSIEDTLAGSMSYEILVDGQEERRPMPGGNEESFGEQRKDE
                     DEDVDGEFIMDYDLNDDQEDDDLLPIELWPLEEQPETRVVQYDNRSKKPVAMLRVERF
                     EDDITVGDGDNNGMDFEGLELEATFVG"
     gene            complement(1048066..1048157)
                     /locus_tag="CNE03690"
                     /db_xref="GeneID:3257494"
     tRNA            complement(1048066..1048157)
                     /locus_tag="CNE03690"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:3257494"
     gene            1048308..1053743
                     /locus_tag="CNE03700"
                     /db_xref="GeneID:3257643"
     mRNA            join(1048308..1048523,1048917..1049836,1049891..1052479,
                     1052532..1052677,1052728..1053743)
                     /locus_tag="CNE03700"
                     /product="glucoamylase s1/s2 precursor, putative"
                     /transcript_id="XM_024657262.1"
                     /db_xref="GeneID:3257643"
     CDS             join(1048958..1049836,1049891..1052479,1052532..1052677,
                     1052728..1053526)
                     /locus_tag="CNE03700"
                     /codon_start=1
                     /product="glucoamylase s1/s2 precursor, putative"
                     /protein_id="XP_024512896.1"
                     /db_xref="GeneID:3257643"
                     /translation="MGILTRIRRRSSSAAQTQRPSSASPLASHLVPSATSGTATVAPD
                     PPSTGSVGSRIPKRPWKKKHDEGSSTGSLNKNGKGKTKAENGELLGGPKYGDFSPSLG
                     PASSLSVSNVPTTRVNGPSSQSSLSPPGNGSPAGDSNSVPCSSEKVEKRRPDVSEIKR
                     PTSRTFKQDGGILGKLNFEVAGDRQRKTSNSSWTKGVESIVSSGSPSEWPNASMSNAN
                     LPSESNPVVTSSSRALTPDLNDDQRPAPTLSRGNKREEDPIEVLESAEKKHRFWKGKG
                     KSNRHSRVMSDSFQLGGSEPPTPGKIPSSSSGPDLASVSRNSVDLDQPHPQQLRRPSS
                     SFFPNPFYRSLSRASERPSAVEDGSFQLKSFRHVSGMSDVEGAGKLEGYLSHVKRESV
                     AALSIELPAASTAPDSSLTFASPKPTAVPLSRPVSVAPSLASMEDMMVSPNRVSVAAF
                     KKGLRRPSNGLMSTMSDIGHGTPATGSGDEDDDIPLGKRIVSQPLPRQTSSQSLFNMR
                     DPGLSNSEGATSNPMLKQPKKETSEKEVSSQEPLVFQVKAYRRTSSGFVVKSRSPMAS
                     NQDLPSSPVSSLNSLATGFPGSLRPTALTSSASTRTPSPNAGVTNLYGASPPTTDDKE
                     LMTDGYFSAGAPSSDRVVQKGQKPSSPVTYQPTEELAKAALPSPPATAQQPSVAPIAE
                     LSANVQSSNSHLKRHTPPPVQHIDVPRPSHDISPTLLALNLPLPPDQMPDTPPKAPSP
                     LSELPRRPTAGPEGSASPGTQSKRMSLLEEPIKYLSGLWATPSAGEDGFDPVLAVDSL
                     GRLSGDEPQSPTKSNRPGITSWYAPQDLPERQTSASPSPFSSTERIRSSLSERLAGVA
                     TSAISTTKPGRGLQKPAMEKLKTSAEEQCPADNHKSPVSDSTVAPIPRSIPRPFSSFI
                     KPGPVQPNPAIDENESDTEGGTSMSTHHCERLRASSLSSQQSVRRVPGGPRQPVRQSR
                     IVSMPITNSHLVHKSPDRWRHVQKDDDEDEPLAKIKHRSSKSSLAMATAGKSPSYGQI
                     SLPTPPTSVTSTSIGSSSPQERRKPLIELESAAPATPQSMTTPRPHDSLLPASSRSFD
                     KSSTTSTGSTPSSGKESLPSPVRAQVRFDNPERKWPSGFQKKRTSPEISKDNVNDNAV
                     EVYGERQRRQAEKYSGDSRQRRRSEGALQHPSPYDPPVQAQMGMQEVPDPQDMSPEAF
                     FAWQKHQWQMQYLAAAYRASEEEWEKQSSVSTSIHNQPSNQFIPFPMQPMSMFPSNAN
                     MMDMGMGMPMGYGYSAYPQLQGHMFNSYLNMPQMQGQADGEGGCSYGMGAQSVFGGEF
                     RPLAAKPSQQQQYNPNPQRRASSDQQGAQYGNPPQPHRHQDDPRLAEGRSASALGMYD
                     NATSPPTMSKRPSGVFRGLLGEREKVELQQEMERQAQEKLEKQKQWAKERARGKTTES
                     SSPPPPSSWSRMTGDWSEGGAPRRQNRSRSNIAN"
     gene            complement(1053710..1056589)
                     /locus_tag="CNE03710"
                     /db_xref="GeneID:3257686"
     mRNA            complement(join(1053710..1054948,1054996..1055730,
                     1055781..1055901,1055954..1056052,1056111..1056283,
                     1056335..1056589))
                     /locus_tag="CNE03710"
                     /product="vacuolar protein sorting-associated protein
                     vps27, putative"
                     /transcript_id="XM_570941.2"
                     /db_xref="GeneID:3257686"
     CDS             complement(join(1053876..1054948,1054996..1055730,
                     1055781..1055901,1055954..1056052,1056111..1056283,
                     1056335..1056386))
                     /locus_tag="CNE03710"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     vps27, putative"
                     /protein_id="XP_570941.1"
                     /db_xref="GeneID:3257686"
                     /translation="MSWLWGSTTNPQFEELAEKACSPLNLPYPQSEDIATALEVADMI
                     RSKAIQPKMAMQSLKKRIASKNGRVQMYAIGLTDTCIKNGGDHFLLEVASKEFVDELS
                     NLIKATTTSPEVKQMLIKYFQQWALAFKSKSELSFFVEVYNELRASGITFPPPPAPVP
                     SHLLTTTTAPAWVDSDACMRCRSAFTFTNRKHHCRNCGLVFDQACSSHSMPLPKYGIT
                     EEVRVCDGCWAKAGRNKADAPAPAVPGRTPRSRADLDADLQRAIELSLAESQHSQNRH
                     HSHFTPSEPPLAHGTVEDEDEQMRLAIEASLRDMEARPSAPAGLGEAPEPEYRPLPTF
                     DLSPRENETILTFSNTMDQMAAYGERDLRRFPHAHVLAEQANTVGGRLRRNVEEKSTK
                     QQMLMEMQDKLSQAVNLYGQILDGQQAYAAKRAHEEQARRYQQQQSYYTQQYQPQPQL
                     YGQYPPNGYQAFVPPQQAYQPPQPQPEAQAQHAPSLYPTMPYTTPNFTSPPQERVYPQ
                     QSHSSPYSQWSPAPSHVQPGLARQASVVVPPVSSPVPAGVQRQASMTYGAPIPVAEQS
                     QRQQQQYASAPPFASGAAPVDIPSAPPPVNLSTHPNSPQRHSYIPSHPQTQTQTQYES
                     QPQEIPSQQDMQYGASAPPPDSLGSYVSEGTVGSAKSGLEQEHAASQIQPQPQPQASA
                     QTQTQSQSQLQAQPQQNQYAAQTQLPAGMYNAASFPQPLPPTIFPDAPVEAPKGLEKE
                     EKEEALLIEL"
     gene            1056820..1063568
                     /locus_tag="CNE03720"
                     /db_xref="GeneID:3257911"
     mRNA            join(1056820..1057259,1057332..1057425,1057487..1057659,
                     1057720..1057986,1058038..1058605,1058661..1058841,
                     1058897..1058976,1059028..1059049,1059099..1059146,
                     1059198..1059258,1059308..1060423,1060472..1062885,
                     1062939..1063043,1063094..1063568)
                     /locus_tag="CNE03720"
                     /product="DNA-directed RNA polymerase ii largest subunit,
                     putative"
                     /transcript_id="XM_570943.2"
                     /db_xref="GeneID:3257911"
     CDS             join(1057176..1057259,1057332..1057425,1057487..1057659,
                     1057720..1057986,1058038..1058605,1058661..1058841,
                     1058897..1058976,1059028..1059049,1059099..1059146,
                     1059198..1059258,1059308..1060423,1060472..1062885,
                     1062939..1063043,1063094..1063241)
                     /locus_tag="CNE03720"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase ii largest subunit,
                     putative"
                     /protein_id="XP_570943.1"
                     /db_xref="GeneID:3257911"
                     /translation="MTVTFPYSSAPVKQVKEIQFGIMSPEEIKAFSVAKIESTEVLDE
                     NGKQKVGGLMDPKMGTIDRNFKCQTCLEGMSECPGHFGHIELARPVFHQGFIVKVKKI
                     LECVCYSCGKLKVDMRDPMVANAVRRIKAQHRLKAIWALAKDKKHCEPDELDEKDNGD
                     ATFEDEYLQEQKAAMKGHGGCGHEQPVWRKKGLKLMGVWKPTDKGEDEAAEPEERNIS
                     PGEVYNILKKITPEDLHIMGLNADYARPDWMILTVLPVPPAAVRPSIAVDGGAMRSED
                     DLTYKLSQIIKFNGVVRRMEAEGVPPSVVNEQFDLLQYHVCTYMDNDIAGLPRDQQKG
                     GRAIKAIRARLKGKEGRMRGNLMGKRVDFSARTVITGDPNLQLDQVGVPKSIAMTLTY
                     PERVTPYNIVYLQTLVNNGPATYPGARYYVKDTGERVDLKYRKSGEPISLQFGWIVER
                     HLKDGDYVLFNRQPSLHKMSMMSHRVKLMNYSTFRLNLSVTSPYNADFDGDEMNLHVP
                     QSEETRAELSQIAWVPRQIVSPQANKPVMGIVQDTLCGIRKFTLRDNFLDWLQVQHIL
                     LWLPEWDGTIPPPAIFKPKPMWTGKQLLSMTIPKGINITYKNNEKPSPIDVTDENVLI
                     ENGELVHGTIVKNMAGSANNGLVHVIFRELGHIAARDFFSAVQRVVNYWLLHFGFSVG
                     IGDTIVDKATMAGITNRMVEAKEAVQKLIQEAEANRMKPKPGMTIRETLEASIAAELN
                     KARDWTGKTTQDNLKADNNVKQMVVSGAKGSFINISQMSGVVGQQFVEGKRISFGFRH
                     RSLPHFSRDDYGPESRGFVENSYLRGLTPQEFWFHAMGGREGLIDTAVKTAETGYIQR
                     RLVKAMEDLKVAYDGTVRNSVNEVVQFLYGEDGMDGAAMEKQSLDIIRLSDQAFERRY
                     KIDVLGGSGFSKGILQAGIDQSSISLQKLLDEEFAQISEDRRILRSEIYPDGTPGHPL
                     PVNIQRVIQNSQQIFHIDPRVPSDLDPVYLLEQRDALADRLLVVRGDDKLSRAAQKNA
                     TLVFNMLLRSHLATRRVLEEYHLNREAFDWVIGEVEQIFNKAVVNAAEMVGTLAAQSI
                     GEPATQMTLNTFHYAGVASKSVTGGVPRLKEIINVAVNIRTPALNVYLEPEYSKTEED
                     AHQIMRKLTYTRLRDITATVEIFYDPKLDSTDIEEDKDFVDAFFAIPDEDIRLELHSP
                     WLLRLELDRAKVLEGGYEMSQIVDAIAETVGKDVFVIHSEDNAPKLVIRIRVVAEKED
                     EELLGDEDMFLKRIEGTLLDQVELGGITGITRVFISEGKQVVVSQNGEYDQEKEWFLE
                     TDGINLKEVMAVDGVNAFRTYSNNCYEVYETLGIEAARNALYKELNGVIEMGGSYVNY
                     RHLALLCDLMCSKGALMSITRHGINRTDAGALSRAAFEETVEILLEAAAVGDVDDCKG
                     VAENVLLGQMAPMGTGAFDVSLDMNMLKDVIVDHRLPVQNMMAGGMAGGMTPGGAMTP
                     YDNLSPMWGGDKGALGHAAFSPIQSSANDEGGNFAYMGYGQSPMHGGMSPAGYSPSSP
                     AGYSPTSPFAVTSPAYSPTSPFAGAAAGAASPWVGRGGYGATSPAYSPTSPQYSPTSP
                     QFSPTSPSFSPSSPTYSPASPAYGGAGAGNRASPYSPTSPAYSPTSPMGGITSPQYSP
                     TSPRYSPTSPAFSPTSPSYSPTSPAPFQATSPRYSPTSPQFSPTSPTYSPASPAYSPT
                     SPQYSPTSPAYSPTSPAYSPTSPAYGGAAPNGGTAQQQNGQARPGWGNTGGYGTSPSW
                     KS"
     gene            complement(1063502..1067109)
                     /locus_tag="CNE03730"
                     /db_xref="GeneID:3258002"
     mRNA            complement(join(1063502..1063879,1063949..1064070,
                     1064132..1064239,1064320..1066457,1066504..1066876,
                     1066945..1067109))
                     /locus_tag="CNE03730"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_570945.2"
                     /db_xref="GeneID:3258002"
     CDS             complement(join(1063866..1063879,1063949..1064070,
                     1064132..1064239,1064320..1066457,1066504..1066872))
                     /locus_tag="CNE03730"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_570945.1"
                     /db_xref="GeneID:3258002"
                     /translation="MAASLPQDAPNPNAPTFRPSPTRAITLGGTPFQYKTRAASQPAG
                     ERFQIPFSTPSSGRGSPGTNGNHSGNGHGNANGNTNGNSYGVIGGTRAGGRFGNALAS
                     GGMGAATRASSFSAGERHEPRNMSLGGTLASHTEEFLPSRSRSTSPFPTFSPNSTPST
                     SPAALRQHPLPHSPPRATNSVSRSRSQSLATGVRPSNVDRPWMGPLSKADMGNLDAWK
                     SSEPSNMSPFTRGLSSLGGGGNTLPEHPRRFQDPTYTSARAAWADTHSQSTQSALTSS
                     VAKALGGYPHSAGLGYNDLSPGAGGGNLSGTSSRRHSVSVVGGPGGRRELVFAEGGGM
                     TPLGSAGLGGFSPRGGLFGFETDLGNALSLDIDLGREAKKREEAFHHGSLPKFEFEGM
                     PGSRGAWDEGAFPSFGTPSRGRVALPSGGNQPQSQHFQIQQEQRAPSTEESRRFPQPS
                     FDMPPPPSAIRRSSIQAAGPSPMSQGPLGPVGTGMPRNIPTISNISMGPGPIGSPPTH
                     SNLGMPPSFGGPFNGGNAPTRQPYQNTAPGGMQQGFRPQYGYFSGQQQQQQQQQQQQP
                     QVRPGQMPQQSGGGYNKPMNIQPPPNQPYTFSPSSSPAFTQPPPPLSSQPAPATHPPA
                     SPSFSSLSLSDLGKGLPLSSLPPATPLYIVTFKAGRRDVYYCPDPTLLISNGDLVIVE
                     ADRGSDLGTIVCDQLTPVEIREWQERQATKALLSGAREHQPPGMAVGAAGGGGAGAQA
                     DSASAGGILGHTRNPSASAGPGQPQQQHAQQQQTQSPQPFLQGMELASLDIDSLLAGV
                     GPGGQMEVVGTAVRGPLAKEIMPKRIFAKSSQGAEEQQRMREKIQDEYDAMMICREKV
                     AQRGLPMQIVDAEYQWDRRKLTFYFKADKRVDFRDLTKENFRIFKSRIWMSMVSKDDP
                     RS"
     gene            1067442..1071559
                     /locus_tag="CNE03740"
                     /db_xref="GeneID:3257646"
     mRNA            join(1067442..1067612,1067749..1067870,1068065..1069599,
                     1069678..1070707,1070794..1071559)
                     /locus_tag="CNE03740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570947.2"
                     /db_xref="GeneID:3257646"
     CDS             join(1067520..1067612,1067749..1067870,1068065..1069599,
                     1069678..1070707,1070794..1071322)
                     /locus_tag="CNE03740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570947.1"
                     /db_xref="GeneID:3257646"
                     /translation="MFVIKATLKDETRRLTFDTSHFPRYYEVQQKLRTIFNLPSTCHP
                     FWVNVLLFPDDSRDARIMFKKHVCDAEEYESAQAPFLHIIGISPALKFTILLTSDPRL
                     DSIHGYHRANKLLSSANHLNIRLANLEERLGEESALLNSLEDKANERVKDGDDLANAF
                     WTSRADEKRASIKELQNAVDACKEQLKSLNEQLDGGLPENYTHQTLRDYAAFENREEA
                     VRAQQTEDELSAWRTSQEMDRPPFPPLESIIHNSGWGQTRGWPYHHPGVHARAMPPLP
                     PAAFGPNRFPVPPHPAMFSSPFPPSPPHAQPPPPPGHMHTHGRGHHHDRRLRSVLDSV
                     SEMLNPNNPNGFVPAHEIKSMLDGFLLNLTNQLAATFEGSTRMSSPADENEPRVPGAF
                     VETQSAQSVQSAQSAQSAQSAQSAQSDAQIQTQPETVVAPASKLGKGGFRHRHIWCDG
                     CEKEIRGMRYKCEHCPDYDLCGSCLPLLNTSALHPTSHTFKAMLHRDLKERINLSDEF
                     SVHNATCDVCQLHIAGVRWKCLNCPDWDACSSCAAGLDQSHPGHSFVKLYRSSDYVVS
                     AALEEKEAIAHPHVTCDGCNTRIYGTRYKCMHPSCPDYDLCENCEAAPNTIHPNNHPM
                     LKIKTPLRVNFKSSYSQKSRSFRGPGFGFGVAEAADQDKLTGELSVRPSRHGHHHHHR
                     NKQDKAAHAHGDAFGKRKGGGWCQHKEASPSPALAKYVSEIFIPANEVEDVQDVQQAQ
                     QAQQVKGKGKEKEMESEPVTPKAENKEFILPASAAAASAEATPVSIADDPAPAPADKS
                     SPPAKEPVGPLDIFSFVRHVTIPPGTSLPAGTVFTKIWKYTHFASGSEYPFSTVRLVR
                     QTDDDGSLGGIQIEGSEVKVEFKVDDVKEGEEGEVRIEGLKVPDKKGEEVREAWRFVD
                     ENGVEYGQPFRLRITVSEDLVQSKNLSASSLLMPLSDHHNPTTPGSSGYVSAYSRDGK
                     QGDGEAAPCGTLIYHYAQQVQQTKPEASPSVTPCAASTTASSYASPLSGITSLPSTAT
                     ADDDDDDDDNLSIISYNSYVDVDGVRTSTTASSSSVAGARREEEEGEEVQLGSEDDYE
                     VVEGSEDDSTADEL"
     gene            complement(1071597..1073137)
                     /locus_tag="CNE03750"
                     /db_xref="GeneID:3257553"
     mRNA            complement(join(1071597..1071795,1071868..1072792,
                     1072901..1073137))
                     /locus_tag="CNE03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_570960.2"
                     /db_xref="GeneID:3257553"
     CDS             complement(join(1071740..1071795,1071868..1072792,
                     1072901..1073119))
                     /locus_tag="CNE03750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570960.2"
                     /db_xref="GeneID:3257553"
                     /translation="MSAQEHMPPPTLKRARPHSTNLSSSSATPTAQPPASSALAAPHT
                     TSRAKRRKPEPVGVEREREKEPESEVKVKIDFNDLPVETLYKYLEAHDLLPRWEPSPW
                     SEEPCIPRMPFFLSGHRAFEHALLTWSSCSPCKKANQLYTIPPAAPTPVPPASVFPTN
                     HDPSPPLERTPSMAPGAEEDVKPTMGTVGIGAEESAAADTGDAGGAADGTTFTSGEKT
                     DGAQQTNGAEEAHQSTNGQVEGGETTAAAPSGQGETTAEEPNGPTTSYDAPIVPVEPP
                     ISLDAPSHIPSTADAPPASPHSTPPPPTPPTTRSKTLPSRRPATPPPPSPPPPIRRGV
                     MTLSDVLAAKHVLAEKANAHWAKGLGGGQNKESETIVNFLYKMKVGPGRLLRVYNPMT
                     SAQPPWL"
     gene            1073265..1074410
                     /locus_tag="CNE03760"
                     /db_xref="GeneID:3257904"
     mRNA            join(1073265..1073361,1073410..1073477,1073530..1073598,
                     1073669..1073890,1073957..1073997,1074053..1074123,
                     1074177..1074271,1074328..1074410)
                     /locus_tag="CNE03760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657263.1"
                     /db_xref="GeneID:3257904"
     CDS             join(1073359..1073361,1073410..1073477,1073530..1073598,
                     1073669..1073890,1073957..1073997,1074053..1074123,
                     1074177..1074271,1074328..1074346)
                     /locus_tag="CNE03760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512902.1"
                     /db_xref="GeneID:3257904"
                     /translation="MGKATKTRKFAAVKRMIKPSDPRLKENVEKAAKKAEKEKAAEER
                     KAVAQVSSSLFLSHNTDLGPPYRILVDTNFINFSIQNKIELVQGMMDCLMAKCIPTIT
                     DCVLAELEKLGPKYRLALKIAKDPRFERLHCDHNGTYADDCLVQRVTVHKCYIVATCD
                     RDLRRRIRKVPGVPLMYVVKRRYQIERLPEGGASF"
     gene            complement(1074364..1078754)
                     /locus_tag="CNE03770"
                     /db_xref="GeneID:3257876"
     mRNA            complement(join(1074364..1074704,1074780..1074902,
                     1074981..1075381,1075448..1075550,1075613..1075819,
                     1075879..1076160,1076227..1076282,1076336..1076996,
                     1077048..1077235,1077286..1077295,1077351..1077622,
                     1077677..1077770,1077830..1078359,1078421..1078754))
                     /locus_tag="CNE03770"
                     /product="actin cytoskeleton organization and
                     biogenesis-related protein, putative"
                     /transcript_id="XM_024657264.1"
                     /db_xref="GeneID:3257876"
     CDS             complement(join(1074552..1074704,1074780..1074902,
                     1074981..1075381,1075448..1075550,1075613..1075819,
                     1075879..1076160,1076227..1076282,1076336..1076996,
                     1077048..1077235,1077286..1077295,1077351..1077622,
                     1077677..1077770,1077830..1078359,1078421..1078694))
                     /locus_tag="CNE03770"
                     /codon_start=1
                     /product="actin cytoskeleton organization and
                     biogenesis-related protein, putative"
                     /protein_id="XP_024512903.1"
                     /db_xref="GeneID:3257876"
                     /translation="MSMLPPKSPSVKRFTQNAEKRSTSPSPSSLLMNLNTPSLAAPKQ
                     PKVVLGVCAMDVKARSKAMREILTRLVDIEKGGLEVKIFGDVVILEEDISHWPPVDVL
                     ISFFSTDFPLPKAISYTQLPNRPPPISINSLSMQSLLWDRRLVLAILDHIGVPTPSRA
                     EISRDGGPRIPRSLRRQVRRELGLVLPGPKAKDEDEWGEAIIPEKWRGKQRKDPVPKA
                     TEVILREDGDAILIGDKVIEKPFVEKPVDGENHNVFIYYKGGGGRRLFRKVGNKSSEY
                     DPNLYHPRTIGSFIYEEFINVDNAEDIKVYTVGSKFSHAETRKSPVVDGLVRRNADGK
                     ETRFITPLSEAENQYARDVVEAFGQRVCGFDLLRCEGGSRSMVIDVNGWSFVKGNQAY
                     YDKAAEILSGVCQIARERKVQGIQAGLASTATIDDPSGGSTTSTLRATVTVLRHADRT
                     PKMKLKFSFPAHEAWSRPFLRLLRGHREEIILRDTRQLQYILAAAEESSQTPGITEEQ
                     LIKLSQIKEALGKKMSFPGTKAQLKPSFAKKKGDKNEKKDKKKKDEDKEDEGDITETE
                     GRKKVNDWLRKGESAQAATADSTLLTEPPMSATDSIDAMPRSGTPCNPEPETDQNEMA
                     QGKHAGCVSDPDIPEGLEKMQLVVKWGGESTHSSRYQSRDLGDAFKKDIMIMNKDVLN
                     NVKIYTSSERRVINTAQIFAHALLGVEGGSSSSASSIANARNPPEQGPQISHLIQRRD
                     LLDDNNAAKDLCTDAKKKLKMLLRTGETERRPDLAWPKSFKKEPVEVVSDVIEQLTEL
                     RGIMRRNYENGNVEKIPQQRWCSGDSPWLFKERWEKIFDDWVGVKQEKFDPSRVSELY
                     DSIKYDSLHNRTFLFAVFDPEGKGQASKAGAPNQDRRLHDLFGRAKALFDLVAPQEYG
                     FDAEAKEEIGVLTSLPLLRKVWEDLDEAKTTGKSLACFYFTKESHITTFVHLLLASGL
                     PFTNVRIPELDYCSHCTIELWEKSTGSGQKDFSIRLSISEGAHSPAVLDSNVDARHSL
                     TVQPRKKLSSHIDYERARQCFSKHFNKGLSFSTTPLEGDEVYLKKSIEDESVLPLSSL
                     HHKAGDETPKMISSASSDRSHPGASDGGW"
     gene            complement(1079000..1081481)
                     /locus_tag="CNE03780"
                     /db_xref="GeneID:3257765"
     mRNA            complement(join(1079000..1079089,1079162..1079548,
                     1079605..1080063,1080208..1081481))
                     /locus_tag="CNE03780"
                     /product="expressed protein"
                     /transcript_id="XM_024657265.1"
                     /db_xref="GeneID:3257765"
     CDS             complement(join(1079271..1079548,1079605..1080063,
                     1080208..1080466))
                     /locus_tag="CNE03780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512984.1"
                     /db_xref="GeneID:3257765"
                     /translation="MSSSKRRPQNPSDAERGSPTTSSPSYLSSSSRAPGRKSDYFNYH
                     PPFSILLLEFIVWLLLFFVCFLSPNGGLAAVVKSDDEYVGVLRSCTKTSCDGWMQSSS
                     YTSSDTNSRRSFNSKRDLTSTIDLSNFFLTTGLAALSSFWLMTYTFLFTFYRFCSSTP
                     SNGARDGDDGEQEDEDMDEKGRRLTRWRRMKRSLKRFAFRVSRIYVFMLGWIVFGVAC
                     AASWQVKMTSSDGGSVGTGVLLLHASWILLFLCSFVEISRGNLRKRVDTGWGSCTCIP
                     FFGICKRRGFRKWGKSGDGGGEDKDVEKQGKRGRSRRRRDEENSRSQSQTANRKR"
     gene            1081635..1086175
                     /locus_tag="CNE03790"
                     /db_xref="GeneID:3257842"
     mRNA            join(1081635..1082911,1082962..1083832,1083893..1084025,
                     1084079..1084151,1084205..1084276,1084332..1084433,
                     1084490..1084564,1084618..1084762,1084820..1084971,
                     1085026..1085201,1085252..1085577,1085633..1085790,
                     1085846..1086175)
                     /locus_tag="CNE03790"
                     /product="voltage-gated chloride channel, putative"
                     /transcript_id="XM_570966.2"
                     /db_xref="GeneID:3257842"
     CDS             join(1081664..1082911,1082962..1083832,1083893..1084025,
                     1084079..1084151,1084205..1084276,1084332..1084433,
                     1084490..1084564,1084618..1084762,1084820..1084971,
                     1085026..1085201,1085252..1085577,1085633..1085790,
                     1085846..1086019)
                     /locus_tag="CNE03790"
                     /codon_start=1
                     /product="voltage-gated chloride channel, putative"
                     /protein_id="XP_570966.2"
                     /db_xref="GeneID:3257842"
                     /translation="MPEQRVPLSAAPMSIAPSSSTSTSASTVRPVRPASTASLRHPQQ
                     QQPRTQPPASGAGSVAQSRRQSVDTFMPESQPPSPITYFPNPSTFASGPNNNANSISS
                     PANSTSTSPTVSISHMASTDSDDPSAAQAVSTSSIARTPRLNPVATSNVIGLDIGAPS
                     PRVQASRGHGGHAQTSSGTTSSTSGSVSSIIDHQSRRRGSGRVFSTPGAGYSATHPNI
                     GLGLGPTPSRSGTGSTSTTINDAALSSPRRISTSRGLHVPPQTAAPPVGNLGLPTHEA
                     YYSVSQPASAATPRFRDKGIYASGGSGGLQHYSSSIAGYPSGSYGAIHQNQPSRDLAP
                     TSAMGTSMHSPFPSPEGSVLKRLKKKASNVGLGLGRPDNYDDEAVGRRGDEDELLEDN
                     EGERANGTRVWYSSFATIDWIHDAIKESSRVRRLRNAASRSLRGKIANTWDRFQGWLV
                     VTLTGIITALIAFLIIRAEMAFFDLKEGFCSTSWGTARRFCCAPRHQSPGSDGGEDEC
                     SDWIEWGQFFNPKEKDGPFGGWVYGGPEFMAYATVALLLAVTASCMTVYLSSSAHHTT
                     SKDSTFLTPPSKIPTAKQSTASSPTKRTASLPYGPHNECQPLLDSVANEPPTPLIESP
                     PETFRKVMFYAAGSGIPEIKTILSGFVIHGYLGGWTLLTKSAGLALSVGSGLSLGKEG
                     PLVHMSSCVGNIVSRMFLKFECNEAKRREVLSAACAAGVAVAFGAPVGGVLFSLEEVS
                     YYFPPKVMWRSFWCAAIAAITLKALNPFGNGSLVLFAVTYTKEYHYWEYIIFVVLGVF
                     GGLYGAVFARLNIIWSRHVRNGTWLRRHPIFEVVLVVLLTTIVSFSNPYTRMGGTEFV
                     ASLFEECNSSSSSSLCVNHPHELATVIWEVFMALIIKGCLTIITFGIKVPAGIFIPSL
                     AVGACFGRIVGHMMEYIEFTYPELSIFNVCKDTDCIVPGVYAMVGAAATLAGVTRTTV
                     SLAVIMFELTSTLNYVVPVMLSILIAKTVADGLEKKGIYDLVIDLNQLPYLDSKHEYL
                     WGSRRAYSVADRSVPHLRADKPHTVRSLTGKLLELVRLGMEDTGFPVLVKEMTSAGGP
                     GTSAGVGLEGGIGSGRERSCLRVVGFLGINELEHALSELADEPDAAINLIPDDASQAR
                     VRSSAMSIFSFADSFVDNVWNPCDLSRYIDQAPITVQIHSPLELVQQLFVKLGVRQVI
                     VVNSRGVFQGIITKKAWLNFLSELEEGTGH"
     gene            complement(1086156..1088215)
                     /locus_tag="CNE03800"
                     /db_xref="GeneID:3257790"
     mRNA            complement(join(1086156..1086365,1086419..1086655,
                     1086706..1087160,1087216..1087314,1087368..1087454,
                     1087499..1087637,1087696..1087766,1087818..1088024,
                     1088073..1088215))
                     /locus_tag="CNE03800"
                     /product="expressed protein"
                     /transcript_id="XM_570968.2"
                     /db_xref="GeneID:3257790"
     CDS             complement(join(1086187..1086365,1086419..1086655,
                     1086706..1087160,1087216..1087314,1087368..1087454,
                     1087499..1087637,1087696..1087766,1087818..1088024,
                     1088073..1088200))
                     /locus_tag="CNE03800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570968.1"
                     /db_xref="GeneID:3257790"
                     /translation="MEQLGALNPWSMTSAVESDERCLEGASNCEGIARYLAAHLSERS
                     YVLGGKKAEEFFQGLGRVWASLATSFDPSAKDTSRYASEDSRIQLALGLAKMERNLVA
                     GLLPFQIEAFKHEPEIRRFIFNITTFVRIEDCRFFTIHSIATQLLSNVLAPVDSSKAA
                     TRHADAALRIYVSGNREDDVIIRLLDSRDPKTNHATLHLLNNLTRNSLPRLELLLTPT
                     GMRWLAQLLGRMDEWLDKEHNCFDLATSIFTSIISFSLHPRLFQLLSEPPEPITPSQT
                     VFLKILDSTLSSLPTSSPTPPVENYPNSFLHPLFNSLIQSSLPSLAQKSDDPRLPKYL
                     EGLVLVSEALGTIGLRVQERIDKAAAPAADREDVELQMQGGEEQLIKATKEPLSGIVR
                     PLIDMLRALNDFFPRTNPRNPSPPTATTTIQPELKPFSNLKRDLVRLLGVLTFNDTRV
                     GDQVREYEGVQLVLSLTEIDEGNPFLREHALFCIRNLMLNNPANQAIIKEMDPVGVLS
                     ETGELLPVPDKMKKKSIESTITEEK"
     gene            1088645..1090064
                     /locus_tag="CNE03810"
                     /db_xref="GeneID:3257805"
     mRNA            join(1088645..1088887,1088941..1089054,1089118..1089288,
                     1089339..1089484,1089540..1089728,1089794..1090064)
                     /locus_tag="CNE03810"
                     /product="expressed protein"
                     /transcript_id="XM_024657266.1"
                     /db_xref="GeneID:3257805"
     CDS             join(1088673..1088887,1088941..1089054,1089118..1089288,
                     1089339..1089484,1089540..1089728,1089794..1089966)
                     /locus_tag="CNE03810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512904.1"
                     /db_xref="GeneID:3257805"
                     /translation="MAYNSNHHQPYNLNYSPNEELEDFDVRADFDVKGPRWSEVHGNG
                     LYNPGIEAGRGNARSSTIGLGVMGGDRNNRPVSEHIPPLGHTYSQDTRKSLASKEELV
                     SVPVLGPEWRKTELHDLSRRGQSGIKAEKRKKAWLEWTRDQRGLCGVRWLTRKVIVGA
                     VFLFCVALGVTLYFVIPRAPSFEFYDEQPFTVNNDTISFSRTPTNFSFSGNLNLWADA
                     SSSYVPVHFTHLEASLYDETTNKKIATGDWGNHVMPHKAEQAIILPVKFAYSAINTSD
                     TTWNDWYNACGHMWPGTTRSDLKLKLLLKMSIVGLTKKPLTSTLISGVTCPFELSADS
                     V"
     gene            complement(1090982..1094102)
                     /locus_tag="CNE03820"
                     /db_xref="GeneID:3257979"
     mRNA            complement(join(1090982..1091738,1091792..1091911,
                     1091965..1092117,1092175..1092300,1092360..1092804,
                     1092860..1093136,1093188..1093459,1093508..1094102))
                     /locus_tag="CNE03820"
                     /product="Cell division control protein 16, putative"
                     /transcript_id="XM_570972.2"
                     /db_xref="GeneID:3257979"
     CDS             complement(join(1091192..1091738,1091792..1091911,
                     1091965..1092117,1092175..1092300,1092360..1092804,
                     1092860..1093136,1093188..1093459,1093508..1094090))
                     /locus_tag="CNE03820"
                     /codon_start=1
                     /product="Cell division control protein 16, putative"
                     /protein_id="XP_570972.1"
                     /db_xref="GeneID:3257979"
                     /translation="MFTPPNPPHGNPPPLSYSPFPSSSRHHRLQRSIPSNLSNSFSYT
                     PADSNLDLSVDSDNFSFAYPTRRPRPSNLSIFSSGALENAAEQGNRGISQVSPRAKPS
                     PVGSKRSTATARPLNLTTDPRNGRSANGRGEYSNGRPKSRMNETIGLDDEKEQDEERN
                     WSMVDSMRLWRHDAIMQHLYETAAFWGDKILSWTADPNDAFWLAQTHFLTGHYLRAEK
                     LLTEPLVPSPKGFLPPRDGSGPQDKGKRRSQDDDDGMNGLEPGEDEVLGRKLIDESLA
                     CRYLAAQCLVHQEKYVEALELVGESNPFRTLDHPSQGPDEPSQDGGIKLHSSLCLLRG
                     LLHLRLSSFALAKESLMEALMLDVKNYDAYRELIEGGMMSEKEEWDFVTHLGYRKQLS
                     EDDANFVKLMYMTKLKKDTHACEVAAAREALTTQFALGENCDVLVGLADELYAKYKWE
                     ECYVVTTKILSRIPGHPSALPLHLACMHHIHRLRSSLFMLAHELVEQDPQAATTWYAV
                     GLWYFSGKRWAEARRYFSKANLIDSRFAPAWIAFAHSFAYEGEHDHAITAYSTSARLF
                     QGSHLPLLFIGMEHLQLSASNLAEEYFLAAKAINDSDPLLLNELGVVHYNKEDYAVAA
                     SYFRKALRASFDMQGVKSIWAVTYCNLGHAYRIMGEYNKSEHNYRQTIRLDPTNPTAY
                     SSLALLHHLRGDIRLSIQIYHQALSLSPQDPLSTVLLEMALKEQMETLDPTTLPGLPG
                     QLGGRDMDPFKVPKGNPSFGPVPVEMDPTTLGEAGGESVVLPPGSVPLPLPAPSGTTS
                     AASLPIARVPGDDAEDRSSVQSVEDGDEYEEGDGSTMDIEDD"
     gene            1094250..1096969
                     /locus_tag="CNE03830"
                     /db_xref="GeneID:3257874"
     mRNA            join(1094250..1094344,1094391..1094556,1094608..1094689,
                     1094750..1094946,1095002..1095263,1095324..1095425,
                     1095496..1095607,1095664..1095892,1095950..1096067,
                     1096121..1096286,1096339..1096969)
                     /locus_tag="CNE03830"
                     /product="general transcriptional repressor, putative"
                     /transcript_id="XM_024657267.1"
                     /db_xref="GeneID:3257874"
     mRNA            join(1094261..1094344,1094391..1094556,1094608..1094689,
                     1094750..1094946,1095002..1095263,1095324..1095425,
                     1095496..1095607,1095664..1095892,1095950..1096067,
                     1096121..1096286,1096339..1096857)
                     /locus_tag="CNE03830"
                     /product="general transcriptional repressor, putative"
                     /transcript_id="XM_570974.1"
                     /db_xref="GeneID:3257874"
     CDS             join(1094321..1094344,1094391..1094556,1094608..1094689,
                     1094750..1094946,1095002..1095263,1095324..1095425,
                     1095496..1095607,1095664..1095892,1095950..1096067,
                     1096121..1096286,1096339..1096575)
                     /locus_tag="CNE03830"
                     /codon_start=1
                     /product="general transcriptional repressor, putative"
                     /protein_id="XP_024512907.1"
                     /db_xref="GeneID:3257874"
                     /translation="MQPPAIYNHHRLPPAGTPSQPSVLAQPSTARLNELFDLIRQEYE
                     TLGTDGNIWKQQRDEYEAKVQSQINELGMIRQSLYELEANHAKIRQEYETEIARLRRE
                     LESRGGPSSSAPSGAAAALNNPSSPSDLHRPGEDRPPFGMTLPGPTLNGLDAGRSRSP
                     YPNPTAGPPILRPPSAADRDRERRITRPPQFNAPPSPPVHLSDLDPDNVSRELRKEGS
                     DWQAMWSSQMRKQLDVTLVHTLEHETVVCCVKFSNDGKYLATGCNRTAQIYDVKTGAR
                     VSTLQDDLANRTGDLYIRSICFSPDGKFLATGAEDRQIRIWDLKQRRICHLLQGHMQE
                     IYSLDFSRDGRFLVSGSGDKSARIWDVEKGTCVFNLQIEDFIHNEHGPIDAGITSVAL
                     SPDGKLVAAGSLDTMVRVWNVSTGQQVERLKGHKDSVYSVAFSPDGKCLVSGSLDRTL
                     RIWDLTGTKREVESLPPGKEAQKNLGTCQSTLNGHKDYVLSVAISPDGQWVVSGSKDR
                     SIQFWHISTGQAQLMLQGHKNSVISIDLARSGGYLASGSGDCMARIWKYEPIPGRD"
     CDS             join(1094321..1094344,1094391..1094556,1094608..1094689,
                     1094750..1094946,1095002..1095263,1095324..1095425,
                     1095496..1095607,1095664..1095892,1095950..1096067,
                     1096121..1096286,1096339..1096575)
                     /locus_tag="CNE03830"
                     /codon_start=1
                     /product="general transcriptional repressor, putative"
                     /protein_id="XP_570974.1"
                     /db_xref="GeneID:3257874"
                     /translation="MQPPAIYNHHRLPPAGTPSQPSVLAQPSTARLNELFDLIRQEYE
                     TLGTDGNIWKQQRDEYEAKVQSQINELGMIRQSLYELEANHAKIRQEYETEIARLRRE
                     LESRGGPSSSAPSGAAAALNNPSSPSDLHRPGEDRPPFGMTLPGPTLNGLDAGRSRSP
                     YPNPTAGPPILRPPSAADRDRERRITRPPQFNAPPSPPVHLSDLDPDNVSRELRKEGS
                     DWQAMWSSQMRKQLDVTLVHTLEHETVVCCVKFSNDGKYLATGCNRTAQIYDVKTGAR
                     VSTLQDDLANRTGDLYIRSICFSPDGKFLATGAEDRQIRIWDLKQRRICHLLQGHMQE
                     IYSLDFSRDGRFLVSGSGDKSARIWDVEKGTCVFNLQIEDFIHNEHGPIDAGITSVAL
                     SPDGKLVAAGSLDTMVRVWNVSTGQQVERLKGHKDSVYSVAFSPDGKCLVSGSLDRTL
                     RIWDLTGTKREVESLPPGKEAQKNLGTCQSTLNGHKDYVLSVAISPDGQWVVSGSKDR
                     SIQFWHISTGQAQLMLQGHKNSVISIDLARSGGYLASGSGDCMARIWKYEPIPGRD"
     gene            1097805..1100975
                     /locus_tag="CNE03840"
                     /db_xref="GeneID:3257567"
     mRNA            join(1097805..1099890,1099951..1100497,1100551..1100975)
                     /locus_tag="CNE03840"
                     /product="expressed protein"
                     /transcript_id="XM_570977.2"
                     /db_xref="GeneID:3257567"
     CDS             1098146..1099849
                     /locus_tag="CNE03840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570977.2"
                     /db_xref="GeneID:3257567"
                     /translation="MESEIDWVCHPHTLRKPFQEGHKNGILGRDSLDIQFSTRQLQES
                     DRGNCSTPSSSIMPNIVLPYPTNTFARHPSSNSYFPPISPTRPRPKPTKPKLSDILLP
                     RPTLRTTTSMPLLKPPTMAPEGDNEKQGRLGKLRKMGSDLLMKARLKRGDNWAEWEVV
                     DASEGSMSNRRRSSVQVDRGLKNEKRSSRIPWPPSPSFEWRVGGDDSNSTSDGSQRPT
                     SFPSFASFLEIPAGTGLERSGSDTNSGSGEGSGFTSSREEWRSSTIEPFISSFPFPPT
                     PMTRKQLVQQFNEDPPLPVDHPFNTGKTPKLAGAPTLPQGVHWREDIIGTPKLPHTPS
                     TTQSPRSLITPRTPQTPRNQKLQSRQATLSLPITPSSSFSDGPSLDSNQLLSALSAVL
                     YLRSVLYTHAASAQSLLESHAEVLPGFVYRSLSRQIDQWWTKWRSVLNNMGAQTASAL
                     LHLSSPPPPPPSPLPLPADTINSPIPSPLTHDTLQRLIWSLEEAGQVPSFTFARMFGK
                     SAQVRLRKLEDEEVWEATRKGWREYQDDEWGCLQREVWRESGDVRVFGLAGRKGKKGI
                     M"
     gene            complement(1099960..1103260)
                     /locus_tag="CNE03850"
                     /db_xref="GeneID:3257487"
     mRNA            complement(join(1099960..1100279,1100340..1100486,
                     1100543..1100930,1100982..1101076,1101128..1102371,
                     1102428..1102622,1102675..1103260))
                     /locus_tag="CNE03850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657268.1"
                     /db_xref="GeneID:3257487"
     CDS             complement(join(1100004..1100279,1100340..1100486,
                     1100543..1100930,1100982..1101076,1101128..1102371,
                     1102428..1102622,1102675..1103224))
                     /locus_tag="CNE03850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512982.1"
                     /db_xref="GeneID:3257487"
                     /translation="MPIQARNTASRLPYSEDIEKAPLNPDNSPPDYDDDRRTKPRQSG
                     STRSEMRTVFFTGLGLFALALYVSQNVSFPFPSKPQPLPDFITKGIEQCKIISRPPPH
                     FERFDSKREKNDRFVPGTKPVWLKNGTVWTGEDDGNEILQGVDLFLDNGVIRKMGSTL
                     ELDEILKGSEYDEVELHGAWVTPGIVDTHSHMGLDSAPGLKGSSDTNSHRGNTQPWLR
                     SFDGFNTHDLAFNLSISGGITTMLVLPGSAGSIGGQAAAFKPRWTYENTPQSMQVEPP
                     FVIDSSGNGTWQRTHSWRHIKHACGENPARVYGAKRMDAAYDFRKAYAEGKELKDAQD
                     RWCADPKSQKEPFPTSLEYEVLADVIRGNVKVNIHCYETTDLNTLVRISNEYEFPIAA
                     FHHAHEVYLVPDLLKQAWGPVPPAVAIFATNARYKREAYRGTEFAPKILADNGLSVIM
                     KSDHPVLDSRYLVYEASQAHHYGLNFSHSLGAVTTHPAKAMGLDHRLGYVREGYDADL
                     VVWDSFPLSLGATPKQTYIDGIPQILKPHVVEKPAEAQEIFPEGKWDDEIAEAIITRG
                     DPDRRPKKSANNILFQGVTAFYLGTDKFDLSVFEQGKKGDVIVKSGEIICVGKCTVEE
                     DLDFEVIDLKGGSIAPGMISVGSYLGLMEIRQEKSTTDGKAYDPLQDAGEYTDGMLVH
                     AVDGAQFGGKDELLAYSSGVTTIVAYPISTSLISGLSFSFSPSAPHPLARHAIQNPSA
                     ALHLSLENTPTSISSKIAILRRLLLGEVEGHTETVRAFKKVANGELRLVVEVSSADVI
                     SALVRLKREVGRKVKITILGGHESWLIAQDLADEDIGVIVAPSRSYPEEWDQRRIIPG
                     PPLSNHTLPSYLVSHGVKVGLGIVEEWQARNTRYDAAWVYANSPEIFSKSSALALVSN
                     NLEELLGLNENNNALRENEKAWVAYEGDLFGFEGRVRGVRGYAKDEVDLF"
     STS             1102958..1104535
                     /standard_name="D1S3697"
                     /db_xref="UniSTS:474275"
     gene            complement(1103520..1105306)
                     /locus_tag="CNE03860"
                     /db_xref="GeneID:3257559"
     mRNA            complement(join(1103520..1103678,1103734..1103790,
                     1103849..1104060,1104115..1104353,1104413..1104443,
                     1104498..1104788,1104836..1104891,1104945..1105037,
                     1105091..1105167,1105220..1105306))
                     /locus_tag="CNE03860"
                     /product="mRNA methyltransferase, putative"
                     /transcript_id="XM_571196.2"
                     /db_xref="GeneID:3257559"
     CDS             complement(join(1103584..1103678,1103734..1103790,
                     1103849..1104060,1104115..1104353,1104413..1104443,
                     1104498..1104788,1104836..1104891,1104945..1105037,
                     1105091..1105167,1105220..1105289))
                     /locus_tag="CNE03860"
                     /codon_start=1
                     /product="mRNA methyltransferase, putative"
                     /protein_id="XP_571196.1"
                     /db_xref="GeneID:3257559"
                     /translation="MESPSRPPTPPLPTLAPSSSKGQKRDESILELNSLLDRETAKSK
                     LRRLAISTSCLPPLFNPLCPSTTLAACKQVRHECTKAHFDPIQRPWTDSTLGFCSYLN
                     LCYGDPMFTKNPSLGDGSGPRGGTKDCRYQHFQVTPSTIRCTQPLPEGYPSVMPGYLK
                     KRVLGDEDVERQDKEADVAQWVNCDLRRFDYSLLGQFQVIVADPAWDIHMTLPYGTIT
                     DDEMRNMPIRSLQPDWGILCLWVTGRAMELGRVVFAHWGYKRVDELVWVKTNQLQRLI
                     RTGRTGHWLNHTCEHLLVGLKLPQNFPRDAPIPWDTEPALRHLRKCVDTDVVVAEVRE
                     TSRKPEEVYGVIERLAPKGRKLELFGRKHNTRPGWVTLGNQLGDSQIAEPDLYDRLVK
                     AYPKQKFTFVPSKQ"
     gene            1105434..1106558
                     /locus_tag="CNE03870"
                     /db_xref="GeneID:3257598"
     mRNA            join(1105434..1105845,1105911..1106558)
                     /locus_tag="CNE03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657269.1"
                     /db_xref="GeneID:3257598"
     CDS             join(1105492..1105845,1105911..1105919)
                     /locus_tag="CNE03870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512919.1"
                     /db_xref="GeneID:3257598"
                     /translation="MLLYIPFRPLFARPVLSKCIHTTPTFLRAPSSFTRPGPPPLPPA
                     EQAEFEALLKANQTIGTIPTAEQENEKDLHQDVRKGPKPEFDGDVNPKTGEQGGPKND
                     PFVAGDADWQFGGRVTDF"
     gene            complement(1106003..1107249)
                     /locus_tag="CNE03880"
                     /db_xref="GeneID:3257505"
     mRNA            complement(join(1106003..1106315,1106372..1106444,
                     1106517..1106530,1106583..1106664,1106786..1106900,
                     1107043..1107096,1107160..1107249))
                     /locus_tag="CNE03880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657270.1"
                     /db_xref="GeneID:3257505"
     CDS             complement(join(1106180..1106315,1106372..1106444,
                     1106517..1106530,1106583..1106664,1106786..1106900,
                     1107043..1107069))
                     /locus_tag="CNE03880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512920.1"
                     /db_xref="GeneID:3257505"
                     /translation="MSLPKRILKETERLMADSPPGISAAPKDDNLRHFDVTVAGPDSS
                     PYEGGVFKLELFLPEEYPMNPPKVRFLTRIYHPNIDKLGRICLDILKDKWSPALQIRT
                     VLLSIQALLGAPNPDDPLANDVAQHWKENQNAAIAQAREWTRKYAQ"
     gene            1107431..1109206
                     /locus_tag="CNE03890"
                     /db_xref="GeneID:3257737"
     mRNA            join(1107431..1107507,1107563..1107638,1107692..1107731,
                     1107789..1107808,1107865..1107889,1107952..1108048,
                     1108110..1108334,1108386..1108419,1108472..1108567,
                     1108621..1108669,1108728..1108833,1108896..1109206)
                     /locus_tag="CNE03890"
                     /product="cytochrome-c peroxidase, putative"
                     /transcript_id="XM_024657271.1"
                     /db_xref="GeneID:3257737"
     CDS             join(1107477..1107507,1107563..1107638,1107692..1107731,
                     1107789..1107808,1107865..1107889,1107952..1108048,
                     1108110..1108334,1108386..1108419,1108472..1108567,
                     1108621..1108669,1108728..1108833,1108896..1109101)
                     /locus_tag="CNE03890"
                     /codon_start=1
                     /product="cytochrome-c peroxidase, putative"
                     /protein_id="XP_024512921.1"
                     /db_xref="GeneID:3257737"
                     /translation="MASVKEGDYQALKEEIKKIMKQPGYDDGSAGPVLVRLAWHASGN
                     FSLVEHNGGSNGAGMRFPPESVDPANAGLHYAISFLLPLQSANSWISHADLWTLAGVT
                     AIEAMGGPQIPWEPGRLDYESEQAAVEHRGDVSNRLPDGALGAAHIRDVFGRMGFSDQ
                     EIVALSGAHNLGRCHADRSGFDGPWVVNPTRFSNQYFKLLLRPIWKPRQWDGPFQYEA
                     IVAGTRLMMLPTDMALIEDPSFRPWVEKYAADQNLFFKDFANAFGKLIELGVDRDDTG
                     FARLAKKAAEEGKPLDKTAPPAGDETCPVSGAVGGGVQRAAGGGGCPFMAMQNREAKL
                     "
     gene            1109506..1111325
                     /locus_tag="CNE03900"
                     /db_xref="GeneID:3257486"
     mRNA            join(1109506..1110375,1110423..1110638,1110689..1110874,
                     1110930..1111325)
                     /locus_tag="CNE03900"
                     /product="expressed protein"
                     /transcript_id="XM_571014.2"
                     /db_xref="GeneID:3257486"
     CDS             join(1109776..1110375,1110423..1110638,1110689..1110874,
                     1110930..1111247)
                     /locus_tag="CNE03900"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571014.1"
                     /db_xref="GeneID:3257486"
                     /translation="MFFKTVPLLLLLVSPFLPSSLADPTEVDCPDTDLATYLISLINV
                     LYYNGLTISEELIVHLSETDEGYELLEDLYMNADIWTFLAPTDEAWQTANIWPPFSSM
                     TDHWGADLLALHSLQGEYSPSSVPSQGAEVASTYLEMKDEMNATSSNSQAYQAVVLYQ
                     GDNGGLVVDGWWGNATSWNGFVDTSSSLGLGNLEILPIDYVLAFPPSLSEAFATSGLS
                     NMSSAIEVIGMTDELQQLTDNGFTIFAPIDSIWSDEAKSMMTNDSTAVPLVKNHYTTS
                     YSLFSPMWASSGSFDLQVESGEVLTIKVDDDGGYSVVLGDVEAKIIKSDITLENGIMH
                     VIDAVLLSPDSIMSSAGVTSSDGVVAVQTGLSSGSSSSSASGSLGLSSAEGIDSTGWA
                     STTTGTNTSKQVVSEQQNSRAGRRTAVGVPLFMGLMFVRELALLSQL"
     gene            complement(1111299..1111929)
                     /locus_tag="CNE03910"
                     /db_xref="GeneID:3257881"
     mRNA            complement(join(1111299..1111544,1111594..1111929))
                     /locus_tag="CNE03910"
                     /product="expressed protein"
                     /transcript_id="XM_571017.2"
                     /db_xref="GeneID:3257881"
     CDS             complement(join(1111338..1111544,1111594..1111872))
                     /locus_tag="CNE03910"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571017.2"
                     /db_xref="GeneID:3257881"
                     /translation="MSRARTIGKRLTNLPIIPIPITRSGNNKPKSLQKTKRTFQPNLT
                     RVDWPVTVLGGPVPIDRTKEQSLPKLEGILMQVRKIRDVEKAGGIEGLLLSRRSKDLT
                     PYGASLRAQLFESLHEIRREMEGQAELSRLGVEEERLRLEDGSPLANTGASQESVSEG
                     R"
     gene            1112081..1113182
                     /locus_tag="CNE03920"
                     /db_xref="GeneID:3258007"
     mRNA            join(1112081..1112283,1112335..1112414,1112468..1112837,
                     1112891..1113182)
                     /locus_tag="CNE03920"
                     /product="60s ribosomal protein l1-a (l10a), putative"
                     /transcript_id="XM_571019.1"
                     /db_xref="GeneID:3258007"
     CDS             join(1112116..1112283,1112335..1112414,1112468..1112837,
                     1112891..1112953)
                     /locus_tag="CNE03920"
                     /codon_start=1
                     /product="60s ribosomal protein l1-a (l10a), putative"
                     /protein_id="XP_571019.1"
                     /db_xref="GeneID:3258007"
                     /translation="MSKLQASSVRGSIRTVLDQSSLETHKEAGGKKRNFVETIELQIG
                     LKNYDPQRDKRFSGTVKLPHVPRPRMSLCILADAMDVDRAKQLDEELPFMTVEDLKKL
                     NKNKKLVKKLAQKYDAFLASEALIKQIPRLLGPGLSKAGKFPTPVSHSEDLARKINDV
                     RSTIKFQLKKVLCLGVAIGHVDMTEDQVMQNVMLAINFLISLLKKQWQNIQSLTIKST
                     MGKPQRLF"
     gene            complement(1112891..1116756)
                     /locus_tag="CNE03930"
                     /db_xref="GeneID:3257639"
     mRNA            complement(join(1112891..1113671,1113739..1113883,
                     1113949..1114298,1114360..1115038,1115103..1115390,
                     1115448..1116756))
                     /locus_tag="CNE03930"
                     /product="expressed protein"
                     /transcript_id="XM_024658541.1"
                     /db_xref="GeneID:3257639"
     mRNA            complement(join(1112891..1113671,1113739..1113883,
                     1113949..1114319))
                     /locus_tag="CNE03930"
                     /product="expressed protein"
                     /transcript_id="XM_024657272.1"
                     /db_xref="GeneID:3257639"
     gene            1113198..1115833
                     /locus_tag="CNE03940"
                     /db_xref="GeneID:3257611"
     mRNA            1113198..1115833
                     /locus_tag="CNE03940"
                     /product="expressed protein"
                     /transcript_id="XM_024657273.1"
                     /db_xref="GeneID:3257611"
     CDS             complement(join(1113396..1113671,1113739..1113883,
                     1113949..1114298,1114360..1115038,1115103..1115390,
                     1115448..1115662))
                     /locus_tag="CNE03930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514388.1"
                     /db_xref="GeneID:3257639"
                     /translation="MRSNSSSSSSRERGVSPRPPPSYARSSLDRSPSLNPMVLDERPR
                     IPPPIYLRSSSPQPRSNVGTLKIHVPAWATCLVKPPRPLDLHPLEAGSSEHEPPSDDT
                     VLSGALEVMMKERKKVRSISVGVQSVCRLHMGKGRGWEEDGIFERGVEVLGEENEDGI
                     WLEKGRQSFSFSILLPATLATSDYHPFGRLTYIITATVRGIAHTSSFSSIFKAVSTPS
                     TLDPDIPYVGDFERVIGRSDKLAAESRSRSASVSRRERSESRDNVPAMRSFPLGGDDG
                     TCAITIGGNSPPMGGLYTTRRHSSSILSSSSSTSIPTLSLSSEEEGRGRRSFSSTSSA
                     SRGHGKADKDDWMKGDLCASRELLVHAVDPLTGGEIPLDVRKEGFVEGLGSWRFSANA
                     EALSISSVILLSMNIPTPTPSTTIFLLRLVLSQTYTFTSPRTPNQHPHLPEAATHHVL
                     YQIGRQHKAGEKYPGPECESLWRGYLAGGHGGLDGQDHGWSVRAVARIPNHDKIRPST
                     HDGTITPIRVTHELLLKIYYSIHGESVKGERIKGPGELRMMSVRVPIHLPSCHCLSDA
                     LSLPTYEKCHRSTDNIDSIISSPPNMKTWCMCGKTFAELGEAAMKRMQAADREDMEER
                     MRQSAGDGNSKDLQSREERSCQDGSV"
     CDS             complement(join(1113396..1113671,1113739..1113883,
                     1113949..1114268))
                     /locus_tag="CNE03930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512924.1"
                     /db_xref="GeneID:3257639"
                     /translation="MNIPTPTPSTTIFLLRLVLSQTYTFTSPRTPNQHPHLPEAATHH
                     VLYQIGRQHKAGEKYPGPECESLWRGYLAGGHGGLDGQDHGWSVRAVARIPNHDKIRP
                     STHDGTITPIRVTHELLLKIYYSIHGESVKGERIKGPGELRMMSVRVPIHLPSCHCLS
                     DALSLPTYEKCHRSTDNIDSIISSPPNMKTWCMCGKTFAELGEAAMKRMQAADREDME
                     ERMRQSAGDGNSKDLQSREERSCQDGSV"
     CDS             1114331..1114867
                     /locus_tag="CNE03940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512967.1"
                     /db_xref="GeneID:3257611"
                     /translation="MVHVMMIQLTASAFAENLQLPSPSTNPSLRTSRGISPPVNGSTA
                     WTNNSLEAQRSPFIQSSLSAFPCPLLADEVDEKLRRPRPSSSELRESVGILVEEEDER
                     ILDECRRVVYNPPIGGELPPMVIAHVPSSPPRGKLRMAGTLSLLSLLSRRETEALRDR
                     LSAANLSDRPITRSKSPT"
     gene            1117275..1119768
                     /locus_tag="CNE03950"
                     /db_xref="GeneID:3257799"
     mRNA            join(1117275..1117637,1117697..1117984,1118037..1118643,
                     1118724..1119074,1119131..1119275,1119345..1119768)
                     /locus_tag="CNE03950"
                     /product="expressed protein"
                     /transcript_id="XM_024657274.1"
                     /db_xref="GeneID:3257799"
     CDS             join(1117402..1117637,1117697..1117984,1118037..1118643,
                     1118724..1119071)
                     /locus_tag="CNE03950"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512980.1"
                     /db_xref="GeneID:3257799"
                     /translation="MSNTSDPASSRPISLSSLGSGSSIRPPPAYAYSHLDRSPARNPM
                     ALDNRPRVPPPINLRSASPQPRSSTGELKIHVHAWATFLVRPPRPLDLLPVESGGAEC
                     EHANEDTVLSGALEVIMKERKKVQAISVGVQSVCRLNMGKKRGWEDDGIFERGVEVLA
                     GRDEDGIWLEKGSQSFQFSILLPATLATSDWHSFGRVPYMITARVQGTPYTSFSSIFK
                     AITPAFEHTYAADFERVMARSEKTAAERSGRSSSRGISIPRNSGSKSRDNIAAMANDS
                     LDEDYDVDDSGSPGQGLYTRRHSHLPIDESSHGSLKWDKTGSDGSNKIDKADWMKGDL
                     VASPELLVHAVSPVTGGVTSLDLRKEGFVDGLGSWTLSASADVFSIASVILLSINIPA
                     PSVSTTIFLVRLLLSQSYTITSPRTPDEPPHSPEDPKQYVAYQIGFAHPKGGNHPGSE
                     YEALWRGHEAGGEGGLPGEDQGWKVRAVARMPNHDISSAVDP"
     gene            complement(1119742..1120775)
                     /locus_tag="CNE03960"
                     /db_xref="GeneID:3257753"
     mRNA            complement(join(1119742..1119921,1120023..1120168,
                     1120462..1120556,1120681..1120775))
                     /locus_tag="CNE03960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571023.2"
                     /db_xref="GeneID:3257753"
     CDS             complement(join(1119799..1119921,1120023..1120168,
                     1120462..1120556,1120681..1120751))
                     /locus_tag="CNE03960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571023.1"
                     /db_xref="GeneID:3257753"
                     /translation="MVSLARTIRHFRLVGFKEWFRQLTYIGDAKYGRLVGTDQFGNRY
                     FEQLDPKEELPGRHRWIDYSQDDFNASQVTPEWHSWIHHIRKDAPTDDVIMKQLSPPW
                     KAPYTENMTGTRGHFKTYSTTAPKIQAWDPVVKPRGGAQTQA"
     gene            complement(1120936..1123863)
                     /locus_tag="CNE03970"
                     /db_xref="GeneID:3257627"
     mRNA            complement(join(1120936..1121398,1121459..1121736,
                     1121798..1121989,1122055..1122269,1122323..1122442,
                     1122498..1122593,1122650..1122718,1122772..1122868,
                     1122919..1122930,1122991..1123074,1123134..1123245,
                     1123298..1123863))
                     /locus_tag="CNE03970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571195.2"
                     /db_xref="GeneID:3257627"
     CDS             complement(join(1121328..1121398,1121459..1121736,
                     1121798..1121989,1122055..1122269,1122323..1122442,
                     1122498..1122593,1122650..1122718,1122772..1122868,
                     1122919..1122930,1122991..1123074,1123134..1123245,
                     1123298..1123490))
                     /locus_tag="CNE03970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571195.1"
                     /db_xref="GeneID:3257627"
                     /translation="MGLLSQRMDSLSIRGKTSRRSSVASPAGTPARDSGETQIDDGDP
                     NDTSTLDQEEGNILLSIISQLRPGMDLSKIALPTFVLEPRSLLERITDFFSHPELIFG
                     AGNDPDAKQRYIRVMTFYLSGWHIKPKGVKKPYNPVLGEFFRCTYVYPDGSEGFYIAE
                     QVSHHPPVSAFFYISPKNGLLVTGELKPKSKFLGNSAATIMEGEDRIRLLDRPEDGEY
                     SITMPNTYARGILFGKMLLELCDVSSIANAKNDFHCDVDFKAKGWISGGYNVISGKVV
                     GPGRSDIGEISGHWSSAIEFKDKDTKEKKVLFDPSTSRVAPKKVLPESEQEEYESRRL
                     WTKLTDAIRAADMHGATAAKSAVEDRQRELAKKRESAGEPAHEQRFFKHVAGDKWMPK
                     LDVDNLPKDRNEMEDVVRKWIFGDKNPLDYESVKTTPRGSQSTESGAAPVAAGEATPV
                     AAGGAVAGGAAGAAGVAGADVSSSNTSVAESTRSTSTEPPAVPTAPGPPVGQPVDHPV
                     PPKA"
     gene            complement(1124201..1129410)
                     /locus_tag="CNE03980"
                     /db_xref="GeneID:3257863"
     mRNA            complement(join(1124201..1124425,1124477..1124794,
                     1124848..1125045,1125110..1125644,1125694..1125815,
                     1125872..1126619,1126678..1126874,1126928..1127265,
                     1127324..1127600,1127664..1128097,1128151..1128235,
                     1128290..1128466,1128513..1129410))
                     /locus_tag="CNE03980"
                     /product="DNA replication helicase dna2, putative"
                     /transcript_id="XM_024657275.1"
                     /db_xref="GeneID:3257863"
     CDS             complement(join(1124414..1124425,1124477..1124794,
                     1124848..1125045,1125110..1125644,1125694..1125815,
                     1125872..1126619,1126678..1126874,1126928..1127265,
                     1127324..1127600,1127664..1128097,1128151..1128235,
                     1128290..1128466,1128513..1129319))
                     /locus_tag="CNE03980"
                     /codon_start=1
                     /product="DNA replication helicase dna2, putative"
                     /protein_id="XP_024512925.1"
                     /db_xref="GeneID:3257863"
                     /translation="MPLFHSGGVKPSAKNPAPSNTPRHKTRPNDENQRVPNEPRKQSC
                     PKETLLQEKKQHDVPKTPKKARNESKSDEQSMMDDLLAGLDASVFEWGRTPSQGSQSR
                     STRPPQHSPLKEKKRRSPNISLDDQMPPAKKAKPLSPKKVVALGNPDLKPSRVIPKSP
                     TKPMTGKERNITSAFRSTTVKQERIGSPANVERMIPLVDVKRESSPLEAKSDEIVEAD
                     VKPVVEPTEALDGMKKESPDIDDDDMFEFDFNIEDLGVTEEDLLATVPPPKIKYPVLH
                     PSVPPAPQGYAPTPWARCIVEAVFGGLLFEDGVIPSTSELDIMSVVEVSFAKTLVVTL
                     TDGGARGVVHLKDRWADTEVRKGDIINIVSPLLATQTTKPISVTFKDPSTFLIHHPDL
                     MITMTSIANAMPCPRKPVIQSLIRTPGPPTKPLLYGTLLHSLLQGALLQQDFGADGTF
                     RRLDAELKKDEIKLEIWSTDMGILDVREEVGVKAGRGFEVFGERYITKDPKPEGELHS
                     SAGDQPALLAINGLHEVEEDIWSPKWGLKGKMDASVQAKIIRDPLHGTQVEEHVAPFE
                     IKTGRSVGVMAHRAQTMLYTLLMEDRYGVPVPAGLLYYSALDTILRVEAKQNEIRALI
                     MARNELAMYMSKQRKIPKHLPEGDRPVEILRGGVVKKEMVKEEKREEELEAEVEEAFL
                     PPTIDNMRDCKMCYAVESCMLYRKAIDKIPQDPEDPIAELYEEHTGHMTEKDAEFYKK
                     WDTLVTVEEQDTVKFRSQLWTMTAKQREKNGKCFSDMIIESYSNDLGKSLAKIHRHSY
                     TFIRAPSAISENTTSLLSGHIAKGDPVSLSIEPDLLCMWRGFVTDLTQTSVTVAVTYV
                     INTDALLKRTGREHRVLRASDGQSQDKVVFRIDKDEMASGMMRMRNNLAQLFYKNGDE
                     ARRRLIVDQAAPEFEPSWRPEPSEIPPSLNSDQQKAMESVLTARDYSLILGMPGTGKS
                     TTIAETIKALVARGRTVLLTSYTHSAVDAILMKLTDAEFGVLRLGNIDKVHPDVQHLT
                     LEAYEASANMDQLNARLMTPPVVAATCLAIDHPLFFRRRFDYCIVDEASQITLPTCIG
                     PLRMADKFVLVGDHYQLPPIVRHAEARRGGLDVSLFRHLSAAHPSAVVDLSYQYRMNE
                     DIMALSNKLVYEGRLKCGNEQVAQSGLKLRSRKRCKEIFGDAGCTCDQGKGCWIQDLL
                     EESAKCVFIDTDGVPALDSRVGDLVQNEIEAKLVQQLSTALVASGVRQEDIAIITPYR
                     QQIKLLSSYLKPIPRVEILTADKSQGRDKDCILVSLVRSNESGNIGDLLRDWRRINVS
                     FTRAKKKLVIFASAKTLNADPLFKEFLELVREKGFEKKLKKGDDKLHFVQVPNSQVPT
                     QDKGKERVKIEKKVVAGAGKRVLNGRGPFVKEVMNME"
     gene            1129592..1133188
                     /locus_tag="CNE03990"
                     /db_xref="GeneID:3257857"
     mRNA            join(1129592..1129756,1129807..1129820,1129875..1129964,
                     1130014..1130275,1130337..1130419,1130468..1130582,
                     1130639..1130763,1130815..1130896,1130951..1131009,
                     1131058..1131157,1131210..1131598,1131652..1131864,
                     1131914..1132050,1132101..1132139,1132194..1132311,
                     1132366..1132446,1132505..1132655,1132733..1132990,
                     1133041..1133188)
                     /locus_tag="CNE03990"
                     /product="protein-nucleus import-related protein,
                     putative"
                     /transcript_id="XM_571027.1"
                     /db_xref="GeneID:3257857"
     CDS             join(1129649..1129756,1129807..1129820,1129875..1129964,
                     1130014..1130275,1130337..1130419,1130468..1130582,
                     1130639..1130763,1130815..1130896,1130951..1131009,
                     1131058..1131157,1131210..1131598,1131652..1131864,
                     1131914..1132050,1132101..1132139,1132194..1132311,
                     1132366..1132446,1132505..1132655,1132733..1132990,
                     1133041..1133070)
                     /locus_tag="CNE03990"
                     /codon_start=1
                     /product="protein-nucleus import-related protein,
                     putative"
                     /protein_id="XP_571027.1"
                     /db_xref="GeneID:3257857"
                     /translation="MSRQEKDALVAYVNSFKLSKPITDFAQLADGKALMEAMSAVDST
                     HFKDVPARGVTSQASSSENWVLRMNSLKRLYRLLLSFPLPAPHPSSLSLSSLSDPPFS
                     TIAKTPTMREGVQGLLQICRFCLAASVWAPGNEKVIMRIQKLKEEHMAELMKSIEAVT
                     ATLPAEHQRQESGSSSLRPSPDLSYSPPPSSLREERDKLLQENDDLRTRCERMMEQVA
                     DLTSKLKETKEEHEDALERLSRGETPGAGLRGNQAAGANEIERLKVDLLKAEESLAKA
                     EEDLEKQTTSVSELTKQIEQYKAEAAEAGKLKDQLDEYRHTADRLRKSENVIEKYRKK
                     LEESANLRRELRNLEEENASLVNTNSSLEADLKKAVAFKSLFDNYKSQIESFEKQTAD
                     QATEITELNHQLEVTQHQLESLQSTYEQHQEELQLSQEKLREIELTGVISSNGEGLKR
                     NAPGDMSLGDELGELPDNGDRETKTDLRLKIKSLQRELSDLQSSAPVSHRLITLETLL
                     ADANKSKERYQADYLKAHKEGLRLSATLEAIREGRGGDNSQTSAALRQRLDEVLEERD
                     ALLRERQELEVAKGEAEKALTAAKVDLSLVGKDKRDILASLRKSVEKDASDLGKEVIV
                     LKEQIEALREKDRQNLEEIKTLLKDKVNLQTASIDQRERAFEKEKEFSELKASMSASG
                     VPAETQQKLLGLYGRNTELSAEVKALQDKLDVLSKSGGTYDHSPFEQAQIAYEKQITS
                     LQAEVAKLKESKTALKKQYDLEQQLMLTAWHDLGQKMVGGHLHVAMNGAKRSQAKPMP
                     NGWLGRQRRIQENAGYART"
     gene            1133379..1134261
                     /locus_tag="CNE04000"
                     /db_xref="GeneID:3257701"
     mRNA            join(1133379..1133470,1133552..1133694,1133834..1133947,
                     1134028..1134261)
                     /locus_tag="CNE04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657276.1"
                     /db_xref="GeneID:3257701"
     CDS             join(1133420..1133470,1133552..1133694,1133834..1133947,
                     1134028..1134100)
                     /locus_tag="CNE04000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512927.1"
                     /db_xref="GeneID:3257701"
                     /translation="MPLYELFCIAVHNPVSSVNLRGIVNIVSTQVHQTGGVVRDLKNL
                     GINMTLPQRIRRMRQYYSTGDHFTMTFDTSPIVLKRIHETLRSDPSVIKWTVLKRADK
                     AKELAAPRHPSIDFQEIGAPESQY"
     gene            1134474..1135923
                     /locus_tag="CNE04010"
                     /db_xref="GeneID:3258008"
     mRNA            join(1134474..1134814,1134867..1135034,1135110..1135222,
                     1135287..1135923)
                     /locus_tag="CNE04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_571031.2"
                     /db_xref="GeneID:3258008"
     CDS             join(1134558..1134814,1134867..1135034,1135110..1135222,
                     1135287..1135894)
                     /locus_tag="CNE04010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571031.1"
                     /db_xref="GeneID:3258008"
                     /translation="MQAPQTSLSDLLPPLHRRLADIQSYQLPRLSTFSGPSDMHSELV
                     DELRTDLESIRHQLGIAKELSLYAPQQTEAQEVEGIEREYIRLKSDFRRAMIDSKKAL
                     ASRQSRAHELSLKSDLEPNSSTDETTRGGEAKSAAELGIGGDDELQTKTNEVTVALRR
                     TTALMQTELERSVLSVQMLESSTQTMTLTQSLYETYSSLLTSSAQLVRALEKADTMDR
                     LIIFAALFFFLCVVGWVIKRRVLDRTVGVVIGGVGKGVGWYLGGSWRLIRMALSGGSG
                     GSSGRAGLDLADQRIGGGMVDGVEEGVPIPQVGEDSAVGGVKLVADYDDVPPPPAPAS
                     QPSQVQGMEEINRINAERRGGKIEVIPNDQGERIVPSWVQDQGREEL"
     gene            complement(1135931..1138219)
                     /locus_tag="CNE04020"
                     /db_xref="GeneID:3257820"
     mRNA            complement(join(1135931..1137467,1137517..1137923,
                     1138001..1138219))
                     /locus_tag="CNE04020"
                     /product="chromatin remodeling-related protein, putative"
                     /transcript_id="XM_571052.2"
                     /db_xref="GeneID:3257820"
     CDS             complement(join(1136013..1137467,1137517..1137923,
                     1138001..1138193))
                     /locus_tag="CNE04020"
                     /codon_start=1
                     /product="chromatin remodeling-related protein, putative"
                     /protein_id="XP_571052.1"
                     /db_xref="GeneID:3257820"
                     /translation="MSTPKISLRISTPADADSQQEQQAEATGQGVQTHDVASAPGKEK
                     EREPHYGGEIANISVPVDNGEPSATPRDAAATETPAEETPAPEPERPTPAQLHDLATT
                     YLAAQTHPLVIPSYSSWFSLTTIHPIERRSLPEFFSSRNRSKTPSVYKDYRDFMINTY
                     RLNPGEYLTVTACRRNLAGDVGAIMRVHAFLEQWGLINYQVDPDTRPAALGPPFTGHF
                     RVTLDTPRGLSNLLHPGVKPGAGALSQTNGVTPHPSNLDLRKTIYHSTPRTTKPVSAE
                     DATKLASTNGDVPKSKTYVCETCGTDCTTTRYHSLKDGEYTICPSCFVSGRFPSTMYS
                     GDFVRLDEEAFKHASASVGADWSDQETLLLLEGIEMFDDDWQAVADHVGSRSKESCIS
                     KFLQLPIEDPYLTQEPAADLGPLRYQAGMNGLPFEGGENPVMSVVAFLASQVGPAVAA
                     AAAQSALGELAKGLKRKRSEGEKEGEKEGKVAKNDEEKKESDEKKKESDEEKEKEKEG
                     EAEPMAVDEATEQPTEPSTAPVENTETEANPSVPSASDLSRAATLALSSAATKASALA
                     SHEDHRISQLVSRLVTVQTRKVELKLSMFERLEELLENEKRSIELARQNLFRDKQTVK
                     KQLAQVEELLKKAKEGDKGVEGEVAGLKKDIETGSTAEAVKEVQATNEPAVEGDTTLG
                     KL"
     gene            1138394..1139750
                     /locus_tag="CNE04030"
                     /db_xref="GeneID:3257554"
     mRNA            join(1138394..1139085,1139152..1139280,1139339..1139750)
                     /locus_tag="CNE04030"
                     /product="6-phosphogluconolactonase, putative"
                     /transcript_id="XM_571054.2"
                     /db_xref="GeneID:3257554"
     CDS             join(1138457..1139085,1139152..1139280,1139339..1139510)
                     /locus_tag="CNE04030"
                     /codon_start=1
                     /product="6-phosphogluconolactonase, putative"
                     /protein_id="XP_571054.2"
                     /db_xref="GeneID:3257554"
                     /translation="MPHTSAPPVLYSFDDTKHLQSSLANFILKAQADAVAHRGVFTIA
                     LSGGSLPNQLRPLADIEGIHWDKWQVFFSDERIVPLDHPDSNYAACAKAFLDHVPIKK
                     EQIHTINTSLFREQTRSDPTAEIKPGEEDAAENEAVDIADDYEKQLVQTFGGGNAARY
                     PTFDLILLGMGPDGHTCSLFPGHELLSENDRWVAEIQDSPKPPKRRITFTYPVLNHAF
                     RCAFVASGEGKQDMLSQILDNPEEGLPCSRVRPNSPGLVFWFVDASASAKIQYPKTEY
                     KWIQAAGEDDPVAVERKKMKSEMDAAVKEGERQ"
     gene            complement(1139897..1141707)
                     /locus_tag="CNE04040"
                     /db_xref="GeneID:3257930"
     mRNA            complement(join(1139897..1141369,1141424..1141707))
                     /locus_tag="CNE04040"
                     /product="expressed protein"
                     /transcript_id="XM_571056.1"
                     /db_xref="GeneID:3257930"
     CDS             complement(join(1140011..1141369,1141424..1141666))
                     /locus_tag="CNE04040"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571056.1"
                     /db_xref="GeneID:3257930"
                     /translation="MAENRTQLPALPFEVVRRIIHFRLALPQTYPAPIAPRAQYRPAW
                     DAWTGARGREVESNMVAERRDVVRTAWGLVTVCKAWKAVVLQYLYASPNITTNLQQLT
                     FSVLKGDAKWSDINLHAFSLPGRHVTTLDLSHIPLEVHRTVVKQSCLALFPLLPNVTH
                     LKLGERETKCIPLEEIGWAAFAKVLKCLQGVWVDEREGMGRELVGLLKKLPNLEVLGV
                     VGPGISVEPGETSEQRPLQLSLPKLHTFKLEGVPSGDLVSTLLTASLPSLTRLILTPT
                     PLMPFDQSLALQTTLGPQIRSLTYLAPRGWPRADTAIPPDTLDIHPELIHLACLDGDF
                     EGLDVLLRSPASTNHPLRVLTVPKWSPSCNSSDQSTSPPVTPLNLFPSHLLTPPPSPP
                     YQSSTDSSLPGPPFLRTLCSRSSTHPNHPGQTGDGPQIKMIVIDGFKWVKPTLGRAAM
                     GAGQSGEMRYWSGVLARKGIQLYDMEGETAPPVGNHSPVGYVTGGRGAGRRRSSSNSV
                     MNFGMGMRGRPSTPREWGGCDEDGG"
     gene            1142058..1143067
                     /locus_tag="CNE04050"
                     /db_xref="GeneID:3257849"
     mRNA            join(1142058..1142452,1142516..1142778,1142838..1142875,
                     1142926..1143067)
                     /locus_tag="CNE04050"
                     /product="iron ion transport-related protein, putative"
                     /transcript_id="XM_571058.2"
                     /db_xref="GeneID:3257849"
     CDS             join(1142123..1142452,1142516..1142778,1142838..1142875,
                     1142926..1142942)
                     /locus_tag="CNE04050"
                     /codon_start=1
                     /product="iron ion transport-related protein, putative"
                     /protein_id="XP_571058.1"
                     /db_xref="GeneID:3257849"
                     /translation="MALPTLRTTFASSSRVTLHHLSFPARSLAYLRCGSSLAQHSSSQ
                     AYTPTPAYSGPVASSSSSKAKGGVKDMHAAPNPAPPAAPAKNEGTGEKKEPRRRVPLK
                     SQRNAITMTPTAISHLRELLASPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEV
                     VEQDGVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNIRF"
     gene            complement(1143552..1145062)
                     /locus_tag="CNE04055"
                     /db_xref="GeneID:36392878"
     mRNA            complement(join(1143552..1143948,1143996..1144462,
                     1144537..1145062))
                     /locus_tag="CNE04055"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658542.1"
                     /db_xref="GeneID:36392878"
     CDS             complement(join(1143592..1143948,1143996..1144462,
                     1144537..1144960))
                     /locus_tag="CNE04055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514389.1"
                     /db_xref="GeneID:36392878"
                     /translation="MPHLNRKQEALREIDNRISSLLPYISSSLFRRQIGLLLSLRKIH
                     ENSRYYQRIPHSSHYENHDYLFLRSSLLPSTDDKIIKTLHMNRAEFTSVVALFGDDDI
                     FKSQGRKPQAPPKVQLATCIYRMAGGESIRTVQNHFNLSHGSVSLYTERSLIAIVSSL
                     KKYISWPSGEERAVIARELYAQYGIPSCVGFIDGTDIVLHQAPTVGSEKAHTMQCYEE
                     RDGYFKLIAVVDHLKRFRYGWFSYSAVANDQMAQGQSDLHGNPDRFFSPKEYVLGDAG
                     MKSSDTVIPLFKRERRQVGHKAYFNHKCAKAQVMIEQAFGILKNRWRILQDYHLTCRT
                     ITDEARLYLVIQACMVLHNLVLGTWKDSLTTSEVEEVMNISERVTDTGDEAANGRRDE
                     VVAEMVRDEVCKDPGFDVNTFEI"
     gene            complement(1145065..1148140)
                     /locus_tag="CNE04060"
                     /db_xref="GeneID:3257987"
     mRNA            complement(join(1145065..1145145,1145401..1145440,
                     1145552..1145938,1145992..1146163,1146218..1146498,
                     1146552..1146789,1146841..1146950,1146997..1147048,
                     1147100..1147389,1147439..1147937,1147990..1148140))
                     /locus_tag="CNE04060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657277.1"
                     /db_xref="GeneID:3257987"
     CDS             complement(join(1145804..1145938,1145992..1146163,
                     1146218..1146498,1146552..1146789,1146841..1146950,
                     1146997..1147048,1147100..1147389,1147439..1147937,
                     1147990..1148060))
                     /locus_tag="CNE04060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512936.1"
                     /db_xref="GeneID:3257987"
                     /translation="MSATPPRSSYQSANGGDKTPELTTKREKRHREDDEDDRDVSGRS
                     HRYRPEDVRDYDRDRSDRGDRDRDRERRHRHRRRDETEEERKERHRRREEETEEEREE
                     RHRRRRERELREREREREGEDDYRRGSREMSVGRPLSHRDRSRESHRSYRSHRDRDEM
                     PPIRPMSREPRDMAEERRENDRRREMHFADLERDGRMRSPPPRRRRLSPEYGGPRGPP
                     PRRPPPPPRDPATALIEEVDSEARSIFVSQLSARMTSQVLGLFFEDKLGRGAVRDARV
                     VTDKVARRSKGIGYVELDSVDLVNKALALSGTVVMGIPINIMLTEAERNHSGTELITA
                     TALASNARSHGGGGGRSSVPFTQNYPPLSTGLALPPGLDPDAHKDAAIPYHRLFVSNL
                     AFSLTADDVRQVFEPFGEIEFVDLHTDLSGLRKGTAYVQFKDVKSAQMALDAMAGFDL
                     AGRLIKVQTIQERGTYQTPDLIEDSGNYGTRLDANQRQQLMFKLARTEPNVNLSLSAP
                     KINGSQSKIPAMDPTPRIVVHNMFNPEEETERNWDLDLAEDVKGEVESKYGRVKRIKV
                     EKMSAGEVYIEFIDTDSAIKAVKGLNGRFFGGRQLQAGYITEALFNAHL"
     gene            1148310..1152540
                     /locus_tag="CNE04070"
                     /pseudo
                     /db_xref="GeneID:3257648"
     gene            complement(1148387..1151969)
                     /locus_tag="CNE04080"
                     /db_xref="GeneID:3257735"
     mRNA            complement(join(1148387..1148877,1148936..1149052,
                     1149106..1150149,1150208..1150658,1150715..1151015,
                     1151073..1151347,1151411..1151567,1151631..1151969))
                     /locus_tag="CNE04080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571062.1"
                     /db_xref="GeneID:3257735"
     CDS             complement(join(1148482..1148877,1148936..1149052,
                     1149106..1150149,1150208..1150658,1150715..1151015,
                     1151073..1151347,1151411..1151553))
                     /locus_tag="CNE04080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571062.1"
                     /db_xref="GeneID:3257735"
                     /translation="MSVAATRSEISHNPGKMSVTSAVSGEKVEGDVQSRMKLFGAIQA
                     FRDGRMPDNEQIGSVLEYAIGHSPVDLQKLSPEGRVLIDDFRDTLETLRMIVHEKNTD
                     ELFQNAVWSSYHSDVSKAKQDGVIPVSSEQAKQDGKTAASHIRVLITLFLTNSEARKL
                     LKDFGIVGRDIFATAATKAADKSRPSQEKLDSVDQEAPSHEWIGADGKRLGPNETPDI
                     QLKGPKGTQARYHPRDDPRDAQLIDDKGNSRSAGEAYNQAQEAKADAQSKAQDLKSSA
                     RDYKETGKQQARSHAQDVAGNRDPNASLSEQKEQVKGAAYDKKDAASAQAGQNLPDPN
                     DEGNQQKARGKVAELKDRIPDEHRQKAADYIQKSKNFVNDELPEERRDQFIYRLKKVV
                     VECQGHKDYQEAMTWLLDTLENYRGHAKHVTNKGTESAQTVSNDPAVGDSTIQFRTLL
                     ERFANGKSLDNVFSALDQIYTDVQNDSELREWFTTFNDYMHRVLLEPGYILDEDSDRE
                     AKQLRESGRRFFQEKYKAHQELLFDELQVWLTAFGEDPLNVRLGDDIKRFFKDLLFNH
                     EGNLTFKPKLWNDVRQVLIPMLLKQVSYVPIPRAEYSDNSIDLVIEDLILSGPNLFPN
                     IVHIESFNSFSFSPYPKLNKTMDNQHHKFRLSLSQIQADIRDVAFAFRRKSGWPKLSD
                     HGLADVILAGKGISVDVELESIENRRDTVFKTNFIHVNIDTLKFAIRNSKHDLLYKFI
                     KSTATGLIKRAITAAVQNAMHTALGHLDEQLVEIRNRVDEAKQSDETTRTEALKDLYS
                     RKKESAQEKKAAADEKTGTFKIVTDRDSQLNPELTHDGGKSWAKRAFKVEDAARTGKE
                     WRSPAFNLIDPAHPAVTGQHHPAVQNADVDAERLKQKAEAAAPGVAAGTKRL"
     gene            complement(1152623..1154164)
                     /locus_tag="CNE04090"
                     /db_xref="GeneID:3257510"
     mRNA            complement(join(1152623..1153133,1153183..1153442,
                     1153494..1153635,1153692..1153820,1153881..1153981,
                     1154042..1154164))
                     /locus_tag="CNE04090"
                     /product="expressed protein"
                     /transcript_id="XM_571064.2"
                     /db_xref="GeneID:3257510"
     CDS             complement(join(1153038..1153133,1153183..1153442,
                     1153494..1153635,1153692..1153820,1153881..1153981,
                     1154042..1154060))
                     /locus_tag="CNE04090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571064.1"
                     /db_xref="GeneID:3257510"
                     /translation="MSDDDWDADETIAPAAPAVTLPPKVPAKKWADEDAEDNDSDDDW
                     DKSEDEKPQATKVAAVAPAKKKGTLKQKLAEKERLAKEAKEKGVDDDNDLMYTMTEQE
                     RRRLAREKEQEADLAVASDLMGAVDLGDEGDALKSVLSAHPSTKNDFSELSKNIYTSI
                     IKKHESNPLYAHFVEQLAKDISAALTAVQTRKVSSALSVLGNTKQQEEREKASGKKKA
                     ASKPKLGAAKVLSKVDTEAYDDVLGDDDFM"
     gene            1154314..1155619
                     /locus_tag="CNE04100"
                     /db_xref="GeneID:3257871"
     mRNA            join(1154314..1154522,1154577..1154658,1154715..1155017,
                     1155069..1155169,1155216..1155619)
                     /locus_tag="CNE04100"
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /transcript_id="XM_571066.2"
                     /db_xref="GeneID:3257871"
     CDS             join(1154377..1154522,1154577..1154658,1154715..1155017,
                     1155069..1155169,1155216..1155555)
                     /locus_tag="CNE04100"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /protein_id="XP_571066.1"
                     /db_xref="GeneID:3257871"
                     /translation="MSHSPHPLATLEQIVSTPSAADGIPSDVEDDLRVAGCMLIQEAG
                     VMLKLPQSTMATAQVLLHRFYYVSSMCSFGVNDISISALFLASKLCESPVRLRDLINT
                     YLYLLARTQHLLNLPADQPFHPGLLSQSDESEKDKLWEGFKFSVPGFHDEIFWDWKDV
                     ITASEMQVLKRLGFNMQVDLPYNHMINYLKILDLVFEDDVTQMCWSILNDMLLTPLYA
                     IHPPHTIACISILLTTRLRRIPLPPKWYLLFDVSYDEIWSGCGVVMRLWIDWGLDRPK
                     GVIQRNKRTVNEEEEGRKIKESRWRRAWVLAQSRKAVRRWVEGLEKA"
     gene            1155775..1156574
                     /locus_tag="CNE04110"
                     /db_xref="GeneID:3257773"
     mRNA            join(1155775..1156013,1156168..1156574)
                     /locus_tag="CNE04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_571068.2"
                     /db_xref="GeneID:3257773"
     CDS             join(1155925..1156013,1156168..1156297)
                     /locus_tag="CNE04110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571068.1"
                     /db_xref="GeneID:3257773"
                     /translation="MVFGRLVHFTFDALAVSTILAGVKKTTGFAPATDLIPDSSIKSI
                     TDSYLGVGTTIFDIVAGQAVTSQYFKRT"
     gene            complement(1156463..1159052)
                     /locus_tag="CNE04120"
                     /db_xref="GeneID:3257610"
     mRNA            complement(join(1156463..1157026,1157082..1157204,
                     1157257..1157416,1157469..1157674,1157732..1157913,
                     1157965..1158044,1158096..1158182,1158234..1159052))
                     /locus_tag="CNE04120"
                     /product="expressed protein"
                     /transcript_id="XM_571194.1"
                     /db_xref="GeneID:3257610"
     CDS             complement(join(1156595..1157026,1157082..1157204,
                     1157257..1157416,1157469..1157674,1157732..1157913,
                     1157965..1158044,1158096..1158182,1158234..1158241))
                     /locus_tag="CNE04120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571194.1"
                     /db_xref="GeneID:3257610"
                     /translation="MTTPAAMAFSALTSLTGLLFIFWHTWHYDRWRCLLYSKDNWFRA
                     MMCHILLLSVAGLQVYTWIDVHVLYSEYWIYYPALEKTIVTPYQLYSKTHYNLFKTSL
                     YFITVAWGFLQGVHLEEFLYWGYLIKSINTPGGPQTSWLRSGFFKAWIGLFICSFALL
                     IASVHIENTNLDMIRAYLFCVGSSLSILLAFASVGLCLIFPSFLKNVRRQGANAEVLE
                     RLHFFSEMNEIRTACRLVYSICFLIISADAFTAEQRVNKSPFWSDTLYLSGQLGLFCA
                     TCLSVVVLLPRNMTSESLPTGNQDVQPIVPYNRPPPEGYSAKQFMELGERLNIGDESK
                     AIGLMTNPRGFEMQVSPPSDNHDDSSSGYSGRTKVNAPFAEVADKTKIARLSDLSGLP
                     SVVQRFKSPFETAEHKIKGPTQVFVTTSHTIAE"
     gene            complement(1159461..1162342)
                     /locus_tag="CNE04130"
                     /db_xref="GeneID:3257625"
     mRNA            complement(join(1159461..1160184,1160244..1160284,
                     1160343..1161215,1161271..1161377,1161430..1161470,
                     1161522..1161682,1161744..1162342))
                     /locus_tag="CNE04130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571193.2"
                     /db_xref="GeneID:3257625"
     CDS             complement(join(1159916..1160184,1160244..1160284,
                     1160343..1161215,1161271..1161377,1161430..1161470,
                     1161522..1161682,1161744..1161931))
                     /locus_tag="CNE04130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571193.1"
                     /db_xref="GeneID:3257625"
                     /translation="MLTRDLSSYGRALVVAGFLFNHLPCLAYIPALPVNDTSGLNLTD
                     SSTIAIAWTDPLGVYSGGVSFQLRADVDTGGTTSGALVHFSESTMGSNITTTTPWIAF
                     ISCDTNETIASMEWDIFTLARDRGASSALLYTTRSQTCLLNSEYITDFEKPLDVFATK
                     NVQVARVINNQFVHTNESFANYNATLLNQSALDVNQSLAGNYPATKTYLIGTLTARNS
                     TGQATSTYIPNATTSTSSDSSHNKRTSTPMIVLYTITGVVSVVFLIMLIMGGRRALRH
                     PERYGRREDEHADGGQSTAGGLAQAMLDTFPVIKFHTSNGKSSSNRTKRISLKDTGET
                     LPMSQIERGDGIDMDAFPNRESKRRPISKCDTEVSFHTALDTCESVPQLLRDRSESQA
                     SGSGGKSEEVAATAAATTMVHLEQVEAEDGQTCPICLVEFEDGDDLRVLPCKREHMYH
                     RGCIDPWLLQVSSSCPLCRKDFNNPQPSPSSTQSSQILSSESPSSPQGFARYLTFMRR
                     NRPRTRSTRTEGGGSSNTSRRQSRSGRDDGTDTAVGRGRMREADQSGPGGY"
     gene            1162551..1164146
                     /locus_tag="CNE04140"
                     /db_xref="GeneID:3257521"
     mRNA            join(1162551..1162833,1162891..1162977,1163033..1163385,
                     1163444..1163545,1163598..1163729,1163780..1164146)
                     /locus_tag="CNE04140"
                     /product="methionyl-tRNA formyltransferase, putative"
                     /transcript_id="XM_571069.2"
                     /db_xref="GeneID:3257521"
     CDS             join(1162650..1162833,1162891..1162977,1163033..1163385,
                     1163444..1163545,1163598..1163729,1163780..1164070)
                     /locus_tag="CNE04140"
                     /codon_start=1
                     /product="methionyl-tRNA formyltransferase, putative"
                     /protein_id="XP_571069.2"
                     /db_xref="GeneID:3257521"
                     /translation="MMLANQPFLLRIPLKRQAKTRSFCCFSATCKRRTAKKPFRILFC
                     GSDDFSVASLKAVYEAKDVWSSIDVVVPAEREIGRGGKHAHHEKYTPALRLYAEQNNL
                     PVSTIPSTGLKAWSPPEPFTSSDLNSSHMLLTASFGHIIPLRLLKLFPPIQRLNVHPS
                     LLPRWRGAAPLQWTIASGDEETGVSVQTLVRYALGVDAGDILGRAEGIKVPHDTRYET
                     LLPSLAGAGGKLLVDVLRKIQNGTVTTAAQDERYITLAPKITHETSRIDWEKHTAEMI
                     DRLHRGFTHQYPLWTSFLDTTAQILSLHPIPRLSLPMPLYQPEAITPGTGILYRQGKS
                     RRLFVACAGDSWLEVQEIKAAGKKALGIKEWWNGLPKHVRESGKVTFR"
     gene            complement(1163803..1165986)
                     /locus_tag="CNE04150"
                     /db_xref="GeneID:3257739"
     mRNA            complement(join(1163803..1164585,1164640..1164693,
                     1164743..1164918,1164970..1165028,1165077..1165191,
                     1165246..1165365,1165419..1165533,1165584..1165702,
                     1165754..1165986))
                     /locus_tag="CNE04150"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024657278.1"
                     /db_xref="GeneID:3257739"
     CDS             complement(join(1164424..1164585,1164640..1164693,
                     1164743..1164918,1164970..1165028,1165077..1165191,
                     1165246..1165365,1165419..1165533,1165584..1165702,
                     1165754..1165943))
                     /locus_tag="CNE04150"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024512937.1"
                     /db_xref="GeneID:3257739"
                     /translation="MPPTPCSLCHTARALVKRPKTGQQVCKDCFFEVFETEVHNTIVE
                     GEGIFKRGERVAIGASGGKDSTVLAHVLSVLNKRYDYGLDLYLLSIDEGITGYRDDSL
                     ETVKQNQAEYGLPLKILSYSELYGWTMDKIVEQVGKKNNCTFCGVFRRQALDRGAAQL
                     GVDHIVTGHNADDIAETVLMNIMRGDIARLARCTAVTTQSEDTIKRSKPFKYAYEKEI
                     VMYAYFKKLTYFSTECIYSPDAYRGHARVFLKDLEAVRPSAIVDIIHSGESFVLEQSV
                     QRGMKALQTCLRCGYISSNDLCKACALLEGLESGLSRSALRQTQESTSAAPEGHRTIP
                     MFERYASLNGTPRTPPTPAEPVEGIERAVRTIEIV"
     gene            1166212..1168858
                     /locus_tag="CNE04160"
                     /db_xref="GeneID:3257578"
     mRNA            join(1166212..1166486,1166543..1166755,1166807..1167968,
                     1168019..1168858)
                     /locus_tag="CNE04160"
                     /product="expressed protein"
                     /transcript_id="XM_571071.2"
                     /db_xref="GeneID:3257578"
     CDS             join(1166247..1166486,1166543..1166755,1166807..1167968,
                     1168019..1168752)
                     /locus_tag="CNE04160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571071.1"
                     /db_xref="GeneID:3257578"
                     /translation="MPSTMSEQDTPKGTERPLTAYNPPLPSNSTPFSFACRCLNVKID
                     GRVSASDEQKVLSKGEGGTSAQGSVEVFLPIGSEGVKFADYVVYDQDIISSREDKSGS
                     AIITEDSPEPSWRKCFICGTRCYRVKDKAQKDPAVEEEWVTVELNSGVVYGEKLSQAL
                     GQEGLPFTGLLFDPPSGQSNFGRPPTNPSPSSDPDSYLPSATPSIHYVPTPHDPFFLP
                     PPFIPSNPHLKDLCDQAEEYLREAHGRLEDEVRHFISLKTLELRDMEEKVRGEVELLW
                     DKYRNGPGKEEISRQRSASISRTRESSSRAPEPSSVFPPPRNPQSQKSFQATPPSPHA
                     TPNPIMQASIAPATSALPNGTSLLAHSLSQASFFPQPAINELGTDGEVPEEMRDEIDH
                     TISEVARTYGKKGDSRAVAMSYIFSSFAENMGGATQVSRVNQEEAESPENTGEAPNKD
                     SWIDQETDTARMARPTDQLDAVVEEDSADGATPRPKQTKPLRDDGKSGEKSKKGKEKA
                     KVKFEEPEKPGKSSRSADGDKTPTNTSEEEDYVFDFELEDRPSEPAEIVPFSLPHSSA
                     GSRNMLEANLSHTFAADLPSHRAAWRRIEQNGSMYEALRRERRSHPNDNLVDDSELSK
                     FATSVPIAINPIRAGQASVPVALERKTSLTDRPGIVVPGLGPAMREKGVARSNSLGLG
                     FPKGVQSSSARGRPSDQQRKTSRSASVSREREAVQSYAADPGAVFETLADGEGEEEEE
                     VENTTVAGKGTIMEKGFVPPHVLARQEDSKKLPDVGWRSLAS"
     gene            1169132..1170893
                     /locus_tag="CNE04170"
                     /db_xref="GeneID:3257883"
     mRNA            join(1169132..1169229,1169298..1169347,1169419..1169507,
                     1169563..1169772,1169831..1169933,1169993..1170189,
                     1170239..1170302,1170355..1170485,1170556..1170893)
                     /locus_tag="CNE04170"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024657279.1"
                     /db_xref="GeneID:3257883"
     CDS             join(1169160..1169229,1169298..1169347,1169419..1169507,
                     1169563..1169772,1169831..1169933,1169993..1170189,
                     1170239..1170302,1170355..1170485,1170556..1170748)
                     /locus_tag="CNE04170"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024512938.1"
                     /db_xref="GeneID:3257883"
                     /translation="MLLYTTRRLPSIIRPACTLRRLTTFSGGPFPKKLAFAFDIDGVL
                     KQGHNVLPEAKRTMKLLTGEDGRLPKPIPFLLITNGGGVLDHERLSLLSSELGVQLTP
                     DQLVQSHTPMRDYAHKYKDKHVLVIGGKGESCRKVAESYGMKNAHIPQDVIAWKSSIW
                     DRTELAKEEEAFVRPQDFSSIQFSAIFVMHDSHDWGRDTTLILDLLNSENGYLGTRTE
                     GRKNGEEAVELIMSNPDVEWRSDWPIPRLGQGAFRIGLEAVYKATTGLDLTYTQYGKP
                     FKATYDFSELSLRRYLASVGRDSSVPLHVYMVGDNPASDIAGANAHGWSSILVRTGVF
                     HDTHGEKPAYQPTAIADNVEKGVEWAIGKEMGLF"
     gene            complement(1170528..1172532)
                     /locus_tag="CNE04180"
                     /db_xref="GeneID:3257498"
     mRNA            complement(join(1170528..1170719,1170793..1172120,
                     1172174..1172532))
                     /locus_tag="CNE04180"
                     /product="expressed protein"
                     /transcript_id="XM_571192.2"
                     /db_xref="GeneID:3257498"
     CDS             complement(join(1170841..1172120,1172174..1172363))
                     /locus_tag="CNE04180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571192.1"
                     /db_xref="GeneID:3257498"
                     /translation="MPPRIPIRHCVELVQLGALLPWAARASSSPASHQVGKRDANGAG
                     EASGSEWKSRTKPRRPLLDVSKNPAIQQQSSDSEAVQTTVVHRLLAQINPPQPDEILS
                     HLKANPSDLTRSAGELLIAYSKRCGDVRTQKDVLRLMIDRRILSLGHAKRARDMKRNK
                     RAGGWKVRPNWWAMQTLPPVEFIPDSSHYTMSQLFGRLHHLLLLGEAPSFDHAWKLLE
                     NATDFEPMGKGKAKETRLEDTVLLNLYLAYLKTPPRSVASPSTLLEQYLLFSSQAPNR
                     QTLHLSIKALLSSPATYSQKVKVIPAEVISMISRFMNFQIPPGLETWRQIADYALNYR
                     LRKLGQMAWEGWFDCFHSSGHSQLYSLNPNQVNVKLGVRVKFERLGTQKKRWTKILRR
                     MELKHWVEKVGGNATEALAGDRWGYVWKGGGNYSTAPDVENVLEGRREGKEEVSEEKE
                     KSRLKIIPAASSPFLTNSRMAPFLLPPSMRSQASSPQSP"
     gene            1172995..1174565
                     /locus_tag="CNE04190"
                     /db_xref="GeneID:3257630"
     mRNA            join(1172995..1173339,1173393..1173887,1173937..1174049,
                     1174114..1174565)
                     /locus_tag="CNE04190"
                     /product="expressed protein"
                     /transcript_id="XM_571073.2"
                     /db_xref="GeneID:3257630"
     CDS             join(1173031..1173339,1173393..1173887,1173937..1174049,
                     1174114..1174393)
                     /locus_tag="CNE04190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571073.1"
                     /db_xref="GeneID:3257630"
                     /translation="MEFLTSSQEINKPKQLYPCLAVIDINSSSDVRSRRLSAGSFGSD
                     KDEGNVLTRVISGGGRRKSSFGETGGGGGGRRLSFGGKKDDDAKVEGKWYWRVQAGVN
                     ETHIVLLPLTQPSNPLLTTRPAPLSTAIPSHATHEASTHPNESAIAENEGDKNESGFA
                     SRMKNMFRRASSSVKERPSAPSASETTSGGPDIGGERVTDQTERGEMLPSAKGNVEGA
                     TNLNSNAELGWPGIINNEKLAAILIPLSSVGKKVGLGGGKKAEASWVTVQVTSSTQSM
                     EPIGTSRFDPTPKSGFIKFEFDKGWLGAKGEAEVLHHYITTAVAAAPAPIERTAPNPS
                     SFQLGGQQAASGATQQAQPSDPLFSGSPFANTGAAGETAERPLIDEAIAPDVSATSSR
                     KVAGVY"
     gene            complement(1174568..1175960)
                     /locus_tag="CNE04200"
                     /db_xref="GeneID:3257795"
     mRNA            complement(join(1174568..1175212,1175268..1175429,
                     1175479..1175960))
                     /locus_tag="CNE04200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571074.2"
                     /db_xref="GeneID:3257795"
     CDS             complement(join(1174587..1175212,1175268..1175429,
                     1175479..1175893))
                     /locus_tag="CNE04200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571074.1"
                     /db_xref="GeneID:3257795"
                     /translation="MSINVALLGSGVFAQASYVPALLSLARFRTLVLHTIWSRSESSA
                     QTLHDKYTSVGAPSPQLLYGDDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKH
                     VLSEKPLARDVKEAMELIEEYERDYKPKGLIWRVAENYAHEPALRFAGDILAKTPELG
                     PVLFWDLKFTSYVEDGSKYHATGWRTIPDYQGGFLLDGGVHWAALLRTVLPPAALPAS
                     FIGFASLHRTHLLPHDTVQAIALPIPSATIPPNGPKSKLDSAVHTEKDLTSQPGQSTP
                     RGQITFSFAKPDMPPEGRTSNGFVVTLLNGVLTVEQTFDRQFITTLIPAEGSGLEKKT
                     ITTRQVGVEVEIEMFVNAVQAVKEGRENKEENFGEPRGALWDLSVVEAMLKSDGKEIS
                     LESLIKGE"
     gene            complement(1176170..1177649)
                     /locus_tag="CNE04210"
                     /db_xref="GeneID:3257591"
     mRNA            complement(join(1176170..1176485,1176546..1176575,
                     1176628..1176801,1176850..1176871,1176927..1176985,
                     1177057..1177171,1177237..1177253,1177319..1177649))
                     /locus_tag="CNE04210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571191.2"
                     /db_xref="GeneID:3257591"
     CDS             complement(join(1176441..1176485,1176546..1176575,
                     1176628..1176801,1176850..1176871,1176927..1176985,
                     1177057..1177171,1177237..1177253,1177319..1177405))
                     /locus_tag="CNE04210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571191.1"
                     /db_xref="GeneID:3257591"
                     /translation="MASIFNGIFNWFLSLFFAKHLEVTIVGLQASGKTSLVNVLGSDQ
                     WSEDVVPTVAFNLRQVRKGNVTMKIWDVAGQPKFRGMWDRYCRGADAIIYVVDAADHH
                     SIPTATSELHALLNIPALASVPLLVLANKNDLHGAMGVDDLIKEMRLGEIGGRAVSCY
                     STSNKTKHNLDIVLAWLTQRAH"
     gene            1178137..1179491
                     /locus_tag="CNE04220"
                     /db_xref="GeneID:3257995"
     mRNA            join(1178137..1178181,1178342..1178404,1178462..1178839,
                     1178903..1179049,1179102..1179230,1179284..1179491)
                     /locus_tag="CNE04220"
                     /product="nonhistone protein 6, putative"
                     /transcript_id="XM_024657280.1"
                     /db_xref="GeneID:3257995"
     CDS             join(1178360..1178404,1178462..1178839,1178903..1179049,
                     1179102..1179230,1179284..1179307)
                     /locus_tag="CNE04220"
                     /codon_start=1
                     /product="nonhistone protein 6, putative"
                     /protein_id="XP_024512939.1"
                     /db_xref="GeneID:3257995"
                     /translation="MSAPSWEEMEAKRIEMIQSLREVSSAMTRCVHVIEEYTSLSPVN
                     LSKPDLLQPLTAGGPLAVALASGLADAGVGGTGKKERKKKEKKIRDPNAPKRPPSAYI
                     LFQNEVRDDIRTSNPGMPYKDVLQIISQRWKELPDSEKKIFEDAYAAAHNNFRAEEQA
                     YAKKDAVEVDPVLMESSDDSSDDDSSEGGSTPAAPIPAPTLAAAEKNKKDKKRKTKEE
                     EAAVNAVLGENKDKKKKKKSKD"
     STS             1178743..1179368
                     /locus_tag="CNE04220"
                     /standard_name="Stu3"
                     /db_xref="UniSTS:470924"
     gene            1179825..1182544
                     /locus_tag="CNE04230"
                     /db_xref="GeneID:3257626"
     mRNA            join(1179825..1180187,1180256..1180505,1180555..1181520,
                     1181594..1182544)
                     /locus_tag="CNE04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_571076.1"
                     /db_xref="GeneID:3257626"
     CDS             join(1180274..1180505,1180555..1181520,1181594..1182312)
                     /locus_tag="CNE04230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571076.1"
                     /db_xref="GeneID:3257626"
                     /translation="MALRFRNATPGTILCLAATILLAIVSFNTPLLKSLYFLSATFSS
                     GSYEGTMQLGTLGFCVTLNDATNCTGPTVGYEFDPNTVFGISSFDIPEAITKYLTYVL
                     ILHVVALGFAAIAMIVAIFAHSPTFPLMCLSIWMAGIASTITLIALIFDLAMFYIAKS
                     RIDSVDGASAEIGISVWLTLAAWLVLAIGGCFFGIGNCCGSCREERETGDPRRKYDKD
                     DREEEDYKMRMMAIDNERRRKQAQEQDLPSFQELSPLKDEEEDKYLIEPQRDQQDLAR
                     NGSVVQGVGVGYGRRNNRTPVNEYSQQPGAFAWGQPRGYQTLQNIQAPPRAARRLSDA
                     TSAGDFVGIGAGGAGVDVPPVPPLTQHQSSQQGYGQGYYGENQYNEQPGQYGQSYAEQ
                     NQYGNNQNYNDPYASQQQQTPYDPYTQTTYNNEPYISSNLSTYSATPAPVAMPTPAPT
                     RSPPQSVPITQPMQSSNPNPYNYATVGSSESYDPGPRVTQADPYDAYDDGLGAIGMAA
                     TSGMGRHARDYTGQTFASSSSYPPQQQAQGSSGSRGIQEPRPRHLVNQNNSSLLASPV
                     STTSPIDHTRNEIIGQPMMIPSGSGFGSTNAAAGGYADDLLDVNGSSNRPPSYSAGDY
                     AVQNTAVPEKSSYN"
     gene            1182717..1184123
                     /locus_tag="CNE04240"
                     /db_xref="GeneID:3257865"
     mRNA            join(1182717..1182963,1183030..1183155,1183311..1183441,
                     1183527..1183637,1183716..1183743,1183955..1184123)
                     /locus_tag="CNE04240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571188.2"
                     /db_xref="GeneID:3257865"
     CDS             join(1182930..1182963,1183030..1183155,1183311..1183441,
                     1183527..1183637,1183716..1183743,1183955..1184019)
                     /locus_tag="CNE04240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571188.1"
                     /db_xref="GeneID:3257865"
                     /translation="MLNYVMLVSRQGKVRLAKWFQTLPTKTKNKIVKDVTQLVLARRT
                     RMCNFLEYKDTKVIYRRYASLFFITSISPGDNELITLEIIHRYVEVLDRYFGNVCELD
                     LIFNFQKAYAVLDELIIAGEIQESSKKTVLKIVAQSDAIEEAEVAEDSLARLGSLARG
                     GQVG"
     gene            complement(1184105..1185085)
                     /locus_tag="CNE04250"
                     /db_xref="GeneID:3257902"
     mRNA            complement(join(1184105..1184235,1184284..1184359,
                     1184416..1184482,1184538..1184640,1184699..1184758,
                     1184814..1184935,1184983..1185085))
                     /locus_tag="CNE04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657281.1"
                     /db_xref="GeneID:3257902"
     CDS             complement(join(1184227..1184235,1184284..1184359,
                     1184416..1184482,1184538..1184640,1184699..1184758,
                     1184814..1184935,1184983..1185016))
                     /locus_tag="CNE04250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512941.1"
                     /db_xref="GeneID:3257902"
                     /translation="MPGLRLATKRLMKELGDIESKGTPPGISLLSADSMEEWIFTIAV
                     LGDETIYKGEQFALRIKFEDRYPIEVPQVTFVVDDMWQAPIHPHIYSNGHICASILGN
                     DWSPVLNAVSICITMQSMLASNKSKVRPEGDQRYVRNAPANPKLTSWKYDDDTV"
     gene            1185298..1187623
                     /locus_tag="CNE04260"
                     /db_xref="GeneID:3257560"
     mRNA            join(1185298..1185446,1185839..1186204,1186258..1186507,
                     1186562..1187381,1187432..1187623)
                     /locus_tag="CNE04260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571080.1"
                     /db_xref="GeneID:3257560"
     CDS             join(1185348..1185446,1185839..1186204,1186258..1186507,
                     1186562..1187381,1187432..1187543)
                     /locus_tag="CNE04260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571080.1"
                     /db_xref="GeneID:3257560"
                     /translation="MAEQQTTELTNIDLEAGSEWRFELEADENIALRTLSSDPVFINS
                     QELTPSAWYPIYRHTKSALYAPTSARIQVTNLPASHYTSTSTVQPQLLNLHLAMERQR
                     ILSKRGMEQRGPRVMIMGPQSSGKTTVMKNLVNLALGTGMGWTPGAIGLDPSSPPNLI
                     PGSLSISTPSHPIPTHHLAHPLGSPPASTAANTISGDVETASWWLGALEPTNKNAEVW
                     RVLVEHMAEAWGMRCEKDKIANISGLFLDTPAAFTVPTLGTKKDDPKARYTLVSHAIQ
                     AFDIDTIIVIGHEKLHIDLSRLPLVQSRQLNVIRIPKSGGAVDLDDHDRETAHIFQVR
                     TYFYGEPPLPPQISSLVGKMVSLDFELSPYSFQIPWSRLVVLRVGEENSAPSSALPLG
                     SSKILSPLRLTRVDPSGPGHVVRLLNRVLALVDVKPEDRIVPAKESEVKEEVKEEKNE
                     KDGEIKQDGEGEKKGEGKGEGEGEGEGKDGEEEGEAEGEDDEEEVPFREEIGTREVMG
                     FIVITAIDTFARKYTVLSPTPGRLPTTVAIAGAIEWVDSA"
     gene            complement(1187610..1190909)
                     /locus_tag="CNE04270"
                     /db_xref="GeneID:3257748"
     mRNA            complement(join(1187610..1188244,1188335..1188592,
                     1188655..1188773,1188851..1189388,1189446..1189625,
                     1189679..1189792,1189856..1189981,1190044..1190404,
                     1190465..1190767,1190826..1190909))
                     /locus_tag="CNE04270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571081.1"
                     /db_xref="GeneID:3257748"
     CDS             complement(join(1187697..1188244,1188335..1188592,
                     1188655..1188773,1188851..1189388,1189446..1189625,
                     1189679..1189792,1189856..1189981,1190044..1190404,
                     1190465..1190767,1190826..1190891))
                     /locus_tag="CNE04270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571081.1"
                     /db_xref="GeneID:3257748"
                     /translation="MAAIPKHRQLPDKESKLFRELLTQYELKQYKKGLKVADTILKKF
                     PNHGETLAIKALTLHSSLPDPPTASSVPKREEAEAMARLAVKKDITSHITWHVLGILA
                     KNRKDWDEASRAFAMARRQDPDNIPLIRDSIALLTHTRQYDAAVQVRHHYTVLRPQIR
                     SAWLGLVIAHELAGDREEAIKTYDLYQSAVQTEGANAQEKAQILLHIIQLCVDAGRNE
                     EALERLEKGIKEGVISPRGEVSQIKADILTALGRTNEALQTYQDLLKQNSDNLAYYRG
                     YFKTKGVDIAGPFDDATRANLLQSLDEFSQAFPRSTAPRRLALDVAQGDKFRELAQAY
                     IIKGLERGVPSLFVDVKSIYSDQEKMVIVGEIVEGIIQKLEKDSTLSNDGTISPPTVL
                     LWAYYYLALHLAHPLNPIPSYTRSLHLLSLALDHTPTLPELYMAKAIVLKRSGDPLGA
                     AHEMEKARLLDGQDRFLNGKAAKYWFRAGDVEKAEQLLGIFTKKDVTPAQDLTDLQSL
                     WFLQESGDAYRLNGNIGMALKRYQTVAKVFQEYEDDQYDFHGYCARRMTFQAYTHLLK
                     YEENLRSHPGYAKAALAAIDVYLRVNDDPSITEEKLTPEQEADRKKAAKKAQKAEQKA
                     KKAAAASGEKKEEPPVADDDPDGQKLLKSETLLDDALKLWKPLEAKQGERVEVWLAGY
                     EIYIRKKMYLAALRCLLQAQALSPSDPTLHVQILAFNRLASSIPADVPEPVVSTIKQS
                     LPTLLPTGKSPEAFNAEYIEAKKAAGDAKGLLGAAKGRLEVDPEDVDGAIDILRSLVS
                     VQADVKTLQEALVFAEAKAGTEKTEELRRLFVEKAPLAWVLRGQQEKEKRKEELVKEA
                     TAQAEGEKEGKADV"
     STS             1189522..1190066
                     /standard_name="D1S3690"
                     /db_xref="UniSTS:474268"
     gene            1191003..1195713
                     /locus_tag="CNE04280"
                     /db_xref="GeneID:3257546"
     mRNA            join(1191003..1191371,1191418..1193915,1193983..1194110,
                     1194193..1194414,1194513..1194747,1194813..1195065,
                     1195127..1195347,1195407..1195713)
                     /locus_tag="CNE04280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657282.1"
                     /db_xref="GeneID:3257546"
     CDS             join(1191162..1191371,1191418..1193915,1193983..1194110,
                     1194193..1194414,1194513..1194747,1194813..1195065,
                     1195127..1195347,1195407..1195638)
                     /locus_tag="CNE04280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512943.1"
                     /db_xref="GeneID:3257546"
                     /translation="MASPPHENDEERPQSIAALRSKFESLAVAGVNSAPTDVPSASNG
                     HATVSSTRNGLLTPRPETPVDGQNAKPVPPPKPASRPVSPASASPVPKPASLLPRPAP
                     RQAPSRPTTPKPSFQTHHSTSSVTSVVSATSDSHLNPSDTIASSPAIISPALLPAPAP
                     LRKSAPSVPSKPPSVAVTPSGSDGDEKEPVITSVKALRAKFSGQAQAGETALRKPGDV
                     PKTAAVPVVKAAPVHDSPEPLRAPSPAPIPAPVIQRTLDGKTSPVILSPASEGEAPSD
                     TNDYPSHPSPPPPPPAPISRTSSPVPVPASSGPPPINRAHKPPRTAASPAPISRPESN
                     APTPNSTPPPIPGNKPVVPSRSSSAPEPAVPPPPPERLQPPQLPVRRPTFSSPDTLEP
                     STASVVSPPALASTPLLHTIHDNNTSARAPAPAPPPLPDRSRANTINRSESEPSTTTA
                     GPPPPRLPARHAAIPVSASGGPTSFNANGSESTTMNPPPPPAHPASPSKARTNSGGPP
                     PPLLRSATINRGSSVGSGNGSGGGGGGSPPRRSNTISRAAPYTQEKYSASATSLSLGE
                     KEVYSDEDDEPEEPGAVTNLSAQAKRMLDEFPDMTEANRRPPAFVPDIRIKDCHHVSA
                     FAVYGRYVCMGAHHVRVYDTQLSDHAISVVDLKETGLESRGKDPKVTAMCFRPGATES
                     EEGRYLWCGTKDGHLWELDISTGEVTSTKAFVHTSSISYIWRHRKNIISLDEGGKLLV
                     FDVGDIEGKPPTMARQLRIGDKFGFAKFICGKLWTSSGPLTRSTTSSATSKGPTVRIY
                     DPCAPGTMPPPKTIFATEWAGAVTSATYMPLHHDTIFLGHEGGFVSVWDGKELVCKQV
                     LKISSTDVLALEGVGEYLWTGNRKGQIHVFDIKEKPWLATNIWIGHPDNPVQSLVVDP
                     YSIQSAGRYTCWSFARDALRAWDGLLSVDWIDKQLTARQSSFCTFRPANVLICTWNID
                     SAKPTDLNGSVANAHFLEDVLRSVDSPDIIVFGFQEVIPLTDKKYTAKTLLFGNKSKD
                     GGAAADRVSHAYRHWLEKLQSAVKMASPSNCPYVKIHSESLVGLFTCIFVKQSEKNFL
                     RDLDITTVKRGIGGIYGNKGAIVSRLVMDDTSICFINVHLAAGQSQKASRNADLAGIL
                     EDKAIFPPADELPFVHGGCGTGILDHEMVFLNGDLNYRIDQRRENVISSIANGELAYL
                     LEHDQLRKEMRTNHAFRLRNFEEAPITFAPTYKYNPGTHDYDSSEKRRIPAWCDRILY
                     KKSPRVQALNYQRYEPTVSDHRPVSAGYTITLKAINSLKMMDVRREVTGEWAEREKEL
                     LEKMQEVFDGIE"
     gene            1195817..1198385
                     /locus_tag="CNE04290"
                     /db_xref="GeneID:3257519"
     mRNA            join(1195817..1196455,1196510..1196675,1196734..1197073,
                     1197131..1197271,1197342..1197557,1197624..1197767,
                     1197853..1198018,1198095..1198385)
                     /locus_tag="CNE04290"
                     /product="GTPase activating protein, putative"
                     /transcript_id="XM_024657283.1"
                     /db_xref="GeneID:3257519"
     CDS             join(1195909..1196455,1196510..1196675,1196734..1197073,
                     1197131..1197271,1197342..1197557,1197624..1197767,
                     1197853..1198018,1198095..1198297)
                     /locus_tag="CNE04290"
                     /codon_start=1
                     /product="GTPase activating protein, putative"
                     /protein_id="XP_024512944.1"
                     /db_xref="GeneID:3257519"
                     /translation="MAHAPSAQLGLSTAPPPPAAPSRDSTLESAGQASDIFDLYGANE
                     ESAPGSGEGPMGALYGGRDAVQEQPGPMPETTPNINIITSPPAPLSPSHSQSPAHSRP
                     HTPIKHRFPSIISTQTDSTANSPVRYSDMQRLSPANTGSKRGSMCTGIFSGTDGTRSQ
                     TSVAASSRYPGEEEDAFHVRSTYARLGGQGVHGDGWDQGVERTRGGSTMADKRMTVFP
                     AAKTGDIGEKERQFLASLDRYGFVNDPHRNRSESRVVSVPSSTLIKIPKMPTISPLSG
                     NPPAQPNNNFTPSSDPGPAPKPPKSPRTDPDSEVKAKRKEGERVMKWGKMMKVKRRDG
                     GGNIIEWQWSRDGEGAKLANRVYKGIPDRWRMAAWWTFAEEQAQKWNGKGKGKSTAQE
                     LTSDYTEAVNLPSTFDVQIDLDVPRTISGHTMFVTRYGTGQRNLWHVLHAFSQRCPTC
                     GYVQGMGPIVATLLCYYDPERAYSLMVRLHDVYGMHEIFEPGFPGLLEAFYVQERLME
                     WLIPDLYQSFQRNMISTTAWGTKWYITLFVNTVPFSQQLRIWDVLWMEGRDAIIITSL
                     AILWSFRDLLAAPNASFESILSLLSSYFVPEDEDVSMQWIKKVLNQKNVREKMDGWRV
                     EWKKLVEEGKSGSALL"
     gene            1198990..1201489
                     /locus_tag="CNE04300"
                     /db_xref="GeneID:3257967"
     mRNA            join(1198990..1199216,1199265..1199470,1199522..1199579,
                     1199629..1199661,1199719..1199958,1200014..1200030,
                     1200082..1200137,1200195..1200260,1200309..1200448,
                     1200507..1200722,1200777..1200827,1200879..1201100,
                     1201158..1201489)
                     /locus_tag="CNE04300"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_024657284.1"
                     /db_xref="GeneID:3257967"
     CDS             join(1199214..1199216,1199265..1199470,1199522..1199579,
                     1199629..1199661,1199719..1199958,1200014..1200030,
                     1200082..1200137,1200195..1200260,1200309..1200448,
                     1200507..1200722,1200777..1200827,1200879..1201100,
                     1201158..1201352)
                     /locus_tag="CNE04300"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_024512981.1"
                     /db_xref="GeneID:3257967"
                     /translation="MNFIGLWSLALLGSQFTSVIATPLRVPQVPFAEPSLLPQDETVQ
                     KWTSQDVKDQEMAKLLNQYAPIFKLSKDERYFPSSVDYMLPHYSFIEDVSGDTYPANH
                     TILTPCHLDTLPLAGAYLFLSINEPHNPQPSLLEKESHYLYGPAGQEEELEKRKKNNE
                     RGRIEEPVYGFWVDQNRGVVDLWYWAFYPLNFGKPAGRLGILGNHVADWEHLRVRIVD
                     GVPVSADYSTHEGGRLSAGTVRWEDVEKVHDRPVAYVAMGSHGVWPEPGDHVYADLGN
                     IFKIVDKTDDEGPIWDTLDNVIPVRYWANAHDRTRVRHAGKDSWRNFKGRWGNKGETD
                     CWWHPITGFCQVVDAPPGPNRDFGVPPECIVAPRATEYSTYNFYLSSHAVEWAEENGI
                     TMVEVEQTCERPRRGKGDDDTSVEDVETWSTKGSILFRGKDQHSAHLPECKGVQSSVR
                     GYRISLCLINGQCLTTSRERRICSYEPGERGNKPGGAVIVNDIDDWRWNY"
     gene            complement(1201436..1202531)
                     /locus_tag="CNE04310"
                     /db_xref="GeneID:3257613"
     mRNA            complement(join(1201436..1201628,1201689..1201848,
                     1201910..1202088,1202160..1202531))
                     /locus_tag="CNE04310"
                     /product="protein targeting-related protein, putative"
                     /transcript_id="XM_024657285.1"
                     /db_xref="GeneID:3257613"
     CDS             complement(join(1201531..1201628,1201689..1201848,
                     1201910..1202088,1202160..1202415))
                     /locus_tag="CNE04310"
                     /codon_start=1
                     /product="protein targeting-related protein, putative"
                     /protein_id="XP_024512945.1"
                     /db_xref="GeneID:3257613"
                     /translation="MFARSFSNASRTIARRSLSTRSGPAPSSLWSSRNAVIAGTTLAI
                     TALAVTSERRKVFNESAQKATSPRDSIIAQDSLKENVHKKSVRQDEFSGESTKPEAST
                     SSDSVEKAADDAAQILEEKEAEASEPSQGAYNPETGEINWDCPCLGGMATGPCGEQFK
                     AAFSCFVYSEAEPKGVDCVELFKVMQDCFREHPEIYGEEIDDDEAPAQEGTMEEKVEA
                     AKEETAAPAAAP"
     gene            1202670..1203501
                     /locus_tag="CNE04315"
                     /db_xref="GeneID:36392879"
     mRNA            join(1202670..1202776,1202916..1202955,1203022..1203076,
                     1203151..1203501)
                     /locus_tag="CNE04315"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658543.1"
                     /db_xref="GeneID:36392879"
     CDS             join(1202698..1202776,1202916..1202955,1203022..1203076,
                     1203151..1203351)
                     /locus_tag="CNE04315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514390.1"
                     /db_xref="GeneID:36392879"
                     /translation="MGDIADLTTKTYDIARLIPPGRVTSYGHIAKLAGYPTYSRHVGN
                     ALKMLPADSEIPWQRVVNSKGIISPRGDSGLGVARQKERLEDEGVEVETLAGAGGEKV
                     DLRRWGWFPETLPQDGEELSQR"
     gene            complement(1203093..1204593)
                     /locus_tag="CNE04320"
                     /db_xref="GeneID:3257584"
     mRNA            complement(join(1203093..1203961,1204031..1204593))
                     /locus_tag="CNE04320"
                     /product="phosphatidylinositol transporter, putative"
                     /transcript_id="XM_571089.2"
                     /db_xref="GeneID:3257584"
     CDS             complement(join(1203505..1203961,1204031..1204467))
                     /locus_tag="CNE04320"
                     /codon_start=1
                     /product="phosphatidylinositol transporter, putative"
                     /protein_id="XP_571089.1"
                     /db_xref="GeneID:3257584"
                     /translation="MSAVEAPSASQAIWPELTEDHPLSQLNSRLPTILSEAGHSQIWG
                     VTLTYSTPPTFSSLIILQKFLRSVDNNVDEAATALGKTLKWRKDWGLDARADKKEKEN
                     FGPDFEGLGYVTKIKKNDGGDEIVTWNVYGAVKDLKSTFGDLDRFLRWRVNLMEEAIA
                     HLHLATTSTPIPDFNAGIDPHRMAQVHLYEGVSFLRMDPHVKAASKATIELMAANYPE
                     LLSRKFFVGVPLIMSWMFQAVRMFVSAETAKKFVVISYKENLANELGELEGVPKEYGG
                     KGLSLGELQNQLRGEDAVTSS"
     gene            complement(1204892..1211934)
                     /locus_tag="CNE04330"
                     /db_xref="GeneID:3257731"
     mRNA            complement(join(1204892..1205331,1205386..1205622,
                     1205676..1206011,1206065..1206708,1206757..1207624,
                     1207686..1209134,1209187..1209996,1210064..1211519,
                     1211611..1211934))
                     /locus_tag="CNE04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657286.1"
                     /db_xref="GeneID:3257731"
     CDS             complement(join(1205107..1205331,1205386..1205622,
                     1205676..1206011,1206065..1206708,1206757..1207624,
                     1207686..1209134,1209187..1209996,1210064..1211218))
                     /locus_tag="CNE04330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512946.1"
                     /db_xref="GeneID:3257731"
                     /translation="MYPDNNYLHLHTPTPLPSSRHHPRPHALDPNFRFSPAPPQPNFH
                     PHQTYTAPPYPNSHVRSNTLPFNAEILNLHSRHNLPVLNTSQGPKFNGSHVSAGVYMP
                     NGKPITSVFTPQTLTPGLTPPPIGKAWTCDPSTLSVISPLNLNGPNSFPVSWLPLSLD
                     SHSQSKGASASQPLALSHAPHISEWRSGSSPGAHDGRKTRLHYYDDLSEKGHKGLRGR
                     VGGPPKAILGGPGGKTFDEMMAEKEKSQSSVKPLSTDSPATTPAQELKPTTPPPGVEK
                     TKQTPTEPIIRKNKDTVIPMPCKQNNPAYSPPSTLHDKNEDDAKSDTSGEPRLLHMEA
                     IPWPPSQFLASEGTPLPISPSDLTHESLGDAVSEALFPSVQGDGGHIWKGKDKWGSLE
                     RERHKGEDEHKEVPGIFPEGEVAGMLPAISDGSEEERMLESNQRGGSADMVDKATSPR
                     NVNCVMGDHESKGVCTQKVSLVPGDVGLTACSPSKTSFPLSTESFSEEHAQLAAPDRY
                     HPPIDPAHVNHIHHDHSRVSPPNTERSMDSSTSSKRSFNAMTGAFARRQLGDILKPKA
                     NRDGKPRVSLRLSATPDVGRPPLSPQDPNIVQHLERIIDQLKNEGCNAYTEKGWDNDE
                     NEKLFSEDKHEKSGRTDATVVEHVEVESIQAQPPSLREVRCKGLESFLGHKAEPKQDL
                     AQQPPRLEEVRQKVLNSMRTRSDGAQSVQPQSSTEPGKANSPIVDLHGSLQEGEAKKI
                     YTYQEKSTPSENNPPSKRLRPTAEPWHPSRAFSSNDAIASSMLGLSILDQKRSLRPTA
                     ATFTPSQVKSLIFDAFPRSEENESAWEKRYFRVSSSASSNPTNDLRPAAAEFVPTNPH
                     VFQPRLTTFTFAFPPAGVLQDSEYHHHAFATPGFMQHEPSSCPGFPALDYEVPQTKLE
                     SYAPPFIRGSSTSGEFKIRATAPPFVPSDLYSSISSSPAFPSSRALSATPLATATKVR
                     TTAAVFVPASAVAIGSASPASPSLAHPVHDAGRSASATLINDDDRRIRDLEGHGRGNT
                     ILGDSESSINAQISGQTKGSTQTSPGISPNPAIIGALSEADTPASKGHKSRLDISHVE
                     VEKTVIQVEADELVSGEIGLHTINTFCREESPMPSVALDSTVDLSVSIHKNDPGSWES
                     DLTPGTTNQQPSQREQNSDLSRGTPGLSSGGNEVIVPLEDIVIHPSQPTQSPRTTPIL
                     RDVEVESFNVPDVPHSASTAHPQYMENEVDSDVIRKDVDLNPDVKPFEFSFQFSDPSP
                     EYFATQEVGDPDENKFTAVEELSERSLPGSAQSTSCQLSPLENEDFDRRIRSAAPSPQ
                     MIWEEPDGRNDRLNPPSSEASHCLMEDDHHSLHSLANSLAAHPRPPDLSSVYPQKEKI
                     GPDAESHLYGFDASAVPGDLELLKKQEERKDSWEWNLGSLEEGIVQAFDKLLNQQHGQ
                     GTGSLANVFNILEQQGQLLRSLQGTLSRTDESLVSEEHKSSSQELFTAILTSQHAILS
                     KFDEVASIRLSSTDDLHAAIAALHNAEDAANARTRKTEEQSREIGALKIKVEEATACD
                     VKLRAEVDELKQRLRDTRQKRDELCSSLEEKENRLKDAMREKMRADEETGRLVTRALA
                     AELETDVLARSLVELREERKDAEREREQVRREAAHDKLRLEAKISESETSRVEIKNTL
                     YATQKALEEARATLQAPPASLSPLATASALAEVGQAANTFHEEVLSRMSHLDDEMHET
                     MGSRVKEYENVLEQNRRLLGELDGLREKLEKSTSDHVSLEKKLLPQLAALEAKEKFNV
                     GKLEIEAKKAEESEKKVAGMQMHMTKMQEQLIRWQIEVATRQSEASMNEIRLQTIIQE
                     STYWREFALNTDRRRFKTYIASKPFESRDQSPVDTSQTQRAVSSPLPSLVEKPSQPAS
                     VISGNAL"
     gene            1211968..1214370
                     /locus_tag="CNE04340"
                     /db_xref="GeneID:3257689"
     mRNA            join(1211968..1212732,1212809..1212825,1212962..1213676,
                     1213729..1213799,1213847..1214370)
                     /locus_tag="CNE04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657287.1"
                     /db_xref="GeneID:3257689"
     CDS             join(1212139..1212732,1212809..1212825,1212962..1213676,
                     1213729..1213799,1213847..1214273)
                     /locus_tag="CNE04340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512947.1"
                     /db_xref="GeneID:3257689"
                     /translation="MSVHSSAPLPNRAVSSLRSRQQPIAEYQPLDFDREASQAAYQEC
                     LHNENAASIANLGANTARSTSTAVSNGTNLPSSQATISEKQAGMSSASSDYKPNEKTT
                     NLTGAGRNYQAQPQETAAPLEKSGRPSIVSPVAGSSAPPLPPREAIPQVNNSGPTPGD
                     LARPPSYPGKNLQTVDEEDRGKGKRKALPPVPADVPTQEPAPWQPDYKPQIPESLIAP
                     SVQHAYTSLSAPPPNIQQRNKPPVNMPQPVGYMTASAGVPSSSKPAPRPASIRTGSQT
                     GGQLTAEPVTLSPTGSVPSPSSSPPPRPRPEAETQVTIKAPDKTPIWSTHYLDPCLRS
                     TVIHVPHQISNIANVALSGLASGPKEMFNTTIGAPIDGLAREVKGWTIGADGKFSTEE
                     GGIELGIGVIRSGRVEGEGGKEGKEKGKDKGRKIARVEVNSKKGGVKVDVVEIDRHRQ
                     IDLRVETKSGDVLVLLPENFLGPIHITSPQCPTYLPIISPLIKPTVNPYANFYTTYMV
                     PLALARDPKHSSSREYTTAKNIEKYVPKSFREENDILDQVTGGYTSHVRKSWSKLNIK
                     TEKGRVVVGMRESKDEEVVKELGLRVGRIDGVKKDKKWWKL"
     gene            complement(1214435..1215235)
                     /locus_tag="CNE04350"
                     /db_xref="GeneID:3257834"
     mRNA            complement(join(1214435..1214536,1214590..1214691,
                     1214743..1215235))
                     /locus_tag="CNE04350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571097.2"
                     /db_xref="GeneID:3257834"
     CDS             complement(join(1214529..1214536,1214590..1214691,
                     1214743..1215187))
                     /locus_tag="CNE04350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571097.1"
                     /db_xref="GeneID:3257834"
                     /translation="MPKKTNAAATSKPAKPAQATVTDIDDIFAKPKVSKSKPESVVES
                     EKKKSKGKSKAVFIEESAAPSVSIESGDKEKKKKKVKTVASFIPDEDERESSSKVETV
                     IDPSTIPVVLPEPPATTKTKKDKGTKRDRKEDEDDEIFRDSRGTGPRRKTEEGFLIYK
                     EAELKIDPEAGGTPLCPFDCECCF"
     STS             1214894..1215695
                     /standard_name="Hind33"
                     /db_xref="UniSTS:470923"
     gene            complement(1215412..1220510)
                     /locus_tag="CNE04360"
                     /db_xref="GeneID:3257758"
     mRNA            complement(join(1215412..1215984,1216035..1217480,
                     1217546..1218056,1218130..1219455,1219508..1219810,
                     1219865..1219927,1219978..1220121,1220175..1220266,
                     1220321..1220349,1220410..1220510))
                     /locus_tag="CNE04360"
                     /product="fatty-acid synthase complex protein, putative"
                     /transcript_id="XM_571099.2"
                     /db_xref="GeneID:3257758"
     CDS             complement(join(1215651..1215984,1216035..1217480,
                     1217546..1218056,1218130..1219455,1219508..1219810,
                     1219865..1219927,1219978..1220121,1220175..1220266,
                     1220321..1220349,1220410..1220478))
                     /locus_tag="CNE04360"
                     /codon_start=1
                     /product="fatty-acid synthase complex protein, putative"
                     /protein_id="XP_571099.1"
                     /db_xref="GeneID:3257758"
                     /translation="MAAEGMDKESIVRRELTSRCIAIMNRADPALLDYMKYHIDNADP
                     SKGPTFQKIKEFGQILLDNCKEVVDKPPVYRDVALPTAPHTEISAKGDIVYSEVSRQN
                     VRKLESYVKEMASGGEVEPAVNLEKVQSDIEKLWDLVNSQPSITAAQKSAIKSMYSEV
                     VKSLGQSSGSALEDAESPAIARAKGPKQRRSSSQFLRPNVEDRTEVEEAHLPFLHLKR
                     KTGTSFSYSAKLTNIYFDVLTEIATSGVTFAKKAALLTGVGKGSIGVEILKGLLSGGC
                     TCIVTTSRYSRAAVDYYKNIFHEIGSKGSKLIVVPFNGASRQDVEALVDYIYSTLQID
                     LDYIIPFAALPENGREIDSIDDKSELAHRLMLTNLLRLLGAVKQKKAARQFVTRPTQV
                     VLPLSPNHGIFGNDGLYSESKISLETLFNRWSAESWGEYLCIAGAVIGWTRGTGLMSA
                     TNFVAEGLEKLGVRTFSAKEMAFNILGLMHPLLFDITQIEPIWADLNGGMDRVAGLAE
                     VMTSIRVDINRVAELRKAITIDNAADFRVINGGDAERLHQKVAITPRANFSFDFPKID
                     SDDILNELKHLQGLIDLDKVIVCTGFAEVGPWGSSRTRWEMEARGEFSIEGCIEMAWM
                     MGFIKHLDGKLGNGQTYVGWVDAKSGEPVDDKDVKTKYEKDIIKHAGIRLIEPDLFWG
                     YNPEKKGFIQEIELNHDLEPLEVAAEEAARFKREHGDKVDIWAQESGEWFVKFNKGAR
                     IFLPKAVKFDRVVAGQLPTGWDARRFGLPDDIIAQTDRTALWALVCTMEALIMSGVTD
                     PYELYKYIHPSEVGTSLGSGMGGMHSMSAMFKDRREERDVQKDVLQETFINTVAGWVN
                     LLLLSSSGPVKIPVGACATALQSVEIACDTILTGKAKVMIAGGFDDFSEEGSFEFANM
                     KATSNAETEFAMGREPNEFSRPMTSTRSGFMESQGCGVHVMMSAKTAIEMGASIQGIV
                     AYTSTHTDKAGRSIPAPGRGILSTAREVTPKEALPLLDIKYRSRQLAFRRKQISQWLE
                     NEHELLRMELETRKGGDNEEWFQNRVAFIDDEARRQEKDALATFGMLEGSHPNIAPLR
                     RALAVWGLNADSVGAISCHGTSTKANDKNESGVYNLQFEQLGRTPGNAVPVIAQKSLT
                     GHPKGGAAAWMFNGMCQTINSALVPGNHNADNISEELRAFRHLFYPSKPIQHVRLECG
                     LLTSFGFGQVGGQVAIVHPRYLFAALQTHELEAYKKRRQDRELNTYSRMSSALVNNNM
                     VQIKDGPPYTAELEGSVLLNPLARAGPSKNSFAFQGKLPTKVPLDIKNAETLKAMFDQ
                     AGALSGVGVDTELISNVPTSETFRERNFTADEISYCNSAADPTASFAGRWAAKEAVFK
                     ALSVPSKGAGAPLKEIEIVSTSSGPTVKLSGDALAAAGGKSVKVSLSHSDTSVVAFAV
                     AQ"
     gene            1221046..1229290
                     /locus_tag="CNE04370"
                     /db_xref="GeneID:3257557"
     mRNA            join(1221046..1221639,1221690..1222578,1222642..1223575,
                     1223641..1225330,1225392..1227466,1227516..1227683,
                     1227734..1227834,1227894..1228804,1228864..1229072,
                     1229128..1229290)
                     /locus_tag="CNE04370"
                     /product="fatty-acid synthase complex protein, putative"
                     /transcript_id="XM_571100.2"
                     /db_xref="GeneID:3257557"
     CDS             join(1221097..1221639,1221690..1222578,1222642..1223575,
                     1223641..1225330,1225392..1227466,1227516..1227683,
                     1227734..1227834,1227894..1228804,1228864..1229072,
                     1229128..1229149)
                     /locus_tag="CNE04370"
                     /codon_start=1
                     /product="fatty-acid synthase complex protein, putative"
                     /protein_id="XP_571100.1"
                     /db_xref="GeneID:3257557"
                     /translation="MAALFSSAAPMRPLVLHDAATRVSVHVPASPLSAWVTSQVVAQD
                     FQDSIVGQHTPAPVADEDEEPSAPSVEPQVKLLAQFLSFVADRAVQDASHELSEVLLA
                     AYNRFNELFLSATNVHSLVQSFDPETRAEILKAYFKAFATAREQLGDKVQIAHPSALL
                     EAAKDGSTELYALFGGQGVNEHYFGELQLLYDTYTPFVAPIISEITDLLISLGHKADN
                     DGYTYYSQGLDLLSWLDGSSPQPSVEYFASIPLSLPLIGVAQLAQYVISCRVTDISPA
                     EMRERFKGATGHSQGIVSAVAIASSNSWSSLYENILKAVKQLFYIGLRGQEGFPLLAI
                     DPKIVSDSVENNEGVPTPMLSINGLGLKALEGHIKKVNSHLASNSQIGISLHNGPTNF
                     VVTAPAKALYGLVTALRKVMAPAGLDQSKVPFSKRKAVFTMRFLPVNVPYHSHYLEGA
                     TQKVEKDLGEELWDAKALGMAIYHTEDGSDLRSSEISLTTSLCDQIFTRPIHWVKACN
                     FPSTATHAVDFGPGGNSGIGPLTGRAIEGRGVRIVVVGEKGKAAAEFYDATKIRREPV
                     WAKEWSPKLVKTLDGKVHIDTPFSRLLGKPPIMVAGMTPSTVGANLVAATLDAGYHIE
                     LAGGGHYNPKALRAKVAEIQRRVKPGVGITLNALYINQRQFSFQFPLWQEMRKEGLPI
                     EGFCVAAGIPSSEKATEIITALKEAGIKHIAFKPGSVEGIRQVVNIAAANPDYPIIMQ
                     WTGGRAGGHHSCEDFHQPIIATYPAIRQNPNISLIAGSGFGGAEDVWPYLSGEWSVKM
                     FGLQPMPFDGVLYASRVMVAKEADTSASVKQLIVDAPGVDDAQWEGTYDRPTGGILTV
                     RSELGEPIHKIATRGVKLWREFDDTVFAQPREKRAAWLENKRDYVIDRLNKDFNKPWF
                     GEKSDGTVVADIGKMTYEEITKRMVRLMYIAKQDRWIDVSLRNLVGDWLRRVEERFAG
                     VDGIRTKESLLQSFSDLDKPLPTIESFFGTYPRAKSQLVAAEDKAFFLAICQRPGQKP
                     VPFIPILDNNFEVWFKKDSLWAAEDVEAVFDQDPQRVCILQGPMAVKHATVVDEPIKD
                     MLGNIEALLVKKILKEFYNNDESKVPEIDFIGAKPGKPKAGLVSESVSGDVRTLKVGK
                     NVPALDDWLEVVAGANVSWLRAALTSVNVVQGAGYISNPFRRIFSPRAGQTVVIKSEN
                     GKAVSVTVYGAARSFGPHAADFKAVELTFNSNTNAMSLIMYEERRGVSVPLHFAFAYH
                     PEQGYAPIHEVVEGRNKSIKDFYWRLWFGDDEKLPSLKLDTTFTCDESKVDALAVQRF
                     CDVVGNQGEAFKSARNEKIMAPMDFAIVLGWQSVMKAIFPDDINGDLLKLVHLSNGFR
                     MMDGVAPLRAGDACSAEARVVSVINSDSGKTVKVKGYVLRGGEPVIEISSSFLYRGKF
                     TDYENTFETIDEDDYVVELSKPTSVGILQAKPWFEWDDDSVPLDVGTTLTFKTKSELR
                     YKDKSTFSSVKVSGAAFIRDSTKALIQVATIDYEAHNLQGNPVIEYLKRHGTAVGKPT
                     PLENGYSLIEDPTAAVFTTPATNEPYSKISGDFNPIHVNPYFSDLASLPGTITHGMWS
                     SAATRKYLESVVADNHPERVVSYQVGFVGMVLPGDEIQVKLTHTAMRDGKKVVKVEAF
                     NQRGEKVIDGSAEVLQPPTTYVFTGQGSQEVGMGMELYNNSEVARAVWDVADAHLTST
                     YGFSIVDIVKNNPKELTIHFGGIKGQAIRQRYMDLTYDIIDESGRVKTLPLFGDIDLY
                     TTSYTFSHPQGLLFATQYTQIALVVTEKAAFDDMKAKGLIDQNAAFAGHSLGEYSALA
                     AIADVLPISSLADVVFFRGITMQRAVQRDAEGKSQYAMMAANPSRVGKTFNEMALREI
                     VDTISQQKSVLLQIVNLNVANQQYVCAGELRALATLTNVLNMLKIQKIDLEKLSTMMS
                     IEEVKEKLGEIIEGCWDMMKEKEEKDGSVILDRGFATIPLPGIDVPFHSRYLWPGVLS
                     FRNYLVKKIDPSQLNPDRLIGKYIPNLIAEPFEVSKAYVQKIFDQTASPRMETVLNNW
                     EKEAWESPSQRQRLAYNILTECLAYQFASPVRWIETQDVLFTYAKFERLIEVGPSPVL
                     SGMATRTLKAKYEAQDGAISLQRQILCHAKNQKEVYYAFEDEAADEAPAAAAASTSAA
                     PAPVAAPVAAAPAPVAASAGPAAAVEDVPPKAVDTVRIIVAQKLKKQVSEVPLSKSLK
                     ELSGGKSTLQNEILGDLQVEFASAPEKGEDLPLDELGAALSVGYAALGKHSMALTNRM
                     VASKFPGGFNITAARAHLNKQWGLGPLRTDSALFFGILNEPPKRLGSEAEAKAFLDQL
                     AQSYASYSGISLSSGAAAGGAGGAAGGGAVMNSEEFDKFVLKQEEHAQREIELLSRYL
                     GKDPREGEKKADEEKATAEELQAKLDAIKLEHGDAYIDGITPVFSALKARTFDSSWNW
                     VRQSSIQLFYDIIHGDLDPSTVFNDPPRYRSNA"
     gene            1229439..1230762
                     /locus_tag="CNE04380"
                     /db_xref="GeneID:3257755"
     mRNA            join(1229439..1229701,1229770..1229936,1229998..1230062,
                     1230123..1230415,1230469..1230613,1230666..1230762)
                     /locus_tag="CNE04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657288.1"
                     /db_xref="GeneID:3257755"
     CDS             join(1229491..1229701,1229770..1229936,1229998..1230062,
                     1230123..1230415,1230469..1230613,1230666..1230699)
                     /locus_tag="CNE04380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512950.1"
                     /db_xref="GeneID:3257755"
                     /translation="MSDQTSQKEPTQRPASSPATLPAEQAPQETKLAVEPVAETSSTP
                     TAPTSAGTEPQIKVYNPVESAPKADEELDDAFFEPTVNDVRAIYASVSSRSKRLNDAP
                     LITSKYRDVEKGEKEKAKREKWPETTMRIKFSDGTIIQSVFPSSSPIQPVYAFVRSCL
                     DETSQTKTFILWQPPRNRYPEHPVPVSKKPNSYKTNIIAPANYGAVRGGVVQGLQGGT
                     GGQESLAELGLVPQSLLMVKWDEEEMNSSSFSAPLKDELRKKSEPLPPPAVKETSESG
                     TPVTADAPDQPKEKKIPKWLQKGLLKKK"
     gene            complement(1230758..1232361)
                     /locus_tag="CNE04390"
                     /db_xref="GeneID:3257479"
     mRNA            complement(join(1230758..1230905,1230958..1231279,
                     1231332..1231665,1231721..1232069,1232124..1232361))
                     /locus_tag="CNE04390"
                     /product="peroxisomal membrane protein pex16, putative"
                     /transcript_id="XM_571104.2"
                     /db_xref="GeneID:3257479"
     CDS             complement(join(1230892..1230905,1230958..1231279,
                     1231332..1231665,1231721..1232069,1232124..1232259))
                     /locus_tag="CNE04390"
                     /codon_start=1
                     /product="peroxisomal membrane protein pex16, putative"
                     /protein_id="XP_571104.1"
                     /db_xref="GeneID:3257479"
                     /translation="MSPLEAYHSFLLSNLSAVQTIESSISNITWLLPGRFEDAEVASE
                     GLYALLSLVAGYHDKILSSHLSSSLSLPPHPFAKPRTPTEPLSASQESVTTRIHPLLP
                     PPSDHARYTRYWTESSSLYEKASRALSTISYLELLVEMVARKKLGDRRRWKVVLGLES
                     LKTFLRLLLMLKTRRPVLSQPTPQREFDLASVPSEVLDPSSSQPQDGNNPVTPQLPAY
                     SPLRSHLFPMAGNLPEKYLEHPLDLIPQLKGSEYIAEAVACCVGLARIYLLIRTSRQE
                     VTRPYNPSSLPTLSRSMSPYLIPLALLLLSRRLRSKSESPLLMSHYAQQDKKLALQAF
                     MTGPMWIGWTRPKIVSVARALERLPILGLVGDLVEGYLPLVDDYFFYTTS"
     gene            complement(1232929..1235460)
                     /locus_tag="CNE04400"
                     /db_xref="GeneID:3257854"
     mRNA            complement(join(1232929..1233287,1233339..1233526,
                     1233587..1234073,1234124..1234625,1234681..1234924,
                     1235022..1235460))
                     /locus_tag="CNE04400"
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /transcript_id="XM_571105.2"
                     /db_xref="GeneID:3257854"
     CDS             complement(join(1233281..1233287,1233339..1233526,
                     1233587..1234073,1234124..1234625,1234681..1234924,
                     1235022..1235033))
                     /locus_tag="CNE04400"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /protein_id="XP_571105.1"
                     /db_xref="GeneID:3257854"
                     /translation="MASRNPVVTRRAATRSRNDENAAPQQSVRTKPSISHLGPASKTA
                     AVNVSVAAGKKPVAVKVGAKRTALGGVVVNGKGETEAGKKPLKASGKTVTEARQPLAS
                     RQNNAQPTRPIAAIPHRSKATPANVYAPVEAPAKLTVEEDMQMEIDARRSQPVSNAAD
                     FATVDEELLDDESEEDDMEEEDEEDWLRMSEEEMVKAQEQLDVVQATFKDDVDMFDTT
                     MVAEYADEIFEHMERLEESVMPNPRYMDFQTEIEWTMRTTLIDWLLQVHLRYHMLPET
                     LWIAVNIVDRFLSTRVVSLVKLQLVGVTAMFIAAKYEEILAPSVEEFVYMTENGYTKD
                     EILKGERIILQTLDFTISSYCSPYSWVRRISKADDYDVQTRTLSKFLMEVTLLDHRFL
                     RCKPSMIAAIGMYLARKMLGGDWNDAFIYYSNFTESQLITGASLLCERLIEPDFESVY
                     VYKKYANKKFLRASTFARDWALTNAANSS"
     gene            complement(1235841..1237471)
                     /locus_tag="CNE04410"
                     /db_xref="GeneID:3257678"
     mRNA            complement(join(1235841..1236375,1236425..1236560,
                     1236611..1236903,1236966..1237210,1237273..1237319,
                     1237377..1237471))
                     /locus_tag="CNE04410"
                     /product="arp2/3 complex 34 kda subunit (p34-arc),
                     putative"
                     /transcript_id="XM_571107.2"
                     /db_xref="GeneID:3257678"
     CDS             complement(join(1236149..1236375,1236425..1236560,
                     1236611..1236903,1236966..1237210,1237273..1237319,
                     1237377..1237391))
                     /locus_tag="CNE04410"
                     /codon_start=1
                     /product="arp2/3 complex 34 kda subunit (p34-arc),
                     putative"
                     /protein_id="XP_571107.1"
                     /db_xref="GeneID:3257678"
                     /translation="MILLESHNTIINDVLSDRFERPSRADIQFVDYDNVRFHLSTPSS
                     KTQLLLSMGIQCWPDLVKYGAREHLQNEYQGYFLAEADTEPEYDVSLLIDLERLPESP
                     EERAALISKIAHLKSTAMSSPFFAAFAEQASLQASYKEPAGAQQADLQPSEVKGDLKI
                     VKYREEEAIFIQASHDRVTIIFSTVFKEETDRVYGRVFLQEFVDARRLHSLQNAPQVM
                     YSNREPPLEIRHLPGLKNGEDWGYVTFVLFPRHFANPSQALATINRIQLFRDYLHYHI
                     KCSKAYMHSRMRYRVAEFLKVLNRAKPEIASEKKTASGRTFRSR"
     gene            1237893..1239047
                     /locus_tag="CNE04420"
                     /db_xref="GeneID:3257604"
     mRNA            join(1237893..1238208,1238263..1238326,1238433..1238531,
                     1238654..1238865,1238930..1239047)
                     /locus_tag="CNE04420"
                     /product="expressed protein"
                     /transcript_id="XM_571109.2"
                     /db_xref="GeneID:3257604"
     CDS             join(1237907..1238208,1238263..1238326,1238433..1238531,
                     1238654..1238865,1238930..1239020)
                     /locus_tag="CNE04420"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571109.2"
                     /db_xref="GeneID:3257604"
                     /translation="MPFQRTNQRPSYSRNSKRITHHNYNGSVTFASVIVIALISVLIF
                     ATVVSQYSPFSSIRPSMSSVNTSVIQSPAASVIATASEPIDNTMVKKNSREDKEWNRL
                     AIHMDSYHNSFRMEFKRVYALADGGYEEEAMKLPRFLRLAQQLSSHLSMHHRIETYIF
                     PILSKKMPQFAAGKRESGEHLVAHKKIHDGLDKYDKFLSNSLDDPSVYNGEKLREIMD
                     SFREVLFTHLDEEVKDLQGEQMRAAGWTLEEMKRIPM"
     gene            complement(1240423..1244190)
                     /locus_tag="CNE04430"
                     /db_xref="GeneID:3257707"
     mRNA            complement(join(1240423..1240907,1240982..1241143,
                     1241247..1241523,1241590..1244190))
                     /locus_tag="CNE04430"
                     /product="cellular morphogenesis-related protein,
                     putative"
                     /transcript_id="XM_571111.2"
                     /db_xref="GeneID:3257707"
     CDS             complement(join(1240534..1240907,1240982..1241143,
                     1241247..1241523,1241590..1244082))
                     /locus_tag="CNE04430"
                     /codon_start=1
                     /product="cellular morphogenesis-related protein,
                     putative"
                     /protein_id="XP_571111.1"
                     /db_xref="GeneID:3257707"
                     /translation="MGCIPCRTLQPEVAHLNACYPPPKALLTAGPEYRPLAQDLSKLT
                     YFATNKPSKLAKIGEELEKRVAQESARASSGNHKYRASLLISLAILRALLTECKRDIA
                     LFARSTLRVIDSSLDVRVYQRGGIDLEVVGRAAAAFIAYTTYTDGSAVGVDDTLTKTY
                     FEILRKFGSMATVSLLDSSEKPDTEQQNRTRLIALAGLNGAATSDAIFASTRDFPRQI
                     DLIIPPLLVNTFEGQISELKLESAKIGMDASPSPFFSEFAAKGPVAQRRAPSLHAHIP
                     GEKGPTSADVVSAALRSLHSLLQQCNVTQASQIIDRLVMFLDKHGWQYAERDCFVAEQ
                     VTAWIPLQYRFIVPTRLVEVLMDLQDRTPTPKHTSALAMVTTILNSTTSLVGLGVTDL
                     LQHLVSLIIRRIHFDLRDALLPSLVQCVSSLGTHIYYADQINDIVEELALRIAEIPSS
                     DTARSEIIRVLTCCISGVMIMTDAADNDAESKQGNNVPQPTPSTPGSPTPPNKGKLPA
                     PAETPFLTPLFEYLRPQAHRSSRRNPISPEVWQETLPLLCEADYSVRSTYARALILFL
                     ETEMQRGPTPRTTPGKQSAQNREKEKGPSADMATYRFCHALNAAVYSLMMSSCLGMAD
                     GDGIPTGVPTTAAASPEIHTDPTASAVTVKDSDPPVALAPDVGPTPASGGSGSETATP
                     NREKGVSFKVTEPTPGETATQTQSGSGATTPPKRNSRSHRPSLPLNRLQSYTHLSSFD
                     NVATPLDFAAALRILDAMHMVVPVAALVTGAPMLLAVDRDAGNELVRRPGDGRAGAWV
                     LERKRAIRELVSLVWRRIADRWGIVEIDDLANKALASLPEPYLIPPYPVPDSPPVFLS
                     LPEEPVSFIQHTLEGESSSTAKPLLDQDTLLDALVKSQTVQAAKQMDEAGLKRLFDGK
                     WSVEQAIKDSMERFSSANLRPDDDSHYNAASALLMSMNNASYQSVNGQRLSRTIDVTD
                     LRDALGGRVDTVSTSGAPSIASFDDSFHSQSAPRSSLQSRRMNKDSDVKEILKDIFKD
                     KKKGTKAPKGIVVNRVKSASASEEARTSTGDENGLGMSGMTQGDGATGHKVVTNPPLD
                     LSLGRPVDVSSSS"
     gene            complement(1244212..1246184)
                     /locus_tag="CNE04440"
                     /db_xref="GeneID:3257542"
     mRNA            complement(join(1244212..1244426,1244497..1244792,
                     1244844..1244961,1245018..1245404,1245460..1245642,
                     1245907..1246184))
                     /locus_tag="CNE04440"
                     /product="nucleosome assembly protein I, putative"
                     /transcript_id="XM_571114.1"
                     /db_xref="GeneID:3257542"
     CDS             complement(join(1244364..1244426,1244497..1244792,
                     1244844..1244961,1245018..1245404,1245460..1245642,
                     1245907..1246110))
                     /locus_tag="CNE04440"
                     /codon_start=1
                     /product="nucleosome assembly protein I, putative"
                     /protein_id="XP_571114.1"
                     /db_xref="GeneID:3257542"
                     /translation="MSQSQDIQRADSHLDVAPTPQNTPLETGVLQNRPANLGQPTVET
                     LQEGEESEEDEEVGGANPASLLAQNPALLAFAQSKLDGLVGKPSGYIESLPPAVRRRI
                     DGLKGVQAKHSEIEGEFQLAILELEKKFLVKYQPLYERRQAIVKGEAEPTESEIEAGQ
                     ASDLEDSDAEDEEEKKTKEEATGGEDVKGIPEFWLTALKNHVPTAETISDRDEEALKH
                     LVDVRLSYLDGEKPGFKLHFVFTANEFFEDAELTKTYYYQEQVGYGGDFVYDKAIGTE
                     IKWKEEKDLTKKVEIKKQRNKTTGRTRTIRKVVPTDSFFNFFKPPQPPTPDTLEASDI
                     DEEELEELDSRLELDYQIGEDFKEKIIPRAVDYFTGKALRYEDFEEEDDFEDEDDFED
                     DDDEDAEGAADANAAAANPDCKQQ"
     gene            complement(1246338..1249390)
                     /locus_tag="CNE04450"
                     /db_xref="GeneID:3257687"
     mRNA            complement(join(1246338..1246588,1246655..1246888,
                     1246946..1246965,1247017..1247073,1247128..1247196,
                     1247256..1247354,1247407..1247741,1247793..1247855,
                     1247909..1247979,1248120..1249171,1249311..1249390))
                     /locus_tag="CNE04450"
                     /product="heterotrimeric G-protein GTPase, putative"
                     /transcript_id="XM_571116.1"
                     /db_xref="GeneID:3257687"
     CDS             complement(join(1246544..1246588,1246655..1246888,
                     1246946..1246965,1247017..1247073,1247128..1247196,
                     1247256..1247354,1247407..1247741,1247793..1247855,
                     1247909..1247979,1248120..1248203))
                     /locus_tag="CNE04450"
                     /codon_start=1
                     /product="heterotrimeric G-protein GTPase, putative"
                     /protein_id="XP_571116.1"
                     /db_xref="GeneID:3257687"
                     /translation="MGGCMSSPTTGDPVAEARSKEIDRALKEDEKRMAKEVKLLLLGA
                     GASGKSTILKQMRLIHDKPFESNEVEDYRKLTFSNIVGGMRAIIDVMDELGLAVQPEN
                     RRYISLVDAEPPINTNEPYPIKYLTALKSLWADQNVQECYKRGNEFALAENMPYFYAD
                     LDRLFAQDFKPSSDDILRVRSKTTGITETRFPIHDVVFRLFDVGGQRSERRKWASCFE
                     DVTAILFLVALSDYNSCLIEDRESNGMQEALMLFDSICNSQWFTKSSIILFLNKADLL
                     QAKIQDPSQQIQEYFPEFEGQPYSFQDAVDFFKIKFRSLNRTSKKEIYCHVTTAVDRQ
                     NVKVVMTACQDTILKNALRDMAIL"
     gene            complement(1249917..1252488)
                     /locus_tag="CNE04460"
                     /db_xref="GeneID:3257928"
     mRNA            complement(join(1249917..1251061,1251114..1251273,
                     1251323..1252488))
                     /locus_tag="CNE04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_571117.2"
                     /db_xref="GeneID:3257928"
     CDS             complement(join(1250121..1251061,1251114..1251273,
                     1251323..1252363))
                     /locus_tag="CNE04460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571117.1"
                     /db_xref="GeneID:3257928"
                     /translation="MFPTNLRARHKQRQKTAEAARAYQRESPPGPGARDSDVAGDYGV
                     QSMSEWGSELISRSPISQSEKEHQSAAMAIATDLMETSREDEATNNMEIDESEPTNGQ
                     TERSPSDSSSTETVSPGDIQSGGTIDTEANLAITPSPEHTIHPFDGVSPSVSTDDPAS
                     RPRTSQHHQHHHHHQHVHDPARLREHTLHHLRLRDLPRPATPTSPSLPPSEPGSPMSF
                     ASMPSYVASLSSLSRASSAASPVGEDDADANDDVGGDLVLPQLSLPTESLSLHLSLQR
                     WPNRDVEMEDGKEERRGVVTVALIGTKDEIEKVLKEVKECVEMVKLDGGALGIISDGR
                     VAIRLITSLEIDQVQSKVYQAYQTLNALLSPVPPPSREIESELRRLIAGYANREDWVH
                     AVVVFDNRESSGNLERMTPVTRISANDSIHESISSTPSAVSERATHPSQISDSRLHEP
                     TPRARDDMDGYFASQHFCSPLTSSESAADPASTHSTHSARTSRSPSILREGTAPMSSA
                     ARTLCNLLSSPSTLIHQSTASFLAWRYSLSGPPSTSMSPISVSASASAYASASSSYCF
                     GGNPMPTVARAQGGGEWEANLSRRVAQRRESGGRSVGLSESGSGRGKGSTFKARPRRR
                     RRSLEKAEQEKACQSLFPKVSSSPFSYSQGKSRGSSLGIGWLVEKTFGISVESAKGMQ
                     TWWAKNGVWKWGVVAAVVVIGGLGLWAKGRA"
     gene            complement(1252843..1254715)
                     /locus_tag="CNE04470"
                     /db_xref="GeneID:3257962"
     mRNA            complement(join(1252843..1254516,1254578..1254715))
                     /locus_tag="CNE04470"
                     /product="expressed protein"
                     /transcript_id="XM_571119.2"
                     /db_xref="GeneID:3257962"
     CDS             complement(join(1253114..1254516,1254578..1254599))
                     /locus_tag="CNE04470"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571119.1"
                     /db_xref="GeneID:3257962"
                     /translation="MPTQTRPVSLHERFSLTRRNAGYPPILAIAASYPSDAAPSRTFL
                     EQRIAELQEHFPLLYVRIEGHRTTNPVEVLREKPWPAEDILDEAEYQPEDDDSVEIGN
                     ILQKNGQKKSTDDLNSRPLWQVTIDTSLKKSTTYITLVADHLIVDGKGLSIFFDALLA
                     KDVSQLPYEKLETIPRLEDTMNIKPSLSFLLPMVWQHLILPRLPFFIQRFFSTGATWP
                     ATHVRESPFNCSPGYSLLSIPADQMASLKQVARAHNILALHAVLKSIYALAIWSKFRH
                     TLSPFRLTASTPRSERDYKLGHAYCMGNYVSSYQFDIQFTPGESFWVVAKNVFNYLMD
                     PESIESARMRMGILEQVPDGVYDPPHADPHRPTKWEDFFLNEAASEKPFGEALSFSNL
                     GHVKLPENAKDVAWVQIGGSLATAGFSTAVLGHEKGLRLNTIYLEGAAVTKEDVKDIE
                     WLFVVILKRLIEGKDNVDELLVKV"
     gene            complement(1255187..1257557)
                     /locus_tag="CNE04480"
                     /db_xref="GeneID:3257525"
     mRNA            complement(join(1255187..1255597,1255662..1255735,
                     1255807..1255866,1255923..1255967,1256027..1256190,
                     1256250..1256277,1256326..1256372,1256426..1256514,
                     1256577..1256781,1256859..1257007,1257107..1257557))
                     /locus_tag="CNE04480"
                     /product="sphingosine N-acyltransferase, putative"
                     /transcript_id="XM_571121.1"
                     /db_xref="GeneID:3257525"
     CDS             complement(join(1255309..1255597,1255662..1255735,
                     1255807..1255866,1255923..1255967,1256027..1256190,
                     1256250..1256277,1256326..1256372,1256426..1256514,
                     1256577..1256781,1256859..1257007,1257107..1257168))
                     /locus_tag="CNE04480"
                     /codon_start=1
                     /product="sphingosine N-acyltransferase, putative"
                     /protein_id="XP_571121.1"
                     /db_xref="GeneID:3257525"
                     /translation="MSQGHKHLHRRRASSVTVALDQIPLNHNRQSSPESAVKPLPGRR
                     RPTEGDRYRSKGLWSDIKTGRWLLAPASSFKLSLIAPSLYLLHHLLSTYGIINHSQVP
                     NVFEHFILPSNKLEDGRYGKSWWDFAFLAHYVIFCTFVRQFMTTRVLRPMARALGVKG
                     QKIVRFTEQGYAIFYFGILGVYGLYVMRDLPIWWFKTEHFWLEYPHREMTSHLKTYYL
                     LQASYWLQQTIIMIAKIEKPRKDYKELVAHHIVTLWLIGWSYTVYLTYIGVAIFITMD
                     VSDLFLGLAKCVNYVSEFYSVPLFAWFTIVWTYMRHYLNIVILHSVWTQFDLIPFPDR
                     TTFDPWNDRWIDWWMKWQIFIPIFLLQLLNLVWYFLILRILARAVFLNDRKDERSDDE
                     DDVEGDEAKEE"
     gene            complement(1257769..1260029)
                     /locus_tag="CNE04490"
                     /db_xref="GeneID:3257918"
     mRNA            complement(join(1257769..1258341,1258404..1258477,
                     1258536..1258595,1258647..1258691,1258744..1258907,
                     1258976..1259003,1259055..1259101,1259153..1259241,
                     1259302..1259503,1259587..1259726,1259792..1259827,
                     1259939..1260029))
                     /locus_tag="CNE04490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571186.2"
                     /db_xref="GeneID:3257918"
     CDS             complement(join(1258050..1258341,1258404..1258477,
                     1258536..1258595,1258647..1258691,1258744..1258907,
                     1258976..1259003,1259055..1259101,1259153..1259241,
                     1259302..1259503,1259587..1259726,1259792..1259827,
                     1259939..1260009))
                     /locus_tag="CNE04490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571186.1"
                     /db_xref="GeneID:3257918"
                     /translation="MPGPAVTPNKPSHRRRSSVTNALNQIPLNHEQGSSIQPVEEVKP
                     LTSRPRPKSKGTRDALPEIYKSNGFWDDVKTGRWMLIPSSSFKLMLIAPILYFNHRLL
                     VHYGILGPDTPNIFEHLIFPSNRLPDGRYGKSWWDLVFLANYIIFWSFVRQFMTLKVF
                     RPMAMSLGIKGGKIMRFTEQGYACFYFSILGSLGVYVMRGLPTWWYKTEHFWLEYPHR
                     EMSWELKTYYLVQAAYWLQQTILLAAKIEKPRKDFKELVAHHIVTLWLVGWSYNVYLT
                     YIGVSIFVTMDVSDVFLALAKCVNYVSDFWSVPVFAWFIFVWSYFRHYLNIWILWSVW
                     AQFDLIRPSERSAFDPLNDKWLSWWMKWQIFTPIFLLQLINLFWYFLIWRILVRAVFY
                     RDLKDERSEDEEEEEEEVKVKAE"
     gene            1260316..1262183
                     /locus_tag="CNE04500"
                     /db_xref="GeneID:3257730"
     mRNA            join(1260316..1260531,1260596..1260714,1260770..1262183)
                     /locus_tag="CNE04500"
                     /product="hst4 protein, putative"
                     /transcript_id="XM_571135.1"
                     /db_xref="GeneID:3257730"
     CDS             join(1260381..1260531,1260596..1260714,1260770..1261936)
                     /locus_tag="CNE04500"
                     /codon_start=1
                     /product="hst4 protein, putative"
                     /protein_id="XP_571135.1"
                     /db_xref="GeneID:3257730"
                     /translation="MTVQVHLSTPGAGPSSAAASSFATPAVDVEDTLRQVVARLRMAK
                     RIVVVSGAGVSTGAAIPDFRSASGLFSGKTKGGHSVKDLFHVRCLAHPTLLAKHHELI
                     TSLSSLSTAAPPTPFHTYLSSLDNEGRLLRCYTQNIDGLEEKTGLAVGIPSNKRKSPK
                     AKGKENAPSLLSISDTPETSLEPPEPRVIPLHGLLSTLHCTLCHTKLPLSPHLPLPPT
                     SVPCPTCELASSIRSALSERSRKSGTLRASVVLYGEEHPEGESIGKSVSKDLKGVDML
                     LVCGTSLSVPGVKRVVKEMAKSAKSKGRGKGKQGQDVKTVFVNEEPPSKGSEWDGIFD
                     IWVQGDVQKFVKDYLQNPDFASTPTKSSPKKVSPSATTKPSTPKRTPNTPNKRKLPTT
                     YLPPTPVSLEKDNSSTGSPQVYATPTKPQSANASAYAGMGVPPTPPLTDEIRPTKRMK
                     VERREREVSPTPTRKDEVSLPPSVEIRG"
     gene            complement(1262743..1264519)
                     /locus_tag="CNE04510"
                     /db_xref="GeneID:3257891"
     mRNA            complement(join(1262743..1263220,1263276..1263416,
                     1263469..1263541,1263596..1263807,1263861..1263941,
                     1263993..1264105,1264165..1264189,1264290..1264519))
                     /locus_tag="CNE04510"
                     /product="isoprenoid biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_571137.2"
                     /db_xref="GeneID:3257891"
     CDS             complement(join(1262933..1263220,1263276..1263416,
                     1263469..1263541,1263596..1263807,1263861..1263941,
                     1263993..1264105,1264165..1264189,1264290..1264481))
                     /locus_tag="CNE04510"
                     /codon_start=1
                     /product="isoprenoid biosynthesis-related protein,
                     putative"
                     /protein_id="XP_571137.1"
                     /db_xref="GeneID:3257891"
                     /translation="MSSLNPEIDGHSYNRPDAGAQTPVDAKAARRARFEKVFDQIAEE
                     LLTYVKGEGMPKDAVEWYQKVLYHNTPGGKLNRGMSVVDTVEILKGRELSEEEYTNAA
                     ILGWCVELLQAYFLVADDIMDQSVTRRGQPCWYRVPNVGNIAINDAFMLEAAIYYLLK
                     KHFRSQKYYVDLMELFLETTFQTELGQLVDLITAPEDHVDLNKFSLEKHHLIVVYKTA
                     FYSFYLPVALAMHMSGVEDKAAFDLALKILLPLGEYFQVQDDYLDCYGKPEHIGKIGT
                     DILDNKCSWNVNTALAHATPEQRKILDENYGRKDSTCEARVKELFSQTPISIPERFEK
                     YEKESYEKINALIEQVDEEKTGLKKEVFRSFLAKVYKRSK"
     gene            complement(1266268..1267680)
                     /locus_tag="CNE04520"
                     /db_xref="GeneID:3257880"
     mRNA            complement(join(1266268..1267235,1267324..1267680))
                     /locus_tag="CNE04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_571139.2"
                     /db_xref="GeneID:3257880"
     CDS             complement(join(1266355..1267235,1267324..1267591))
                     /locus_tag="CNE04520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571139.1"
                     /db_xref="GeneID:3257880"
                     /translation="MTTAHIDRSDLCIPKPKTFVYDSKHDIKLDAYIPQPGSASGEAI
                     QEHGQKLQLEGKAEKELKKMPVVVQFHLGGMVGGSRVMVFPANLPALFNSKGILFVSA
                     DYRLLFPSTPSDIVNDVRTLMSYLSDPSTPLAKTLASSGYMVDKDNLIVNGASGGNYP
                     ARAAATIADIKPRPIAWINFFGQSGDWLLDFWCQGADIEKSMPSNVHLHDMKRAEELE
                     KMKGGEVTTEDPYIVVDGKLTSAKGRFSLFLKWQRDGVFLDYLLSEPGLSAKLAKLRY
                     EERLAAIPVSKRSLLLPSTDATPPTYIIHGKEDHTVPIEDSMATEKDLKEMRKEVKVE
                     WVADAAHMLLQPSGEEMKLVEGIDEIVQRMVNWTIGILERKAEIERLL"
     gene            complement(1268392..1272048)
                     /locus_tag="CNE04530"
                     /db_xref="GeneID:3257847"
     mRNA            complement(join(1268392..1268735,1268791..1268877,
                     1268934..1269028,1269083..1269192,1269231..1269316,
                     1269365..1269735,1269793..1270072,1270138..1270239,
                     1270278..1270449,1270490..1270558,1270599..1270746,
                     1270800..1272048))
                     /locus_tag="CNE04530"
                     /product="siderochrome-iron transporter, putative"
                     /transcript_id="XM_571141.2"
                     /db_xref="GeneID:3257847"
     CDS             complement(join(1268524..1268735,1268791..1268877,
                     1268934..1269028,1269083..1269192,1269231..1269316,
                     1269365..1269735,1269793..1270072,1270138..1270239,
                     1270278..1270449,1270490..1270558,1270599..1270746,
                     1270800..1270999))
                     /locus_tag="CNE04530"
                     /codon_start=1
                     /product="siderochrome-iron transporter, putative"
                     /protein_id="XP_571141.1"
                     /db_xref="GeneID:3257847"
                     /translation="MSAPHHQQGDRVEYDEPNLPRLNQNEFEESSSEFSEDPKAPVKR
                     GIASASRVLSVITKKDIRIAYLALTVLALGMAFAQYTQTTFTAYATSAFKSHSELAAA
                     AVVSRVFSMIAYLIVPKICDNVGRISPSIIISMVVFTVLSDAMMAGCKNVQTYIGANV
                     FSGLSSTGYTIALQIYYAETTAIRERALWNVAADSFSAIITLYSGSTIGGLILENWGT
                     TSGWRWGYGMWSIINTVLAIPFIAILFSWHRRVRRNPNVPRLPPHTNVIDQLFHEYDL
                     IGSCLLVASVALILVPLTLAKGVASQWTDDNIAMICVGFGLLVLFIVWSIPKKWRPKW
                     FFTPRLPLIPWYTLKNRSLMSMFVINMCDFMSYGVFTTYFQTFMQVAVRTSASKASMI
                     DNTLRIVFQVTALVVGLVMRFWTPACVKLGLGKRLFHTRYPVWIGIPLCALSIGIDIN
                     FVQHPRRKSAIASYVIAKAIYGVGRGMFQTSAQITVQASSRRRELAIATGIFYFAASL
                     GGAIGIAVAGAIWLNILPDALANNLPAASANLASTIYGSITVAISYDPNSEIGLAILK
                     SYVHTMKILAIVSTCLQIPMLISMFFIEDLQLTEDEQIILGGKRIGLGKKKQEQIDER
                     EGEEEVKMVEKEKPVVRAD"
     gene            complement(1273250..1273880)
                     /locus_tag="CNE04540"
                     /db_xref="GeneID:3257845"
     mRNA            complement(join(1273250..1273415,1273460..1273489,
                     1273537..1273638,1273693..1273880))
                     /locus_tag="CNE04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_571143.2"
                     /db_xref="GeneID:3257845"
     CDS             complement(join(1273326..1273415,1273460..1273489,
                     1273537..1273638,1273693..1273791))
                     /locus_tag="CNE04540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571143.1"
                     /db_xref="GeneID:3257845"
                     /translation="MSLSRPSNVYDALAPSESFFEREKARLIEEISTNFEELMGNMNT
                     LNRTLEQVYGVGREFTTVASLWGRFNTLIKEQQTELATSADVGVPGTGGANFAASAST
                     AASR"
     gene            1274458..1277110
                     /locus_tag="CNE04550"
                     /db_xref="GeneID:3257954"
     mRNA            join(1274458..1274555,1274628..1274723,1274782..1274952,
                     1275006..1275024,1275075..1275100,1275154..1275704,
                     1275753..1275830,1275883..1275898,1275948..1275974,
                     1276025..1276326,1276389..1276472,1276531..1276769,
                     1276819..1276866,1276923..1276942,1277008..1277110)
                     /locus_tag="CNE04550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571145.2"
                     /db_xref="GeneID:3257954"
     CDS             join(1274478..1274555,1274628..1274723,1274782..1274952,
                     1275006..1275024,1275075..1275100,1275154..1275704,
                     1275753..1275830,1275883..1275898,1275948..1275974,
                     1276025..1276326,1276389..1276472,1276531..1276769,
                     1276819..1276866,1276923..1276942,1277008..1277064)
                     /locus_tag="CNE04550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571145.1"
                     /db_xref="GeneID:3257954"
                     /translation="MSQVRSRASQGGKGKDEPQKRLDKKDIDRKVEQIQALGVLRTIL
                     SCLGLVAVLWFGWKTVAPILEKKTSPPVIPQAKLPGSKFGTIKPSDLPKINLSTKLEA
                     DIEKREAVKEAFEWSWHAYEKHAWGADEYQPLTQTGSNLTSAGGVGYTIVDSIDSLLI
                     MDLIPEYQRARDWVRDHLNFDKDAQFNTFETTIRLLGGLLSAHYLSSTHSSPAIQADA
                     PLYLDLAIDLGERLLGAFTSPTGIPWSGINLATRQGIPDRDNQGVASLAEAASLQLEL
                     KYLSHLTGDYVYWKKAEKVTEIIRAQAIHDGIAPIFISPVNGQFVASEIRLGSRGDSY
                     YEYLLKQWLQTNRQEPVYRDMYDEAMVGIKRHLIGQTSKSNLIFTQELHPARHPRDQS
                     ATWQVVPKQDHLVCFLGGSFLLGITEGGKRDLDWENMEEKDREDFLVGQGIIESCMKT
                     HDTATGLAPEIAMFVQWSDDRANEEDWYIKPNHNGILIDGRNILRPETVESLFLAYRA
                     TGDEKYRRWGWQIFEAFQKWCRVEDGGYAGIEDVQSMPPKQLDRMETFWLGETLKYLY
                     LLFDDADHIPLDKNIFNTEAHILPVFTPEYVSSFALS"
     gene            complement(1276968..1278444)
                     /locus_tag="CNE04560"
                     /db_xref="GeneID:3257855"
     mRNA            complement(join(1276968..1277460,1277510..1278274,
                     1278329..1278444))
                     /locus_tag="CNE04560"
                     /product="expressed protein"
                     /transcript_id="XM_571147.1"
                     /db_xref="GeneID:3257855"
     CDS             complement(join(1277161..1277460,1277510..1278274,
                     1278329..1278373))
                     /locus_tag="CNE04560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571147.1"
                     /db_xref="GeneID:3257855"
                     /translation="MPAPAMSQLETISAILGEYMLKGWTLTDLHCSECKTTPLMREPS
                     AIAERDNRERIQFCALCDGRPQGRVAARPAPPVSQSSAGSTPSSATISQTISPPESQA
                     QSKVSASEPDPAESISNLLLKGYSLLGENCPNPSCRGIPLVGYPRKADGSKDGRKMCV
                     SCGGRWVDESSVPTDWVRSAPITSTTQTAPSSRSVQDGESPRSRKRRELYGITTSGTN
                     QSVCKGKGKEVGVGEFERKAKESESKLVNQAVSENIAPEASDEIEQTAAGARKTFSTR
                     PTPGILPAPISRPTPPSPDSALFATLSTTSDSLSETLTRLSRSLDTTASSLGKRSSSS
                     QDEGKCFVDIKLHTEAMKDVLGVLAQVERAKRQGY"
     gene            complement(1279485..1279571)
                     /locus_tag="CNE04570"
                     /db_xref="GeneID:3257514"
     tRNA            complement(1279485..1279571)
                     /locus_tag="CNE04570"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:3257514"
     gene            complement(1279752..1284419)
                     /locus_tag="CNE04580"
                     /db_xref="GeneID:3257946"
     mRNA            complement(join(1279752..1280231,1280292..1280791,
                     1280868..1280982,1281066..1281915,1282000..1282096,
                     1282165..1283063,1283138..1283447,1283514..1283761,
                     1283860..1283915,1283968..1284017,1284068..1284197,
                     1284296..1284419))
                     /locus_tag="CNE04580"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_571149.1"
                     /db_xref="GeneID:3257946"
     CDS             complement(join(1280098..1280231,1280292..1280791,
                     1280868..1280982,1281066..1281915,1282000..1282096,
                     1282165..1283063,1283138..1283447,1283514..1283761,
                     1283860..1283915,1283968..1284017,1284068..1284197,
                     1284296..1284341))
                     /locus_tag="CNE04580"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_571149.1"
                     /db_xref="GeneID:3257946"
                     /translation="MSTAKKLQNKLFRAGQEQPSAGATAGDVTPVATGTATPVPEQLK
                     INIPAPPGAQREKENLPKRPPSQQESAPELSPKDGGSDMDTPEAVAQDKKQSLRDRLV
                     AELGPRFHSVEEYRLQQSDKYQVHWKRWGPYVSERQWGTVREDYSANGDAWNSFPFEM
                     AQSRAYRWGEDGMAGISDNHQRLCFTLGLWNGKDPILKERLYGLNGNQGNHGEDVKEV
                     YYYLDSTPTHSYMKYLYKYPQTEFPYQQLKEENQNRSREVGEFELMDTDLFDEDRYWD
                     VYVEYAKDEEFADAISVRITAYNRGPDPADLHILPQVFFRNTWSWGKELPPNMPSLSQ
                     EAEGVIHASHDTLGETRLYCTPSPAPAAPAKGGVVLVDGPSVVPDLLFTENDTNFERL
                     WGGKNRTPFVKDAFHDHLIPSHRPPEPEMAKSAQEGLALKSPSVKTPKLPPAHTAAEL
                     EEDGDDDQPAAQSQEGDDHDSAVHSAPAAPRPVADHGHRQFVNPDKTGTKAAAHYHFT
                     DVPANGGCVVVRLKLTPYSPDEDPTIVDEELFDENMEDRRVDADEFYGRIAKGGISED
                     LRSIMRQALSGMLWTKQYYQYIQKEWMEGDPGQPPPPPERKWVRNKEWKHMYINDILS
                     MPDKWEYPWFATWDTAFHCIPLAMVDPSFAKKQLDLMTREWYMKPDGALPAYEWNFSD
                     VNPPVHAWATFRVFKIERKMFGREDLDFLERVFQKLLLNFTWWVNRKDADGNNVFEGG
                     FLGLDNIGPFNRSEPLPTGGTLRQADGTAWMAFFSLNMLSIALELAKHNPTYEDIASK
                     FFEHFLFISDAMTYPGSNEEHLSLWNEEDGFYYDAIQWGYGHSQQLPVRSMVGLMPLY
                     ATLVLEPQVIKRFPGFKKRMDWFIENRPDISERNVASLKTSGRGDRKLLALASKERLV
                     RILEKMLDENEFLSEHGIRSMSLYHHDNPFSMNVNGDEFGVGYWPGDSRSGMFGGNSN
                     WRGPIWLAVNFLLIESLQRFHQYYGDSLTVECPTGSGDYMSLAGAAEEIQHRLIHIFS
                     RDEHGRRAVNGGNPKLNRDPHFKDYVHFYEFFHGNDGRGLGASHQTGWTGLIAWSIMQ
                     TGEFCRLPKTPKTPRSVAKHYFDEQINTPSEYAEDGSIYSAYSMHSEYDEPEPDEL"
     STS             1283212..1283967
                     /standard_name="Xho17"
                     /db_xref="UniSTS:470922"
     gene            complement(1284504..1286124)
                     /locus_tag="CNE04590"
                     /db_xref="GeneID:3257690"
     mRNA            complement(join(1284504..1285386,1285444..1285624,
                     1285750..1286124))
                     /locus_tag="CNE04590"
                     /product="hydrolase, putative"
                     /transcript_id="XM_571151.2"
                     /db_xref="GeneID:3257690"
     CDS             complement(join(1284644..1285386,1285444..1285624,
                     1285750..1286046))
                     /locus_tag="CNE04590"
                     /codon_start=1
                     /product="hydrolase, putative"
                     /protein_id="XP_571151.1"
                     /db_xref="GeneID:3257690"
                     /translation="MPHKIILDTDPGVDDVLAILLALSSPEVDLALISIVFGNTHAPV
                     AHSNLLKIYHLLAQEVAQTAGAEGRYGRLKGQVKTVLAMGEDGPIGGEKAVAAYFHGP
                     DGLSNISETHPHFTPPEIQPGDMHAHLDTSPKPSYEVILDILRAEPDDSVTIVALGPL
                     TNIAHSLRADPETFTKVSRVVWMGGAIDHPGNTSPVAEFNCFADPYAASSVISAAKEG
                     KIELVMAPLDITTPHAIPFSDLIHPSVVPIPEPSTGAVRKAPETPTPLEAFISAMLVR
                     VRGLQASFGLPDAMEMHDPVAVWYAIAHAGVPRGAGPVEGWALQGREFTVERTGEYTR
                     GMCVVDRRGTGETGVDRSKDERILSHGLAQDTGNTLPEKALKPRMLPLVITRTPGAEV
                     LRSTLLGRVFGERE"
     gene            1286251..1287883
                     /locus_tag="CNE04595"
                     /db_xref="GeneID:36392880"
     mRNA            join(1286251..1286475,1286626..1286792,1286887..1287000,
                     1287061..1287883)
                     /locus_tag="CNE04595"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658544.1"
                     /db_xref="GeneID:36392880"
     CDS             join(1286330..1286475,1286626..1286792,1286887..1287000,
                     1287061..1287719)
                     /locus_tag="CNE04595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514391.1"
                     /db_xref="GeneID:36392880"
                     /translation="MPKDTASSLLAHILDNTQIPHQPLLILRDEPTFPATPIFNHLLA
                     TAVSRNEQITFVTVLNPPEEYLDPSLPRGDGLKIIDLSGDVPGYTSNLSFPEIKQRIL
                     SSYNGGQIFIDALHVLGEDHSFAGVVSLVRSLLASIKSHKAPSRLILPLHPSLLHHFT
                     PPTLSPTLSLLSPLPLPLLTHLSKLYLSPISSSPSANYWMVLENAMKRGVGRELAYKG
                     EEGLDVGARDWEDGVGVGVLVRKATGGIKGISRSLEAVVLSPPSQPSSSPTNSTLTLP
                     PLSSLINLTPFTPPPPSAIPPDASALGYPAQAATHADLDLPFNLSLTDSQRQARAQVP
                     LPYAHEGEGASGDLVWEDEEESDDEEI"
     gene            1287892..1291156
                     /locus_tag="CNE04600"
                     /db_xref="GeneID:3258016"
     mRNA            join(1287892..1288161,1288218..1288298,1288367..1288644,
                     1288723..1289517,1289578..1289643,1289709..1289808,
                     1289879..1291156)
                     /locus_tag="CNE04600"
                     /product="leukotriene-A4 hydrolase, putative"
                     /transcript_id="XM_571153.2"
                     /db_xref="GeneID:3258016"
     CDS             join(1288498..1288644,1288723..1289517,1289578..1289643,
                     1289709..1289808,1289879..1290210)
                     /locus_tag="CNE04600"
                     /codon_start=1
                     /product="leukotriene-A4 hydrolase, putative"
                     /protein_id="XP_571153.1"
                     /db_xref="GeneID:3258016"
                     /translation="MLPCQDTPAVKATYGARVRSGRGLEVLMSALRKDTVDLGDGITE
                     FIYDQPVGIPSYLIAIGAGELTYKPFDKLSGRNWNTGCWTEPGNMDAAYWEFHKDTAN
                     FVATAEDLASEYKFGVYDVLFLPESFPYGGMENSCLTFATPTIIAGDRSQVDVVAHEI
                     SHSWFGNGIGCASWRHFWLNEGWTTYLERLIIRATHGEQARQLSFTVGRRGLVDDLAR
                     LESRFQRLVAEYKDYEDPDEGYSQVPYEKGANFLYYLEQTVGGLEIFLPYMKDYVKTF
                     EGYAITTEQWRGHLFHYFGSLKNGEEIVRKLGKVDWDEWLHGDGGDLCVDIKYDDTLS
                     KACYDLAERWNHARDSEDFSDFSPKDVENFSTTQKVIMLDRLETYPAFPPKAVSALDK
                     AYSLSSTGNAEIALRFFEIALKSSADYAEKAAEWVVSKGRMKFCRPVFRLLNEQAPEL
                     AKKTFMEHAGFYHPIARKMIAKDLGLKVE"
     gene            complement(1290244..1291533)
                     /locus_tag="CNE04610"
                     /db_xref="GeneID:3257732"
     mRNA            complement(join(1290244..1290701,1290803..1290994,
                     1291056..1291158,1291236..1291533))
                     /locus_tag="CNE04610"
                     /product="protein complex assembly-related protein,
                     putative"
                     /transcript_id="XM_024657289.1"
                     /db_xref="GeneID:3257732"
     CDS             complement(join(1290324..1290701,1290803..1290994,
                     1291056..1291158,1291236..1291495))
                     /locus_tag="CNE04610"
                     /codon_start=1
                     /product="protein complex assembly-related protein,
                     putative"
                     /protein_id="XP_024512969.1"
                     /db_xref="GeneID:3257732"
                     /translation="MPPRLPFQPRALRLAPITPLAGPSRLLATAPPTNSKPKGKSPAS
                     GDIPPLQRPPGTPIKPSSSPKSWQQKKDEMLDDDRAKAKRKALLHEAKQGYFHDYNQA
                     RTARGGKLWIAPNVLIREDKANYFPDISGKSLLGQNVHTTDLFRGKATLVAIISTRLS
                     EEHVQSFVQPVLEDLEGHPDFQYLTINHQPNALKSLLVSFFTSSLKRIIPEHQWPTYL
                     ISTGSWSPIDVIQPLGLGNSLLGYIFLVDHNAKVRWAACGLATEEEVKNFRRAAAVLV
                     GRMKGGVGAGAVAGSKAGEKAVEGVVDPALSGSH"
     gene            1291664..1293678
                     /locus_tag="CNE04620"
                     /db_xref="GeneID:3257786"
     mRNA            join(1291664..1291810,1291863..1292033,1292093..1292788,
                     1292844..1293195,1293282..1293678)
                     /locus_tag="CNE04620"
                     /product="mitochondrial processing peptidase, putative"
                     /transcript_id="XM_571156.2"
                     /db_xref="GeneID:3257786"
     CDS             join(1291703..1291810,1291863..1292033,1292093..1292788,
                     1292844..1293195,1293282..1293535)
                     /locus_tag="CNE04620"
                     /codon_start=1
                     /product="mitochondrial processing peptidase, putative"
                     /protein_id="XP_571156.1"
                     /db_xref="GeneID:3257786"
                     /translation="MMRIPAAPRFASKASTSSRLLVPSRRATTAATSSAHTLNPAGTV
                     TTLPNKLRVATESIPGHFHAVGVYIDAGSRYESQRTSGVSHLLDRLAFKSTDKHTDAQ
                     MTTLIDSLGSQVTCASSRETIMYQSTVFPQSLPLAFELISSTIRHPLLLPEELLAQKE
                     AAAYEIREIWAKPELILPEILHTVAFRDNTLGMPLLCPESQLGVLGEEEVRGFMRDWY
                     RPERMVVAGVGMPHEELVMLAEKFFGDMPATTTSPGSLHPSVTQAQQPLGSKSFATAS
                     ALPVSQDYTDLAHAKAQYTGGELYMEKPEEEFVHIHIGFEGLGIHDPDIYALATLQTL
                     LGGGGSFSAGGPGKGMYTRLYTKVLNQYHAVDFCAAFHHCYADSGLFGISASVYPQFA
                     SRIVDVMAGQLHALTGPMFGGVEEKEVRRAKNMLKSTLVMALESRLTAVEDLGRQVQI
                     HGHKVPVEDMCAKIDALTMADLHRVANRILRPGNSSEGRVNYGLGSGKATVVAQGPGL
                     GALGDVRRILKDRWVLGV"
     gene            complement(1293692..1296696)
                     /locus_tag="CNE04630"
                     /db_xref="GeneID:3257720"
     mRNA            complement(join(1293692..1294085,1294171..1294332,
                     1294402..1294558,1294625..1294739,1294794..1295232,
                     1295289..1295442,1295494..1295587,1295642..1295990,
                     1296048..1296141,1296195..1296505,1296564..1296696))
                     /locus_tag="CNE04630"
                     /product="DNA binding protein, putative"
                     /transcript_id="XM_571158.2"
                     /db_xref="GeneID:3257720"
     CDS             complement(join(1293783..1294085,1294171..1294332,
                     1294402..1294558,1294625..1294739,1294794..1295232,
                     1295289..1295442,1295494..1295587,1295642..1295990,
                     1296048..1296141,1296195..1296505,1296564..1296683))
                     /locus_tag="CNE04630"
                     /codon_start=1
                     /product="DNA binding protein, putative"
                     /protein_id="XP_571158.1"
                     /db_xref="GeneID:3257720"
                     /translation="MSEDSMDIDLRPEVEEIEPEGPKPIHRLTKDVINQIAAAEIIHR
                     PSNAIKELLENSLDAGSTSIKISVKDGGLKLLQITDNGHGINKDDLPLLCERYATSKL
                     QKFEDLQSLGTYGFRGEALASISYCSHVEVVTKTKNEGCGWKAHYQDGSLIPAKPGGT
                     ADPKPAAANDGTVITAADLFYNMPLRKRAFKSTSDEYNRIIDVVTKYAIHNPHVAWVC
                     KKAGTALPDVATQVGSNTKANIAALYTSALANELLEIPESELQPARLGAKLKGWVSNA
                     NSSWSKKGGWLLFINNRLVDSNKLKKAVEGHYTSYLPKGASPWAYLSLQIDPAKIDVN
                     VHPTKSEVRFLNEDEIVDAVVQAVQTALEGANLSRSFTVQTLLPGAPTPLGKRESSNS
                     TIASASFSTRKAAPNYKVRMDPSNRTLDSMFTVIDPSQLSGFVEDGELQEQERPSKRR
                     NVDPEFQGDESIVLDDDNDDEGQAEEGEREQVFADEGESAKGKAKEIEESVCHFTSIQ
                     SLRRAVKRDGNAELHEIFQRHAFVGVVDRYQCLSLIQHSTKLFLVNHGSLGDEHFYQL
                     GLRQFGAFNRIRLDPAPQLKELLTLAAEDEPGLLEAGLEVESVVDYIASLLRDRQEML
                     DEYFSLLITEDGKVETLPMLLKGYTPNLDRLPHFLLCLGTQVDWDNEKECFQTFLREL
                     AFFYSPRPFEDQPPPPHTKDENMTGDELEGVEPTPEEIQHQLWQLEHVLFPSFRRHTV
                     WPKSCMTHVNQLADLPDLFRIFERC"
     STS             1295520..1296202
                     /standard_name="Bgl1"
                     /db_xref="UniSTS:470920"
     gene            1296832..1298584
                     /locus_tag="CNE04640"
                     /db_xref="GeneID:3257743"
     mRNA            join(1296832..1297029,1297104..1297162,1297241..1297258,
                     1297335..1297636,1297697..1297852,1297912..1297995,
                     1298069..1298584)
                     /locus_tag="CNE04640"
                     /product="expressed protein"
                     /transcript_id="XM_024657290.1"
                     /db_xref="GeneID:3257743"
     CDS             join(1296901..1297029,1297104..1297162,1297241..1297258,
                     1297335..1297636,1297697..1297852,1297912..1297995,
                     1298069..1298313)
                     /locus_tag="CNE04640"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512979.1"
                     /db_xref="GeneID:3257743"
                     /translation="MPLTVNEPHHHRIKRHYTVRKSPYLVSLVLLLAATSLTLLNIYV
                     PRLIHVKGRNPGPTTFETRYGLYKRCTRSLAVPNSTLAFLESAHPLPTAVDLPLVDIF
                     GIEGPTGDPSKGAGNQWVCQNFPTRSECQQFGEKFCVLWSTSGYAAQLSLVPCLASLI
                     SLLFIFLHRGERTARAKARRQQWKLVSGTMLIHCLLQVLSIALILHVFRTDARFESKG
                     SHLDHSFNFGVASAVVSLTQALLLTFTGLAARAGKPWAAGQSALKSRNHRRTRSGRVV
                     LVPEGTHVPPHEAVTVGEVRAVQEVGEPNESTGLLDGHEESVAGGGSQRATDTV"
     gene            complement(1298522..1302978)
                     /locus_tag="CNE04650"
                     /db_xref="GeneID:3257957"
     mRNA            complement(join(1298522..1298879,1298931..1298999,
                     1299059..1299512,1299566..1300173,1300225..1301598,
                     1301650..1301714,1301961..1302085,1302730..1302978))
                     /locus_tag="CNE04650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571185.2"
                     /db_xref="GeneID:3257957"
     CDS             complement(join(1298879,1298931..1298999,1299059..1299512,
                     1299566..1300173,1300225..1301594))
                     /locus_tag="CNE04650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571185.1"
                     /db_xref="GeneID:3257957"
                     /translation="MAAVLHMPTVVHRPSMDRTPSFDQSRSRSGTPFSDPAPHNRSGS
                     GDSEASPYNQSYPGCFPQQQFYSVQPQSWTTAAIPASAFHTPPFHGYSGQPGFQQFQQ
                     SQADFAAWANAYQHMMMASVTGAHQTVPTPPASAEYERRGSMSEGYFDPSYAASQGQN
                     KPHGKGQQQQPFHHYKRGPSRVASREQVRSASMPSKADPQPSSLPRSPSAPDATDQRT
                     FPVSTPSTLNPPTVPTSELDPSVASFVPPARLNTEMRRNSHSSDRSDRENSPSSRSSS
                     AASSKPPTVRAATPLYPGPITNATNARPSPLSNSTTPETVEKGSKSGLKSKIFNKSEK
                     NLKEQKKFVSPVKRSLPPQTFSSPSETSTRSATPPVTPPHDLPAPSAPFANVAAAGSE
                     VSLAGTERTERTATIGDETKSKGKRSLFRMKNMSTDNISLSSTVSSASMMIRKMGSIG
                     KLAKRNSLMGISRIFKEKPKDEDAGLPQKEVKKIKKEKKKKSKSKGEAAPAAISHATA
                     EPERLINDEEDRALAGLTPAAKLARQYTLRSRAEAAQRQNDNVAAKSTPNQDVVGDIE
                     SVTAAVPHEGPNLGPEVVHVQPRQTPTLVHAVAVTEHEYDSEDDSSDEGDTMEDLTMT
                     MGRTRLSDEADAEFKATWGNAYIDKNAVPKKGILKQSSSYSSQDEETNNRPRSNSTHE
                     AISAKPGPLARLPPSDPARLDGLEQLLHPSDDSKNPSLPTSSPEQVSPAPERMYQLPV
                     QNTSAPTLSFMTPSTHHAPPRSMTAPGRKRLLWAPECAVYTTYDCLTYDRRSEPATCN
                     RLTPELAMAIKQELNAFKLEMPIHPESRIYTHYFA"
     gene            1305371..1306334
                     /locus_tag="CNE04660"
                     /db_xref="GeneID:3257784"
     mRNA            join(1305371..1305581,1305643..1306106,1306160..1306334)
                     /locus_tag="CNE04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_571159.2"
                     /db_xref="GeneID:3257784"
     CDS             join(1305553..1305581,1305643..1306106,1306160..1306185)
                     /locus_tag="CNE04660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571159.1"
                     /db_xref="GeneID:3257784"
                     /translation="MSQPEAQQKKEQKQDQAPPTPHEDENQPDDNDNQSENNDQPPKE
                     PQPEPQRQKKKKPQGRGGKGPLPDVKEATKPVQNGTDTAEGALSGAGDTAQGAVGGAT
                     DGATDQALGPLKSRRKPLPNELADTAPEDQPGGGKDKEEKGSLRINISLDLDVEVHLT
                     ARIKGDITIGLL"
     gene            1306729..1308002
                     /locus_tag="CNE04670"
                     /db_xref="GeneID:3257679"
     mRNA            join(1306729..1307091,1307156..1307692,1307748..1308002)
                     /locus_tag="CNE04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657291.1"
                     /db_xref="GeneID:3257679"
     CDS             join(1306894..1307091,1307156..1307683)
                     /locus_tag="CNE04670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512971.1"
                     /db_xref="GeneID:3257679"
                     /translation="MVLGLLTAIAACPAIIGTTEAIQQGQKANAREQHRGRKTNLTIK
                     LPGAHSYKAKFEGCMVVLQDKKLYVQHAGCESLAYAHPFQGYYLPHPQNQSRWKGAGW
                     KGEGMVTTINEDNMLNWAYVDADTYELKHGIRVEAQDHLTGPWDCTQIDRRVTFEGWE
                     GFVLVQEDEEKDLWALYFDKDDDGLAGEGKVGDVQANGGKRKRMLEVQLVRTEMEKTR
                     YDALMERRERIQALQAKTKEQQE"
     gene            complement(1307996..1309691)
                     /locus_tag="CNE04680"
                     /db_xref="GeneID:3257552"
     mRNA            complement(join(1307996..1309067,1309131..1309210,
                     1309268..1309401,1309468..1309557,1309608..1309691))
                     /locus_tag="CNE04680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571161.2"
                     /db_xref="GeneID:3257552"
     CDS             complement(join(1308071..1309067,1309131..1309210,
                     1309268..1309401,1309468..1309557,1309608..1309623))
                     /locus_tag="CNE04680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571161.1"
                     /db_xref="GeneID:3257552"
                     /translation="MSTRQDKSTTERHAKILRELVKQPGNKNCADCKRNDTRWASWNL
                     GVFLCIRCSGIHRSMGTHISKVKSIDLDIWTPEQMESIQKWGNKRANMYWERHLKAGH
                     IPSDHKIESFIRSKYETRRWAMDGPPPPDPSVLENESTGGVVSPPPHQTKSPAPIPSS
                     TSSSAAPPVPAHLPKTHPLLSRSIASSKATPSKPTSAVQAPIIDLFADDPAPAPAAVP
                     AASSRAPAPIATAPAPAQPAPSSASNIFDLDFRTPSAPPLSNSPPASGPISNKSQSAK
                     ADIMSLFSSPSPSAIQSQQPNLTGGFFNATPSGVQATSPYASWQGGITSAVPSDGTQL
                     GIPVGNKWSGLQMDQNAWGAPQHAQATQKTQPTQAYAQPQQQQSVNNIVSDPWTQAKT
                     SMASPSDPWASTSSGDAGMGGGFFGMNQAQPKKEKDERDPFANIWA"
     gene            1309822..1311227
                     /locus_tag="CNE04690"
                     /db_xref="GeneID:3257580"
     mRNA            join(1309822..1309916,1309964..1310151,1310219..1310704,
                     1310763..1310868,1310927..1311227)
                     /locus_tag="CNE04690"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_571162.2"
                     /db_xref="GeneID:3257580"
     CDS             join(1309883..1309916,1309964..1310151,1310219..1310704,
                     1310763..1310868,1310927..1311021)
                     /locus_tag="CNE04690"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_571162.1"
                     /db_xref="GeneID:3257580"
                     /translation="MPEIPNSDSTLDGFVQAFVMIVVSEIGDKTFLIAAIMATRHPRM
                     TVFAGAFASLVVMSMLSAALGRVILGLIPKLWTLWAASVLFFVFGAKMLQEAFSMASG
                     SSHIQDEMREVEEELEEDSAVHDSHNARGTTILLESVEAGTGTRSPRVSTSRLDRSAS
                     PRPSRSGPSIHFPLSGGNNVGPLEKGRHWTMVLKEKIRTTLQMTTNPVFAQAFVLTFL
                     GEWGDRSQITTIAMAGAHSVAVIAFGTIVGHGVCTCGAVLGGRYLSTKISVKHISLLG
                     AAAFIIFAFLYAIEAYYYNGDLEVNW"
     gene            complement(1311197..1313711)
                     /locus_tag="CNE04695"
                     /db_xref="GeneID:36392881"
     mRNA            complement(join(1311197..1312204,1312270..1312349,
                     1312406..1313019,1313069..1313191,1313268..1313711))
                     /locus_tag="CNE04695"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658545.1"
                     /db_xref="GeneID:36392881"
     CDS             complement(join(1311590..1312204,1312270..1312349,
                     1312406..1313019,1313069..1313187))
                     /locus_tag="CNE04695"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514392.1"
                     /db_xref="GeneID:36392881"
                     /translation="MSNNNNNRFDHGSYLLQELLSSMKDESPMWSQYQPLWDPLQVLQ
                     ETSSNATDQTKNNSGIDMVEDGLFNMALSSFPPVTNNLPTQFTPVGLSISQPSSATGL
                     SGGQPPLQLAPISDTSFFPLLSLPSNQVPPPPQQPQLFVPHNLQLPTTITQDFHAPAL
                     SQSPVHQTPTTHQQRLNSHPFVHRTASSPARVSKQPAPYHIPSSTVAGPSSQLDVAPE
                     GVSSLLDLRVDTFTSELPVSQGREPTRSRDRVPEENRKRRLQACEGCRKARHKCQEGG
                     SHKSLPCKRCKSKGITCVWSSKKRMFGRQGLSAQRRASNQTSARDTDDSNQTLVNINV
                     RATVSPISSERNQEPRRTVSDTVIAASASSQRPSANQIVSSLPPLSAQQLADHYLQLI
                     MGQSQKSQQSDAIGSQLSQAPLPWEMMAPQELQNQLQASHPQDQQEQQQFALDFTEFA
                     NTEDGNNTANGGFQYDSLVEALYAW"
     gene            1314096..1315604
                     /locus_tag="CNE04700"
                     /db_xref="GeneID:3257749"
     mRNA            join(1314096..1314337,1314392..1315032,1315081..1315339,
                     1315391..1315604)
                     /locus_tag="CNE04700"
                     /product="expressed protein"
                     /transcript_id="XM_024657292.1"
                     /db_xref="GeneID:3257749"
     mRNA            join(1314161..1314337,1314392..1315032,1315081..1315339,
                     1315386..1315595)
                     /locus_tag="CNE04700"
                     /product="expressed protein"
                     /transcript_id="XM_571175.1"
                     /db_xref="GeneID:3257749"
     CDS             join(1314194..1314337,1314392..1315032,1315081..1315306)
                     /locus_tag="CNE04700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512977.1"
                     /db_xref="GeneID:3257749"
                     /translation="MSYESLTDLLGGHDKQPPSARTLIDSPEVSERELDDEPSLSAPV
                     KEKELGPDTLPIKFTFAPSDTPLGIAAPHTFMHGLFKDGNLYGPYVSNKFESSLPRIL
                     SPNSPEWNDPPAFPPRSGNPRIKGLRKLMLVDCLSHGRVWDAFRAKVQVYQTKLLFFE
                     ESVIVKTTDPSRFPAKAPLPGVFTDKEARLSIFQENMIYTDYLYDLQGEVVPGSYGLW
                     GGRLVLGDDDDEEEDEETSCEVWVMILEDVGEEVDVTTLSEDEKHEIVSHYRELHKAG
                     VLHGDPDPRHWRRHPAGGFRIIDFDSATVLPPGKKGRALMEDELDLVNSHLVEEDRTW
                     YI"
     CDS             join(1314194..1314337,1314392..1315032,1315081..1315306)
                     /locus_tag="CNE04700"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571175.1"
                     /db_xref="GeneID:3257749"
                     /translation="MSYESLTDLLGGHDKQPPSARTLIDSPEVSERELDDEPSLSAPV
                     KEKELGPDTLPIKFTFAPSDTPLGIAAPHTFMHGLFKDGNLYGPYVSNKFESSLPRIL
                     SPNSPEWNDPPAFPPRSGNPRIKGLRKLMLVDCLSHGRVWDAFRAKVQVYQTKLLFFE
                     ESVIVKTTDPSRFPAKAPLPGVFTDKEARLSIFQENMIYTDYLYDLQGEVVPGSYGLW
                     GGRLVLGDDDDEEEDEETSCEVWVMILEDVGEEVDVTTLSEDEKHEIVSHYRELHKAG
                     VLHGDPDPRHWRRHPAGGFRIIDFDSATVLPPGKKGRALMEDELDLVNSHLVEEDRTW
                     YI"
     gene            1316110..1322495
                     /locus_tag="CNE04710"
                     /db_xref="GeneID:3257590"
     mRNA            join(1316110..1316231,1316282..1316962,1317019..1317798,
                     1317849..1318566,1318617..1319655,1319705..1320031,
                     1320091..1320453,1320508..1321080,1321133..1321511,
                     1321567..1321995,1322050..1322226,1322301..1322495)
                     /locus_tag="CNE04710"
                     /product="helicase, putative"
                     /transcript_id="XM_570982.1"
                     /db_xref="GeneID:3257590"
     CDS             join(1316221..1316231,1316282..1316962,1317019..1317798,
                     1317849..1318566,1318617..1319655,1319705..1320031,
                     1320091..1320453,1320508..1321080,1321133..1321511,
                     1321567..1321995,1322050..1322226,1322301..1322370)
                     /locus_tag="CNE04710"
                     /codon_start=1
                     /product="helicase, putative"
                     /protein_id="XP_570982.1"
                     /db_xref="GeneID:3257590"
                     /translation="MSFRQDKLILLLDSGSSQQIRQTAAKQIARIARTSFDAATSKPD
                     AKPHVDGDSSITVHSSGAEQDAWNDTLETISKILALFKSKSSETRHAAAHAIGLLAKS
                     MPEYIEIASMSRAFLTSQPTDLPSTLKHGQMLLASAGREYAAKPLPGDKAKRRKAMMA
                     SVGLGDAVGWGEDTDKVLDDDDDDMEDVRKTAPPSREPSVPPPDVFEGLSARQITMLK
                     RKKGTNIMEEANKMRRLNEKAVGNGSSSAAPSRANSPPLPESSATPDLKAEVITIDPG
                     AKVRAAEAGGQIDPALDTEGNPLASSKTLTITSGQSPWTTVLLEVIPDLHDTTWQTRH
                     GSALVIMEILRSLGTSYANAHPELYVALSRQLLSLLVLDRFGDFVGDTVIAPVRETAA
                     QTLGVVLKYISTPGVKEIHQTLMGMVRQPWAKRGKEAENSQKADKFAWEVRHAGLLGL
                     KYEVAVRGDLLSTKMEEDVKPDVEMGDFNLLDDVVNAAILALGDADDDVRTVAASALT
                     PIAETLASQLPTEELAKLLQSLWDCLAEGGDELGSSTGAVMDLLGALISYSEVIALLS
                     ADNNNLVSRVYAFLRHPIASVRLSVANILLAFSRLSSIPRRWSSDGYFSFLFQNLVLE
                     ERQDVRDVSFQAFETSLVEASDMPEGVGVVLGGDVEDWYSIIMTPIGVALDANLFRRP
                     TKATGQTHNVDKAMMAGDMSLISMDTALQTRIAGAKALALLRRYKLTEINDIKLLRQF
                     LGSASSHQTFLASVIIQEWALDTESRVSDPFSFSLGTSNPDVESLSTLLIDRIGSPAP
                     STYHEMAMVLQRIYSECSALLTAFSVEGKLSKDKVPSLPKRIDPLSNTPDVFSIESAH
                     HAVTTQFDILAGKLSKNAIKNALPSLQDRRNKVMGSVGYFSIMKEKYDVQVMAGIAGA
                     LVALKIMPPKFGPVIKNLMDGVKKEENEILQKRDAFWVAAFIQYTTSPFFTGRINPSD
                     KVVKNLFTFLCLDTSVTPVFSPTAQGATEGIITLLEERTAAAAANARKKDIVEESEEQ
                     MASRMTRRGALETFKAMAKRFGSNLFEKVPKFWEGVSGALLANFADGVNMEQVDQNLT
                     ANVQAGQDLIDALTSLRLIAPELDPVLYYKLHGLFSPIITALQSSFSVVRNAAAQCLA
                     AMCDVMTDEGMKRVVDDVVPLVGDAKKAYSRQGAVEAIHRIIKVLDLKALPYVLFLIV
                     PILGRMSDPDEHVRLLSTSTFASLVKMVPLEAGIPDPPGFSADLLAKRDEERKFLMQL
                     LDGSKAEQYQIPVEIKAELRQYQKDGVSWLAFLAKYQLHGILCDDMGLGKSLQSICII
                     ASKHHERAERHKATQSIDSAHLPSLIVCPPTLTGHWYHEILKFAPHLRAVQYVGSTFE
                     RATLRRSLSSYDVVISSYECVRSDISELSKFSFLYCVLDEGHIIKNTKTKLAVAVKQI
                     KAQHRLLLSGTPIQNNVLELWSLFDFLMPGFLGNERTFNEKFSKPILADREGKATPKE
                     REAAANALEALHKQVLPFLLRRLKEDVLNDLPPKIIQDYYCELSPVQQQLYEEFSRSK
                     AAEEAGMEIETSASKEGQGHVFQSLQYLRKLCNHPALVLDGEPQRFKEIQKKIGGGPE
                     LHDLSHAPKMEALKQLLQDCGIGLPVDKLADDVTTHRVLIFCQLRPMLDIIEKDLFGT
                     HMPTVSYMRLDGSTDPRKRHAIVQTFNADPRIDVLLLTTSVGGLGLNLTGADTVIFVD
                     HDWNPMKDLQAMDRAHRLGQRKVVNVYRLITRGTLEEKIMGLQRFKLNIASSVVTQQN
                     AGLGSMNTGEVLDLFKVSAEGEPVKTKSAGTGAVSMSKMLEELDELPPEDEYAELSLS
                     NFLSKV"
     gene            1322869..1327272
                     /locus_tag="CNE04720"
                     /db_xref="GeneID:3257986"
     mRNA            join(1322869..1322908,1322961..1323440,1323544..1323831,
                     1324084..1324297,1324345..1327272)
                     /locus_tag="CNE04720"
                     /product="expressed protein"
                     /transcript_id="XM_024657293.1"
                     /db_xref="GeneID:3257986"
     CDS             1324345..1326963
                     /locus_tag="CNE04720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512908.1"
                     /db_xref="GeneID:3257986"
                     /translation="MSALDALLPTLPRSSSLYVSDAPRTVPLLDTSSYSPFPTFPGTL
                     KASDPYGLNTFLLHPEDALWNYVDPIPDPLASTASGEEEDEGDASAKSRPQTVRKQKS
                     LGLLRPSPLSQPPMAADETGKPEKQLGRKRSLSMGGETRLSPTQQKEVVDSFRVTVPV
                     TPVREKSKLKKAFALGRKTGRKSETTPPVLTPPVPIVPTLSLAEDDTVGHPVTPLSTR
                     SSSNSTLSSASSTCSSDDIKTPAEGQPVEVMIEGKALANALEEKSKKKGRSVWGWLGG
                     RKIKGDGSQVSPRASAKSTPSSSTADLLTVPQSSPPQPKSQTVLNFPSNQYPVEHTYL
                     TNQLRASSLRKIAQLKAPSPHPFALALARQHRKLPDEVALSIQSGRRVFPKSVNSFTG
                     LADLSPAQGGLRLGLAVRDVMIKLDRGEQPQGTIMARRNSKKNLVPRPKGVLDFINRP
                     PFEQRNFVYFPDGVYSPISMARPGYGVWELDFSAYIQGLGELHEVSSMRNVERESKES
                     FKAMQEERIEEAVEEKEVEGGQDQQAALMALIAKKAKPLFISDPLESPSPSSSSPCVS
                     SENLPFSSFHPTSQRRISQSSDDEDDEPLSLTKRRSQLLGAKPSQPSLIPSLDTRVHN
                     LSQAQATGDPASKRPSCLAPPPTDPHAAMLEVQRARERRELNRRGENEKRAEAERLME
                     KMKDRNTRDVSMMDLKSAPDLSVRDKMPQHKRASSSGSKLDLAHLQASRSSPQMGYPP
                     TPRRSNTQPMPTAQAHDGRRRSVMSLVDSYPAPQAMLYAPPSNPGSKRPEITKAKTGL
                     ERDHSKSRFHSFYEQRGGVISTSSLNRRASQVAMVQPLPQDYLQQGVTRGSMVFGYGV
                     SGMGVGTGDKRSSRMA"
     gene            complement(1327390..1331199)
                     /locus_tag="CNE04730"
                     /db_xref="GeneID:3257529"
     mRNA            complement(join(1327390..1328388,1328441..1328620,
                     1328677..1329699,1329750..1330350,1330401..1330514,
                     1330565..1331199))
                     /locus_tag="CNE04730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657294.1"
                     /db_xref="GeneID:3257529"
     CDS             complement(join(1327423..1328388,1328441..1328620,
                     1328677..1329699,1329750..1330350,1330401..1330514,
                     1330565..1330866))
                     /locus_tag="CNE04730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512909.1"
                     /db_xref="GeneID:3257529"
                     /translation="MSANPLTYPSSRRPFSLDVFKSPPSEYRGAPFWAWVTKQEKQST
                     VDQIKMLEEMGMGGFHMHTRVGLDIPYLGEEFMSIVEGCVDEAKKRGMSAFLYDEDRW
                     PSGFAGGKVLEGHPELRHLHLLFTPWAYGSELGYKKPDFPIANAAPMRSELGTLLAMY
                     AIKLQDGFLHSSRIISSTSDLKTSEVVWYAYAEPLPDSGFFGDQTYTDLLSKEMTSRF
                     IEVTHEVYKKHVGSSFGSVVPSIFTDEPQYCPMSTLNVAEKPQDVFLPWTRGIIGSFK
                     ASKGGDLLELLPRLVWDSADGQPNTTRSQFLDHVCELFSTNYIGTIAKWCAKNNIMCI
                     GHMNAEPTLASQTAQNGEVMRCYREMQFPGIDMLCDKRELNTAKQAASVARQYGRPGV
                     MSELYGVTGWQFTFEGHKGQGDWQAALGVTLRVHHLFWSTMEGEAKRDYPACIGYQSP
                     WWKEYKTIEDHFARVNSALTRGKPVTRVAVIHPIESYWLCFGPKDKNAEELDYREQAF
                     AQLTEWLLGSHIDFDFISESLFPELTSLEEITSTLSVGECKYDVVIAPNLRTIRSTTL
                     ERLDKFAKEGGKVIFAGSTPTLVDTLTPSSPPSIPMAVTLPWSRAQVLSALQPFRDVD
                     MVINESTLYRTQGKKADTLFYQMREEGEERWVFICNTDRKESTPVEVGFKGEWKIEVL
                     DTMKADAWAIQCNQRNGWTYLKYWFDGCESVLLHLVQGSSKNGKPQTVVRRQYKQVAD
                     VKLQSISLSEPNTLLLDYCTYKWDDEPWSSSSEEILAIDQLLRRRFGLFLKGAKFRQP
                     YTIPSSSRKPIGKLRLRFVFRAACEVQEAHLAIEGADKVKMWLDGQQAKMKVDGWWVD
                     KSIKTIPLPCITEGTHTIEFEYDYSMLTNLERIYILGSFGVDVRGRTTSIVPLDLSTI
                     EWGDITRQNLPFYTGNITYHCTFTSLGNTPQAIRVARYAGPAVSVDVDGSRAALLVHE
                     PYAFELGNLSKGAHTVDFTCYGDRHNAFGAVHLVPNKTNWLNADTWRSDYDWWSEEYV
                     LGEIGILNAPRVEEPGLEVPKQVRRGLMLHV"
     gene            1331420..1333143
                     /locus_tag="CNE04740"
                     /db_xref="GeneID:3257772"
     mRNA            join(1331420..1331663,1331712..1331929,1331996..1332094,
                     1332168..1333143)
                     /locus_tag="CNE04740"
                     /product="expressed protein"
                     /transcript_id="XM_571150.2"
                     /db_xref="GeneID:3257772"
     CDS             1332170..1332439
                     /locus_tag="CNE04740"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571150.1"
                     /db_xref="GeneID:3257772"
                     /translation="MLFTSLVFSIGTSVIQRHSLLCQNHRAKRAISSIHRQKHTLHPQ
                     SIGLYSVVRYRVNILFPLFDWTSSITMGCRRFPEPRAYMEGKAFY"
     gene            complement(1333095..1334642)
                     /locus_tag="CNE04750"
                     /db_xref="GeneID:3257620"
     mRNA            complement(join(1333095..1333656,1333708..1333884,
                     1333944..1334157,1334211..1334270,1334335..1334642))
                     /locus_tag="CNE04750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571183.2"
                     /db_xref="GeneID:3257620"
     CDS             complement(join(1333247..1333656,1333708..1333884,
                     1333944..1334157,1334211..1334270,1334335..1334418))
                     /locus_tag="CNE04750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571183.1"
                     /db_xref="GeneID:3257620"
                     /translation="MSKILSFLATLAISAAVVRGQAAPNWQYVPQTCASDCAETVKTA
                     YLCEATYTDGTEAYSCFCNNFPSDASACATCLSSNDASAVASVLTSAQTACPAAISQC
                     FFECDFTTCSSTDVACQCDGTYLENIFNCASCNTANGNTAATQVSDFQALQESCANQN
                     YTGASESFTTKALPTIATSDYTAPSLTATGGGAAASDTAAVVIGTTSNAAGTNSTPAA
                     TSDSDAASSSSPAAASSGSETASSAAAAVASTTSAADRTSAVSGTTGGSASRSVSQSA
                     SASASSSSSSDSSSSGAGMVAPAVGGVLAFAGAALALL"
     gene            complement(1335467..1337017)
                     /locus_tag="CNE04760"
                     /db_xref="GeneID:3257637"
     mRNA            complement(join(1335467..1335794,1335848..1336068,
                     1336139..1336317,1336367..1336515,1336601..1336701,
                     1336771..1337017))
                     /locus_tag="CNE04760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657295.1"
                     /db_xref="GeneID:3257637"
     CDS             complement(join(1335747..1335794,1335848..1336068,
                     1336139..1336317,1336367..1336515,1336601..1336701,
                     1336771..1336909))
                     /locus_tag="CNE04760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512978.1"
                     /db_xref="GeneID:3257637"
                     /translation="MPAADQLAIDCQSLTYSWKEGDDPVLENVNLELRKGDRCLLLGA
                     NGAGKSTLLRILAGKRLTKTRTCRILGQDVFMSPPGGVVYLGTEWSSNPVVRSDIVVS
                     HFLDSVGGYRHKERRDRLLRILDVDLDWHMHQISDGERRRVQLCMGLMGEWDVLLLDE
                     VTVDLDVLVRADLIDFLISESETRGATIVYATHIFDGLKKFPTKICHIQLGSTPRGLI
                     AWPPADKGLQEETLFELALGWLREDRDLRRQKENEKGRTRGPKTDTRDAKTFFEKYDY
                     SH"
     gene            complement(1337395..1338882)
                     /locus_tag="CNE04770"
                     /db_xref="GeneID:3257800"
     mRNA            complement(join(1337395..1337504,1337555..1338001,
                     1338057..1338882))
                     /locus_tag="CNE04770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571181.1"
                     /db_xref="GeneID:3257800"
     CDS             complement(join(1337685..1338001,1338057..1338696))
                     /locus_tag="CNE04770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571181.1"
                     /db_xref="GeneID:3257800"
                     /translation="MASLNPCAKELHLLYVLTDSSLPTGGFVSSSGLESFAKHGFLSS
                     QYSYTSKEFKDGGVPGKKSMTGGLVDFARAEVSNYASTTGGFVKDGWTCVDDSRKASK
                     AGTGIIEDEVQRVLQKIQALDKYHECTLLSHVGRRSSKAQGVAMLTLFSRGLSRPVGI
                     DEYLNDDGGGPGSTDEMGVKIIEGYKKMVILEKVPGHLAVCWGVITAALGLPVDRALH
                     LHLFLHARSLLSSAVRLNIIGPYASSQLLLHPYRDIINQEVEKLSNCTTGIIEDKAEK
                     SGEEEDLWAWTEDAEKGPATTWPLGEVLMGRHDIQHSRIFNS"
     STS             1338330..1339081
                     /standard_name="Xho16"
                     /db_xref="UniSTS:470919"
     gene            1339055..1340611
                     /locus_tag="CNE04780"
                     /db_xref="GeneID:3257533"
     mRNA            join(1339055..1339242,1339308..1339375,1339424..1339477,
                     1339526..1339626,1339682..1340611)
                     /locus_tag="CNE04780"
                     /product="expressed protein"
                     /transcript_id="XM_570990.2"
                     /db_xref="GeneID:3257533"
     CDS             join(1339126..1339242,1339308..1339375,1339424..1339477,
                     1339526..1339626,1339682..1340535)
                     /locus_tag="CNE04780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570990.1"
                     /db_xref="GeneID:3257533"
                     /translation="MALLSDKLQEFTIKAANQSQIELHAKASYVIWPRAQSFEEYWEV
                     YKTERREAPWGKDAFQTWVLVHRDDPEGEVYAACKTYRRKAFVKHRGADDIEDGYVYG
                     IASVVTPKQHLRNGYATRLLSLLHRYLGPENTLPPVPESWGKDQPYIQLPPDIAPKIP
                     KALGSILWSDVGSTFYSRCLSGQGRQGWIVDDALNGELVWKILPSADPVEEVYTWIYQ
                     EGLVSVGQELSVRAQNELRKSDTTERSIFLQDPANPGTLFFLPVKSTWLNPEFKSLPV
                     GLRIKASSGNSTEDAIVLFTVSNRSIRKRFLITLISNLAPLQLPSVLKAFDILAAKVG
                     HEEGCAWGLEAESELVKAWKALSEREARVGRREEVDGHLLGVAWYGPEEDRGMLGDGQ
                     MWSWC"
     gene            1340779..1342529
                     /locus_tag="CNE04790"
                     /db_xref="GeneID:3257944"
     mRNA            join(1340779..1340843,1340944..1341103,1341181..1341248,
                     1341307..1341360,1341423..1341523,1341576..1342529)
                     /locus_tag="CNE04790"
                     /product="expressed protein"
                     /transcript_id="XM_570993.2"
                     /db_xref="GeneID:3257944"
     CDS             join(1340987..1341103,1341181..1341248,1341307..1341360,
                     1341423..1341523,1341576..1342429)
                     /locus_tag="CNE04790"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_570993.1"
                     /db_xref="GeneID:3257944"
                     /translation="MSDAQTRLRQFTTRAANTSQIEQHARASYAVWAKGKSWEEFWGI
                     FQWELNDAQWGKDALVTWVLIRTDDPEGEIYAGCKTYRRKGWVKHRGANDIEPGFVYD
                     VTFVVTPKQHLRNGYANRLLSVLHRHLAPSSTIPPIPEAWDKDQLSISASPDIIARTP
                     KAFGSILWSDIGSTYYARCAISPDRPGWIVDDSQNGELVWKILPPKDDAEEGFEWLYL
                     EDLDAIGEELSDRLKEKLRQADTTERALFIQDPATPGTLSYVPAKGVRLSPTSQRIPV
                     GLRIKSSSGNASEDAIVLITVTCIPFGERFLITFISNLTPAQLPLVLRACDKLAADAG
                     HEEGWVWGVNGEVGLVKAWNEEPGREVKVGRRPEQHGHLLAVAWYGAEEEKGTIMESQ
                     IWSWG"
     gene            1342756..1344400
                     /locus_tag="CNE04800"
                     /db_xref="GeneID:3257969"
     mRNA            join(1342756..1343027,1343079..1343146,1343196..1343249,
                     1343307..1343407,1343461..1344400)
                     /locus_tag="CNE04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_570995.2"
                     /db_xref="GeneID:3257969"
     CDS             join(1342899..1343027,1343079..1343146,1343196..1343249,
                     1343307..1343407,1343461..1344314)
                     /locus_tag="CNE04800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_570995.1"
                     /db_xref="GeneID:3257969"
                     /translation="MTLTTDSRTQKLQQFTIRAANFSQAEQHARAAWAIWNKGKTWQQ
                     FWEIFQMEINEAEWGKEALVCWVLVRLDDPEGDIYAGCKTFRRNAWVKHRGADDIEEG
                     YVYDVTYVVTPKQHLRNGYANRLLSLLHRYLGPEANLPPVPESWGRDQPTLPLSPEVA
                     SRVPKAIGSYLWSDIGSTFYSRCSIGENRPGWVVEEPSITELVWKIHPSTVSIEGPLE
                     WLYIDDLKTVAEELHVRQRKRLREANTSERSLFLADPATPGSLGYLTIKGSWSTPTDI
                     SLPAGLRIKSASGNPSDDAIILFTLHCSLIAPRFLIRFVSNLSPSQLPVALSAFDDIA
                     TQAGHTEGCVWGLTEEKELVEAWRAQPGREVAIGRRPELDGHMLGVAWYGKEEDNGSL
                     LDTQMWGWQ"
     gene            1344429..1347237
                     /locus_tag="CNE04810"
                     /db_xref="GeneID:3257829"
     mRNA            join(1344429..1344938,1344997..1345143,1345194..1345307,
                     1345363..1345610,1345659..1347237)
                     /locus_tag="CNE04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657296.1"
                     /db_xref="GeneID:3257829"
     CDS             join(1344554..1344938,1344997..1345143,1345194..1345307,
                     1345363..1345610,1345659..1346354)
                     /locus_tag="CNE04810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512916.1"
                     /db_xref="GeneID:3257829"
                     /translation="MRSFLKSIFKPSPSSNRSTRPRKRSRESPFTTRYYSEYNPQPED
                     LGTLPDALQGQLMIDNNEETESTIPRLLRVLEDRGQSGEEGMITPYLHEGRNYRTGDT
                     ITTSSLSINERVGLVEAVLQANDEAINDLEKLLQTAFGMAPNSRLLGQMMNLLETQRH
                     EINEMKPYIESRPFPSLLTLQQIYAKVDGEINNLADLPDTVARDTLVTLVQVLQEGPD
                     YLIDVCLISNIVWYAKIVDLSYAASIQHMLDKAIDQKSNLTTFRGAVESIFAISAALS
                     VDFLDDQTAENAYRDLGALLRQLELRMESSKEITPETIIVNSVVGSSATTGASTPTPP
                     PMPGYAADTSILSPAVLSPSSSFPSSPNASEFKSIDMKELQTLFGTGVSTPVTPLSGL
                     SSFDATPTDTTAKPTRAPSSSAVSVAGSDSSEEIWEYRGQFLTRSALDLVLRQETLAQ
                     ADSSGQYAGEASWDDLRGTWIPVWVKKLKLSDLAEGEIPDSSPAGFQERDTDAWGNKI
                     GWYGSHKEMYYKEEPKWELKD"
     gene            complement(1346312..1348060)
                     /locus_tag="CNE04820"
                     /db_xref="GeneID:3257661"
     mRNA            complement(join(1346312..1346499,1346554..1346840,
                     1346896..1347040,1347113..1347312,1347365..1347440,
                     1347491..1347586,1347644..1348060))
                     /locus_tag="CNE04820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_570999.2"
                     /db_xref="GeneID:3257661"
     CDS             complement(join(1346431..1346499,1346554..1346840,
                     1346896..1347040,1347113..1347312,1347365..1347440,
                     1347491..1347586,1347644..1347955))
                     /locus_tag="CNE04820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_570999.1"
                     /db_xref="GeneID:3257661"
                     /translation="MTPPRSLLRYITSMSSKQPFVARWGILGCGWISSEFTKDIGRPM
                     ASRNVTDVSHAIAAVGSRSLSKAEDFISKYCPNGAAGQQDGLVDFKPKAYGSYKGVVE
                     DPNVNIVYVGSMNIAHYEDAKLALEAGKNCLLEKPATLNAAEWKHLVSIAKKNDVFLM
                     EAVWTRFNPVMLAIQKAIHEDNLIGEIRCMYSDLAMDAYKKRPNTNRLFAAELGGGSL
                     LDLGPYPLVWTMMILYRHPMNQLTPPDKVGSTMLQHHTGVDLATSITLTFPKLNAVSF
                     CTTNLLSNVQKYQNTRIVGSKGEILVHGLTSRPQKYTIRRLLNPEIEDGDYEDETIDM
                     TFDGFGLYWEADAVARCLRDGLKECPSMPHAETTMTMEIFDKVRKEGGYEFLPGLEKV
                     KA"
     gene            complement(1348241..>1352126)
                     /locus_tag="CNE04830"
                     /db_xref="GeneID:3257943"
     mRNA            complement(join(1348241..1348477,1348530..1349248,
                     1349317..1349502,1349565..1349687,1349746..1350144,
                     1350194..1350607,1350664..1350930,1350997..1351064,
                     1351116..1351218,1351266..1351553,1351609..1351713,
                     1351770..1351841,1351902..>1352126))
                     /locus_tag="CNE04830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571001.1"
                     /db_xref="GeneID:3257943"
     CDS             complement(join(1348375..1348477,1348530..1349248,
                     1349317..1349502,1349565..1349687,1349746..1350144,
                     1350194..1350607,1350664..1350930,1350997..1351064,
                     1351116..1351218,1351266..1351553,1351609..1351713,
                     1351770..1351841,1351902..1352126))
                     /locus_tag="CNE04830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571001.1"
                     /db_xref="GeneID:3257943"
                     /translation="MTMAPPPATPSASSKPRLPPKSAATAPATGRVTRLRAAKEAVAS
                     PAETSRQPGFLTKGKEGFRKVSGKIGQKEKVAPTPRAKLAAQPISKPEASAESLKAYL
                     RIRPPPVPDLVSTARPYLEIQSETDVLMRAPAENARHHIPRPPHLFSFDRVFPPDTAQ
                     SPFFTTTTLPLVEKLLQGENGLLFAYGVSNSGKSYTIQGGNTTSTTERGVLPRAIDVV
                     FNSIEGSESKANLQPQGLADVVLCDEVDGSLNIVDPLAATEPRTDEAVKVDKNFSYAV
                     FISYAEVYNEKIFDLLEAVLPTSSPSASIFPRPRATYDKFPRTSHMQGIPSVLNSSFN
                     MAAMANGGGGVLKRQALSLKNDPDGNGKYIAGLKDVRVRTREEALAVFRSGQNARQVF
                     GTLANRESSRSHGIFTIKVVRVHNGAPEDPDSAQVSRLAIVDLAGSERNRNTHTTGDR
                     LKEAGNINKSLMVLGQCLEVLRSNQQKLSASSAVGVKKRIAVVPFRHSKLTEIFQNFF
                     VGDGRAVIIINVNPYDTGFDENSHVMRFSASAREVQTTASNRVGLPLLKRQISTQFNA
                     FKHAVSAPMKIKVTVPVIPKDDGAASQAMKSKIFAERESQGFVMVEEELEVKEEDAED
                     EDEEDKDLLVEYLFDQLKEMKTRLYESEMRAAAIEVEVREEVAREMQEAMQRMHKEFS
                     QRLNEHVAASELKADRKIDIVMRTMTPAVSRIARYELSPAESSYADRDESRDDLSIEK
                     SFESAIDESLLVSGDDSMVSSHSDPFLAKPASTIPKLTISRDSTSHRTLADRESDREM
                     IKEEVKKHDEEYEDELTRSEDERSMVHENEEKEGIEEEEEKENDEEEEESEEEEEKEE
                     EEEEEEEEEEEEEGPDSDGSAFTISDEEVSEDDESEPSPPRRLSSVKRKDSNPIKRIP
                     AKVPSRLQASSPLTPGAVKGNKMTHDATSKATSKTEKSREPVFETPGPLSVRVGQLQL
                     GDDDDDELPIKTTVKKKRTLGKKKVVTEDDMERNDMDISGAEVKRLIRGAK"
     STS             1352176..1352437
                     /standard_name="GTT7"
                     /db_xref="UniSTS:470921"
     gene            1352332..1357402
                     /locus_tag="CNE04840"
                     /db_xref="GeneID:3257959"
     mRNA            join(1352332..1352774,1352829..1353073,1353132..1354112,
                     1354169..1357402)
                     /locus_tag="CNE04840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571003.2"
                     /db_xref="GeneID:3257959"
     CDS             join(1352560..1352774,1352829..1353073,1353132..1354072)
                     /locus_tag="CNE04840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571003.1"
                     /db_xref="GeneID:3257959"
                     /translation="MAEPPYTTFTKWQKLSLVVVASLSASFSGFASNIYFPAIPVMAT
                     SLGTSIENINLTVTTYMIFQAITPTFWGAISDAYGRRLVLISTLTVFFSACIGLALVK
                     HYYQLVILRCLQSTGSASTIAIGSGIIGDVADRKERGSYMGFFQTGLLLPLAIGPVLG
                     GIFAQTLGWWAIFWFFVIYAGIFLLILALFLPETLRRIVGNGAIYPPARSRTPLEHFL
                     ASRDKTLPPITSATPIRPDWIAPLRILFVPDVFLTLSFLSLHYATWQMAITAQSSLFK
                     SIYNLNEIEIGLTFIANGFGCMLGTLSIGRFLDYDYQHFKKKFSGPTSDFPIEQARLR
                     TVWFWSPFQCAAVLWFGWTLDQKVHMASPIVASFVLAWAAMSIQAVISTFIVDIFPKS
                     SASATAALNLARCLMGAGATASVEPSINTLGVGFTFTLWACLMALSLAFVGVQMRFGP
                     AWRKRREKRLEEGEKG"
     gene            complement(1354392..1356501)
                     /locus_tag="CNE04860"
                     /db_xref="GeneID:3257981"
     mRNA            complement(join(1354392..1355137,1355193..1355324,
                     1355375..1355703,1355762..1356501))
                     /locus_tag="CNE04860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571180.2"
                     /db_xref="GeneID:3257981"
     CDS             complement(join(1354996..1355137,1355193..1355324,
                     1355375..1355703,1355762..1356490))
                     /locus_tag="CNE04860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571180.2"
                     /db_xref="GeneID:3257981"
                     /translation="MRASRFVIPSTQPVRFRRQFRPAWIPSLGTGYDSCCVYSTTTSS
                     SISSDSGSESGPSSGFSSRRFRRRYLYPLAFLPAGFLLVPTLSAETEPFPGAGSSSLQ
                     IASTAQLLRTWLVYSLISFPGVVDYSPKILSILINSPLRLPTEWFVRNTFFEQFVPGE
                     TVEDCISSLKALRTRGIGAMLNYSAEVDESRLQDDNTYGKEARRQRERKHRLEQVMMA
                     LEKSGEYERSLPVEQRGATGFALKVTGIVDPNVLERASYTLLRLRSLAESSSTNAPNT
                     PLFVPYPCTPESLDCQVLARTQDLNFGDPRELFALKDKWDDIGVLETDPGLKEDDLEV
                     LSDLWYNLRKIGEKAKENDVVLIIDAEHTWYQPALDGYTLLLSEVFNKPPKSKSEKWN
                     GPLIYGTYQSYLRRQPTHLMHAIQHAEANGLRSRSQTRPWCLSPPRTQEMA"
     gene            complement(1357386..1359617)
                     /locus_tag="CNE04870"
                     /db_xref="GeneID:3257576"
     mRNA            complement(join(1357386..1358155,1358208..1358339,
                     1358391..1358719,1358775..1359617))
                     /locus_tag="CNE04870"
                     /product="proline dehydrogenase, putative"
                     /transcript_id="XM_571179.2"
                     /db_xref="GeneID:3257576"
     CDS             complement(join(1357504..1358155,1358208..1358339,
                     1358391..1358719,1358775..1359473))
                     /locus_tag="CNE04870"
                     /codon_start=1
                     /product="proline dehydrogenase, putative"
                     /protein_id="XP_571179.1"
                     /db_xref="GeneID:3257576"
                     /translation="MSAIRPIMRPFRMTTPFRQSSSFRQLRITWAPSFGAGSSRCLTI
                     GLSPSSGSGSSFRRRLLYPLAILPVGLLLLPVLSADSEPDAIPVPTSLSTSTTSELLR
                     TWFIYAIISMPGVVDYSPAVLNFFINSSLRGPTEWFVRHTFFGQFVAGETVEGCMPTL
                     KAFRERNVGAMLNYSAEVDESQLTETAPSKEERNRKEREKKFETIITALEAAGEYERS
                     LPVDQRGVTGFALKITGLIDPNILERASYTLLRLRPLAKSNSPTAPNTHLFVPYPGTP
                     ETLDRQVVARTPELKLGDGKELLALKGKWDDMGVLEKDPGLQEGDLEELRQLWYKLQK
                     IGHKAKENDIILYVDAEYTWYQPALDAYTLLLSQEFNRPPTSKEEIWTGPLIYGTYQT
                     YLCRQPTHLIHAIQHAEVNGYALGVKLVRGAYFEQERKKWSDEGRVGAAPIWPNKSAT
                     DVAYNGSISTIMTTLASQLKSPHPELALSVAFGTHNPESCDLVCENLLRNGLAKEVGE
                     AKMLRLREDVRGKVRIAQLLGMKDDLTDRMARKFVNDGKPVALKYMAYGKLSEVMPYL
                     GRRAIENKSLMSGDHGAAAEMRRVAAELKRRFFGGSV"
     gene            1360944..1362506
                     /locus_tag="CNE04880"
                     /db_xref="GeneID:3257523"
     mRNA            join(1360944..1361128,1361182..1361249,1361314..1361367,
                     1361422..1361522,1361576..1362506)
                     /locus_tag="CNE04880"
                     /product="expressed protein"
                     /transcript_id="XM_571005.1"
                     /db_xref="GeneID:3257523"
     CDS             join(1361012..1361128,1361182..1361249,1361314..1361367,
                     1361422..1361522,1361576..1362429)
                     /locus_tag="CNE04880"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571005.1"
                     /db_xref="GeneID:3257523"
                     /translation="MSDSRDHLQEFTIKAANPAQAEQHARAGFVMWGRKQSWEEYWEV
                     YEKERKEAAWGKDALVTWVLVRNDDPEGDIYAGCETYRRKGWVKHQGASDIEEGYVYG
                     IASVVTPKHHLRQGFATRLLSLLHRHIAPANTLPPIPDSWGKDQPVIPVAEEVSSRLP
                     KAIGSVLWSDIGSKFYSRCSMGAERPGWLVEDSQNTELIWKIFHPAAGSTEGFNFLFE
                     DDLEEIGQILSEAMQERLRKTDTSRRAYFVQDPSTPGVLSFAPVKGSWMEKTPSPLPV
                     GIRIKSPSGKPSDDAIVLFAVTCPPIGERFLITHISNLDSHQLPFVLQAFDMLATDAG
                     QEEGWVWDLSLSSNLVHAWQQLPDREVRVGRRQEMYGHLLGVAWYGPEEEKGTLLESQ
                     MWSWC"
     gene            1362740..1366008
                     /locus_tag="CNE04890"
                     /db_xref="GeneID:3257508"
     mRNA            join(1362740..1362838,1363010..1363134,1363185..1363632,
                     1363679..1365004,1365062..1365233,1365295..1365435,
                     1365539..1366008)
                     /locus_tag="CNE04890"
                     /product="mRNA polyadenylation-related protein, putative"
                     /transcript_id="XM_024657297.1"
                     /db_xref="GeneID:3257508"
     CDS             join(1363061..1363134,1363185..1363632,1363679..1365004,
                     1365062..1365233,1365295..1365435,1365539..1365747)
                     /locus_tag="CNE04890"
                     /codon_start=1
                     /product="mRNA polyadenylation-related protein, putative"
                     /protein_id="XP_024512918.1"
                     /db_xref="GeneID:3257508"
                     /translation="MSNERGRGRGGNRGGRGGMEGGSARRGAWRNGPPAGSFPHSRGG
                     SPALGQSPTPRMSINDHMHDLKIVHGEHKGFQTDTDISRTAGPVERELQPWVPDGPSP
                     PPLSNGESGNADFETFGTTNNITWDQFETNERLFGAKTDFKEELYTTKLNKSGPDFHK
                     REKEAERLAKQIMGQTSKNAHIAEERGQATDTRDEEEKYSGVSRAPNAYVPPSARRAM
                     GQSSATLRPDPTSESKTNGSTPVPAKTASPAALETAPPVPERRISDDPVGSKPEAPAM
                     KVTGTTVRPITENIEVTVNGASVTAETKPELSGVVNEWRQFVGTEREKVEAKKQSVLK
                     SEKEKQLADFKKFQANFKVPLPLPKDILPILSKDEAKQKDIEAKATSALQAAKERKSS
                     IAKDSPAKSPATLNSVKSDAPKPAPPKKIVMKIPEIPPFNPAKRKAPAVPVPESATQD
                     IKLITSPAPSNGSLASQATKLNPTASTFVFKPRADAAPFKPGQPSVSPSIAPNQPSAG
                     PSNASASATAPKGNAFFRDKLPEKTHINAREDFNPWKHGPVPRPNTVGTGWPYPGRKV
                     GVPPPFMSPAAPPQMQMQFEDDPTSPSPHPAQPAMMPGMPPNYPPYGRFQPGMPPPYG
                     VPGGMQNPMFSPGPHFSPHPGQPMGQPPQHMMPGGPQPNMPMYFQNGMPQNPAFLPPQ
                     MQQFPHNPQRPGPGPGPGPGGPQMFYPNQMPPMPHQTPLQQHTIPFSGPSPAQPQFQH
                     QHQHQHQGQHPHQQAPPPPPVQMSPAHSTPNGPGGVVQGGPQQNGQTQG"
     gene            complement(1366089..1368850)
                     /locus_tag="CNE04900"
                     /db_xref="GeneID:3257607"
     mRNA            complement(join(1366089..1366354,1366422..1366473,
                     1366529..1366621,1366714..1366933,1367009..1367200,
                     1367268..1367355,1367409..1367811,1367867..1368850))
                     /locus_tag="CNE04900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571009.2"
                     /db_xref="GeneID:3257607"
     CDS             complement(join(1366203..1366354,1366422..1366473,
                     1366529..1366621,1366714..1366933,1367009..1367200,
                     1367268..1367355,1367409..1367811,1367867..1368763))
                     /locus_tag="CNE04900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571009.1"
                     /db_xref="GeneID:3257607"
                     /translation="MSNQEEKPLWTPTDPTSTQTHLFLSHINKIHSLSLTTYADLWEW
                     SCAHRSDFWSALWDWEHIIGDKGVKENGKVVDEDKTPEENPPWFTESSLNWAENQLRH
                     AKSRPDDIAIIQVCEPCSTYVPSIKQITQFELYSLVGKAQRSLRAAGVGKGDRVAFWG
                     GNCLEAVVTVLATSSLGGIFSSAAADFGIDGVVERLEQIQPKVLVVTNGVIYAGTPRP
                     LLPRVAPLLNILKNPPSVVVSVDHLPEELVPTFAEVKEKLVRWDDWLDQKDGDVDFLR
                     MGFDEPIWILFSSGTTGKPKAIVHRQGGMLLDSLREHHLAGDISSSDIFFYYTTPGWM
                     MFQYLISGLATGATIVLYEGSPLKLPSHLWSLIDDLGITVFGTSAKWIEQVEKHYPDV
                     GKNHDLKTLKQILSTGSPLPGRLFDFIYEKVKKNVLVGSVTGGTDICSVFAGRNTCLP
                     VFRGEIQSRMLGFALDTDGNSDHAGELICHKAFPIEPLGFWPLPGYGFDEAQVEEAKK
                     RFKDSYFKGDKGIWYHGDYVQITPSRLGNGGGLIMLGRSDGVLNPGGIRFGPTDIYSV
                     LENLTFAKEGVEETLVVGLMCDGGADEKVVLFVKMRGGKELDDGLLAKIKASIRTARS
                     ARHVPAKIIQVSDIPVTLTGKRVEVPIRKVINGAPISSINPSTLQNPECLEEYAQLGK
                     KMREEEGMGAGAFAQC"
     gene            1369145..1370204
                     /locus_tag="CNE04910"
                     /db_xref="GeneID:3257496"
     mRNA            join(1369145..1369737,1369803..1370204)
                     /locus_tag="CNE04910"
                     /product="hypothetical protein"
                     /transcript_id="XM_571011.2"
                     /db_xref="GeneID:3257496"
     CDS             join(1369552..1369737,1369803..1369952)
                     /locus_tag="CNE04910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571011.1"
                     /db_xref="GeneID:3257496"
                     /translation="MMRPSPYLFPRLTPLFRHAPAYPPVIVHTTSAVTPTHTASETDQ
                     ATGSWWVTHIHQNTLPTLQSEPTTASLNRDTSPPPPPSEYETEIQTGPRKSHLPPPTI
                     AWYDYLTMV"
     gene            complement(1370414..1371508)
                     /locus_tag="CNE04915"
                     /db_xref="GeneID:36392882"
     mRNA            complement(join(1370414..1370732,1370813..1371022,
                     1371128..1371155,1371224..1371508))
                     /locus_tag="CNE04915"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658546.1"
                     /db_xref="GeneID:36392882"
     CDS             complement(join(1370664..1370732,1370813..1371022,
                     1371128..1371155,1371224..1371423))
                     /locus_tag="CNE04915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514393.1"
                     /db_xref="GeneID:36392882"
                     /translation="MLLRQSFLSHHIIRRTIMTASYTPIAIQHVNLAIPKDTLEQAQE
                     FYGDVIGFKNDQVPQAQRDTLLWFRVGDGPQQIHVSFEKGISEAGPALSDRAPISSRH
                     PCFSLPSQEALTALQERIYEHHIKGLPASAEECDKPGGENSGSKGVEFPTRFFARDFA
                     GNRLEFSI"
     gene            1372411..1373807
                     /locus_tag="CNE04920"
                     /db_xref="GeneID:3257616"
     mRNA            join(1372411..1372606,1372745..1372758,1372929..1373028,
                     1373108..1373129,1373254..1373341,1373407..1373807)
                     /locus_tag="CNE04920"
                     /product="hypothetical protein"
                     /transcript_id="XM_571177.2"
                     /db_xref="GeneID:3257616"
     CDS             join(1372592..1372606,1372745..1372758,1372929..1373028,
                     1373108..1373129,1373254..1373341,1373407..1373467)
                     /locus_tag="CNE04920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571177.1"
                     /db_xref="GeneID:3257616"
                     /translation="MSAKDYYGNQQQPYGQQYGGGYPQQGGYGGPPQQGGYYPPPPQQ
                     SYQQPGQYYPQPQPQPVYVQQQPKKSGGGGAGCCACLAGALCCCCAEELCCDMLF"
     gene            complement(1375737..1377563)
                     /locus_tag="CNE04930"
                     /db_xref="GeneID:3257593"
     mRNA            complement(join(1375737..1375936,1375996..1377225,
                     1377290..1377563))
                     /locus_tag="CNE04930"
                     /product="expressed protein"
                     /transcript_id="XM_571178.2"
                     /db_xref="GeneID:3257593"
     CDS             complement(1376219..1377214)
                     /locus_tag="CNE04930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571178.1"
                     /db_xref="GeneID:3257593"
                     /translation="MSSSKQLKQSELVLPLDSLLPVHDHIIHHLSFIAPLKTLTLSKY
                     YYRHTIPILYRTVPISSKSLYGLLWGVHKDARARTLKAFSNTRVIQLTNLDSILTYHH
                     LSMTDPKLSVTPEEYNNLLSNVRRIEFMWEAAVSPFYTLYNQTYPDQPAYAATIQRLV
                     PSPCEELVVHLKNTDGWLGVDLCFKQEISEMLKHHSPSTATIILHLDLLATSSYYSLL
                     EACARCWNEKKRLRVIINMSNVDYFSPSSSPGSDFCRLLYAVIAKFSHHHLDKALDSS
                     VQKPLEDVLEIYIPRAESVQEYLKVCDLESHRESEIAGVVKILELEQDVLEEYVS"
     gene            1378983..1381347
                     /locus_tag="CNE04940"
                     /db_xref="GeneID:3257501"
     mRNA            join(1378983..1379284,1379631..1380462,1380523..1380994,
                     1381046..1381347)
                     /locus_tag="CNE04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_571013.2"
                     /db_xref="GeneID:3257501"
     CDS             join(1379919..1380462,1380523..1380994,1381046..1381097)
                     /locus_tag="CNE04940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571013.1"
                     /db_xref="GeneID:3257501"
                     /translation="MMMASSVLAPPHSRPISHTPSPTASPKLVPVAGTMAPISLSLSS
                     SASSAPTTTAASHGTLSQSAPTRSFVRGPQARPYGPPMSRKKELDGDTKRFAELVVET
                     VDERRRLSLAASSPVSRGRTLEGEKGLVEMVENVSLQGAHEARSIERRGTQGRMMSGS
                     WEAERADLIVDYPVWSPGCFQDLSTLQSLREKTLSHIHLLLSHLQNAHHIHATYRLLA
                     RSAVACPVSNPSPFYHGWGCIRLAPCASQEHGRAGAKVRRASLVHSGRPLSFSPERKM
                     SDSAVIDSDDEDSSPHMSPRTSEIKLREGFWSGSASGSEDEDEEEVADVIVAREIEKR
                     GGKEGMAFLMTLFGQPAIILT"
     gene            1381536..1385440
                     /locus_tag="CNE04950"
                     /db_xref="GeneID:3257763"
     mRNA            join(1381536..1381731,1381772..1382455,1382543..1382653,
                     1382769..1383141,1383206..1383231,1383301..1383810,
                     1383866..1384276,1384350..1384372,1384446..1385440)
                     /locus_tag="CNE04950"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657298.1"
                     /db_xref="GeneID:3257763"
     CDS             join(1381882..1382455,1382543..1382653,1382769..1383094)
                     /locus_tag="CNE04950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512922.1"
                     /db_xref="GeneID:3257763"
                     /translation="MQLGNDKMRIPHRRSAPWRSSHAPPWDKKRQVLGEEELLGNATT
                     TTIDGEEANIVQSTETPGEVGGSLANTIVASATSTKEESESLSSSMINGVTSRVITAD
                     SEATNPVNTAETALHSSASSGRSGSSVTATTSSISSSKGGSIMANPSDTGNEKSNRSA
                     SSLASAAMSSRSGTVTSAVPVISLASVLHPIQVNTFPSDFPVEAQTSALVASAGRGYV
                     FLPNDALADSMLLFITFFFSFLILTILAIKFDKCLNRRRGGGKEDQVIGEEMRWAEGK
                     EVLDSQIIWQGRRGGRDEVGYVGGKRERRGREEWIGGRRVETGPAFRGREMRGSGLKI
                     QV"
     gene            complement(1383053..1385475)
                     /locus_tag="CNE04960"
                     /db_xref="GeneID:3257752"
     mRNA            complement(join(1383053..1383848,1383918..1384109,
                     1384188..1384263,1384341..1384428,1384507..1385475))
                     /locus_tag="CNE04960"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_024657299.1"
                     /db_xref="GeneID:3257752"
     CDS             complement(join(1383387..1383848,1383918..1384109,
                     1384188..1384263,1384341..1384428,1384507..1385362))
                     /locus_tag="CNE04960"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_024512923.1"
                     /db_xref="GeneID:3257752"
                     /translation="MSARSPRSPKMPLTQAPVPLSPVTLSPKRGKLTSFTSSPASPTA
                     ITRRPSPDNNASVRLQMFSSSVDDWLTAKLPPGLIYFISQNVGLVFVAISELFFVLMG
                     LTVKYFLSATQISTTTLIFVRMGITAICCVLSLWLIKRDPNPLLGPPGIRGILILRGF
                     FGFMGLLSSYQSLRGLTLSDSVTIQFLAPSVTALLGFLFLHETLSQREILAGFFCLVG
                     VVLVSRPPFIFGGEGKREDITLPGEGGGTRLDLPLPPGEGDQEGNDTTERAIAVTWAF
                     VAVFFASMAYTTIRWIGNKAHALHSITYFSYTCTITCGLWLLFKPGHIVWVSSLHELL
                     FIVTIGIFGFAAQTFLTLGLQREKAGRAGLAIYLQVVFSLLFEFVLWGTIPSFLSALG
                     TVIILASAIWATISSTPNRPLAKPTDPEAVPFSRTPSPIPPPVAGLGRRSRHSSFRAG
                     EHYNYDSIPTSDAEEEGEGDTRKREKGPSRKGSIFSSKKDSALGLSIGGDSNLGIPQS
                     RLGPSLGKRRESQLSISSASGNKGVREPKNGVIGGSRRNSRFRAKSDTE"
     gene            1385644..1388384
                     /locus_tag="CNE04970"
                     /db_xref="GeneID:3257832"
     mRNA            join(1385644..1386630,1386681..1387014,1387086..1387369,
                     1387481..1387674,1387787..1387895,1387975..1388384)
                     /locus_tag="CNE04970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571020.2"
                     /db_xref="GeneID:3257832"
     CDS             join(1385724..1386630,1386681..1387014,1387086..1387369,
                     1387481..1387674,1387787..1387895,1387975..1387994)
                     /locus_tag="CNE04970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571020.1"
                     /db_xref="GeneID:3257832"
                     /translation="MSFDPGPSSNYYRNFASSADGPLQPPSPPRSPILGATLPPQQVE
                     RDLYALLNISKDASEATIRDRYRSLATTFHPDRQRSDRTREAAHAQFTEIQRAYEILT
                     DPRKRAVYDMFGEEGLKTNWEIGPRVKTPEEMRKWFTAQAHEKRAMEAEALVKPKSDL
                     EVVLDARAVFLSKKVFPDPNAVKHDPISRVLRIRPGRTVLKHSFEMPLSPNTQFIVEG
                     QALSRNGRGGANVLGTVKHQFSPKFWVETGVTLMHPRIGKVKATYTVDEDQYVTASVV
                     QSTLTAPPQLGFTYGRRLYADTTGFMLYEPGSFSVGPWGRNRPESQLNPSSLSIGLTN
                     AKRNGAGWTVQTTAGLANSQITADWSTPIPGGLKMKFGADIGLDQSIAGFITAEGKVT
                     DNVKAGLILQMEIGGGIILKVKINRLGQKISIPILLAERLDPVILLGSTLIPAAVYAG
                     IYKLYLLPRKKRALKDRVKELREENKEFIRQKRQEARDAVDVMERSVEVKLAQERDRN
                     GLIVISAHYGLASSFTERGIIVSEKIDQEGEGEIIDVTIPVQALVQDGRLYIPGGKGK
                     HNIIGFYDPCIGENKKLRVRYLFRGKMHEVTVDDTSPLRAPVRTHVLEV"
     gene            complement(1388347..1389413)
                     /locus_tag="CNE04980"
                     /db_xref="GeneID:3257499"
     mRNA            complement(join(1388347..1388641,1388706..1389148,
                     1389213..1389285,1389335..1389413))
                     /locus_tag="CNE04980"
                     /product="NTL02AT1906 50S ribosomal protein L22, putative"
                     /transcript_id="XM_571022.2"
                     /db_xref="GeneID:3257499"
     CDS             complement(join(1388403..1388641,1388706..1389148,
                     1389213..1389285,1389335..1389365))
                     /locus_tag="CNE04980"
                     /codon_start=1
                     /product="NTL02AT1906 50S ribosomal protein L22, putative"
                     /protein_id="XP_571022.1"
                     /db_xref="GeneID:3257499"
                     /translation="MARPFRSLFSVAGTSLPGPSRPLPLRRAPLGQVRTAFNLSGFGR
                     YLPTLPTWKSDSAEDQSASVIDEPSSSSPPGETTSDSLFAPSPSAFPGDTQPKLSKKM
                     KKRGLPNNTWTEHRYASAAHKISHRKLGLLSHQIAGLPVDEAIVQMQFSEKRASKWVK
                     STLALARDHAVDKSLKRDKLVVAEAWVTKGRKEARIDIKGRGKYGIKHHPSARIHLVI
                     REGLTPSEKEEKQFKRDLGRVKSAGAVREDTPLRRKVVSGWTW"
     STS             1388938..1389693
                     /standard_name="Bam14"
                     /db_xref="UniSTS:470918"
     gene            1389567..1392061
                     /locus_tag="CNE04990"
                     /db_xref="GeneID:3257859"
     mRNA            join(1389567..1389721,1389910..1389971,1390287..1390348,
                     1390416..1390463,1390578..1390645,1390744..1390812,
                     1390878..1391075,1391181..1391205,1391280..1391551,
                     1391604..1392061)
                     /locus_tag="CNE04990"
                     /product="triose phosphate/3-phosphoglycerate/phosphate
                     translocator, putative"
                     /transcript_id="XM_571024.2"
                     /db_xref="GeneID:3257859"
     CDS             join(1389680..1389721,1389910..1389971,1390287..1390348,
                     1390416..1390463,1390578..1390645,1390744..1390812,
                     1390878..1391075,1391181..1391205,1391280..1391551,
                     1391604..1391792)
                     /locus_tag="CNE04990"
                     /codon_start=1
                     /product="triose phosphate/3-phosphoglycerate/phosphate
                     translocator, putative"
                     /protein_id="XP_571024.1"
                     /db_xref="GeneID:3257859"
                     /translation="MSQNKDIEASIPLSAMPRASDVEHDLTHGEHVEVNISDDGPPPN
                     QQKKIVIPAIIIIPIWMACSISVILYNKYVFSGLNFEYPTFLTTWHLIFSTIATRVLQ
                     RTTTLVDGAKDIEMTRQQWMRTILPIGALFSGSLILSNYAYLTLSVSFIQMLKAFNPV
                     AILLISFAFKIQEPSGRLIVIVLLISCGCFLAAYGEVQFELFGFLCQCAALAFEASRL
                     VMIQILLHGMKMDPLVSLHYYAPVCAVINACIIPFTDGMAPIWNLHKVGILVLFTNAG
                     IAFALNVAAVFLISVGSGLILTLAGVLKDILLISGSVLAFGSPITGMQVFGYSISLSG
                     LILFKTTGGK"
     gene            complement(1392127..1393272)
                     /locus_tag="CNE05000"
                     /db_xref="GeneID:3257746"
     mRNA            complement(join(1392127..1392522,1392588..1392747,
                     1392823..1393132,1393190..1393272))
                     /locus_tag="CNE05000"
                     /product="triose-phosphate isomerase, putative"
                     /transcript_id="XM_571026.2"
                     /db_xref="GeneID:3257746"
     CDS             complement(join(1392260..1392522,1392588..1392747,
                     1392823..1393132,1393190..1393212))
                     /locus_tag="CNE05000"
                     /codon_start=1
                     /product="triose-phosphate isomerase, putative"
                     /protein_id="XP_571026.1"
                     /db_xref="GeneID:3257746"
                     /translation="MARKFFVGGNFKMNGSLESVEKIVRSINDANLDGTNEVVIAPPA
                     LYLLKVQSELNAPTQVSAQNAFTESSGAFTGEIAPQQLKDANVHWVILGHSERRSLFG
                     DTDKLVADKTKAAINAGLSVIACIGESLEERESDKTMTVVERQLEAIAAAIDVDAWKR
                     IVIAYEPVWAIGTGKVATVSQAQEVHAAIRSWLSRRASPEIADSTRIIYGGSVNGKNC
                     GKLSAAKDIDGFLVGGASLKPEFIDICKSGKKA"
     gene            1393476..>1394698
                     /locus_tag="CNE05010"
                     /db_xref="GeneID:3257518"
     mRNA            join(1393476..1393568,1393638..1393646,1393754..1393826,
                     1393875..1393968,1394038..>1394698)
                     /locus_tag="CNE05010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657300.1"
                     /db_xref="GeneID:3257518"
     CDS             join(1393530..1393568,1393638..1393646,1393754..1393826,
                     1393875..1393968,1394038..1394698)
                     /locus_tag="CNE05010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512926.1"
                     /db_xref="GeneID:3257518"
                     /translation="MPPAKSNKFKTSRFPAARIKRIMQLDEEVGKLASATPVMISKSL
                     ECFIQVLLDESCKTVREAGARKLTAGHLKLMINTNPSFDFLRELTESIADLPSAAAPG
                     AGPSTSKARKASTSAAAAAAAAAASGEGDEDNLPGMGTAARRAPRGAGKGKQPVTGIA
                     GKGLDVETWAKGEQERLGEGGIAPGWGGGGAPIAGTGEGWTAMPWSGSGSSSYPPAQA
                     HALSQSALPTLQPPQQQPQQPQAQPQPEPEEIQQQQQSVTMIGSWKQDMTGGGGTGEG
                     GRGMFDDYEEDEDDY"
     gene            complement(1394809..1395540)
                     /locus_tag="CNE05020"
                     /db_xref="GeneID:3257903"
     mRNA            complement(join(1394809..1395053,1395111..1395322,
                     1395370..1395540))
                     /locus_tag="CNE05020"
                     /product="hypothetical protein"
                     /transcript_id="XM_571030.2"
                     /db_xref="GeneID:3257903"
     CDS             complement(join(1394914..1395053,1395111..1395322,
                     1395370..1395494))
                     /locus_tag="CNE05020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571030.1"
                     /db_xref="GeneID:3257903"
                     /translation="MPAPVSKTFAALRSAAARLPLSPSVKSITLSFVAKNSGAGPRQF
                     LRHHAPALAYANPLLPIAIRRIPDPRSKHKDPSSPDREAVKLGRWGGVADGLQLGKGN
                     VPGGEMVVEFHNAPAQTLPLAHLSGQQILDQLLAIALEKKVPRVAGSEVDKEALRS"
     gene            complement(1396895..1402424)
                     /locus_tag="CNE05030"
                     /db_xref="GeneID:3257617"
     mRNA            complement(join(1396895..1397469,1397531..1397646,
                     1397733..1397889,1397953..1398178,1398245..1398374,
                     1398452..1398930,1398989..1401561,1401619..1402039,
                     1402099..1402424))
                     /locus_tag="CNE05030"
                     /product="hypothetical protein"
                     /transcript_id="XM_571032.2"
                     /db_xref="GeneID:3257617"
     CDS             complement(join(1396964..1397469,1397531..1397646,
                     1397733..1397889,1397953..1398178,1398245..1398374,
                     1398452..1398930,1398989..1401561,1401619..1402039,
                     1402099..1402368))
                     /locus_tag="CNE05030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571032.1"
                     /db_xref="GeneID:3257617"
                     /translation="MSAEPALASASKLAARAARFSNTLPGNRYKELEEARAKEVQQYH
                     AQQRLVRDGKVELEDAVEMKGTCEKMCSDYEREFREWTREVHPFEATPDKRMDPAKAV
                     AAYSRSDAGAGHGTAAILPSDLRTPQTLIRTLDYLFTSIMTLLPSSSSDLPPNSELAQ
                     RKALGYSAGFIRDRTRAIRKEFAMQSSWGHEEAIESFERIARWHILCLRELQEEEGTN
                     NDMHIDSAELGRCFTSLRQHYNDRREESGLDMPCSHEPEFRAYMLVYDLTSKSISIPT
                     SELPSSILSHPLVKIAWEIRRSAQRNFDSQKEGSKHNAELGMNNIRRFIKLLSSPKVP
                     YLLACLVEIRLREMRRSALRAMTRAYPRLKTEPIRVNEKGEIVERRMVLIETLNKILG
                     CLTPDSTPSAWDDVPLQSSAEFNADSESEAICRRFNIPLFPPDNESGGKRGALINLGT
                     PFDDNKDAPYTRRWALVSAKRGGKAFVEVVNSGSPLTSEDTLSIAAPFKTTAKAPASV
                     LAFGGPGASSAFDFKKPPSSTTTPSSARPIEGQTSMSAFSFGSGAGTGSVFGSISTPA
                     TTPNKPSSGAFNFGFSKPSFASASGSASIAPSAPAGAPGVTPAPAGTSLPSSMKATST
                     SGTPPLFSLPPSQPMKEKEKEKEVDANAKGIPDFFSSAAAPTAAPAPASVPTAGLSTS
                     TPAPLFVPPAATGDSKAGIDVTNAKSKERGQKDKPSFSFVFGSTPTSTSSEPASAPIP
                     LTSPLAIDEKSRKRAAGQEGKKEQGGGKPELFTFSVDRAASSGSGIREGVEDKPLFSF
                     TATPGPSALGASTSAATSANAAPPLGAHLNTSASTVSPLTPVSASVAGPASTTTPHTP
                     HTVARSRPHRDPSLLLSTSTPTSQLNLLSPSLSKSSPRISLDVYHAERLKRRQAIPSV
                     CEELVVQVMEGILRDCLTPDLEVFVRQQLAERTYAARKAYRSETIRFWSEVLFRDHFL
                     LGSTPGNGGGNRDGLVREIAKEAMLDEIRRRWRAREAGKWWKLWAKEKRERREGGERK
                     RREWLGGLKEMGLGASMGSSTTVLGAKANGVGDVSMDVEVDSMDAGLDSLRLDIEIIQ
                     AERDKDNFFAPSTFLTSIARYVAPQLSAAFTSATISLSDSASSSGPESTALSPHQGHP
                     AFITLLSTPSRGSSADKAVEGWLVSKFAPPNSSSQLDQVHDGDGETTPDGEKERGYMC
                     GGVEFDLRVVNNGMMPKHSKDDGWIGLLVFEAPLKTTDAKKASENVANAQDRMGLLVK
                     TLQDDGNRFAPGLIVLSWEDESMDNLAERLHIQSEIASFSNKSFVSLGVADDLDQQFA
                     KALEGLGEVEVKEQGIVRLQDVAERVLFHWKQFVDVIGLLLSQQRTDAYLGWTCLKSG
                     IELINSVPRLAREFTGARGLDNGNVLDAIALPEITFDAPLSNDKLVDQMAEYFENEIF
                     VGIDELSLLIVRLSQAAQYGNALPIDAILQFLSFFVLGEFQHRHLFARTFFATETEMG
                     RWQRDHLRQVISKFGELVEKKIQLVTSLAEPPPSSRALVELPPIKTSSPTTISKVTDG
                     TSSPIITPTGKKRPRGEKDERAMLDREKKGKKESKAAKAERLLRLMQKVEKTLDERDN
                     IYLERRGNAEDVLLL"
     gene            complement(1405495..1409350)
                     /locus_tag="CNE05040"
                     /db_xref="GeneID:3257605"
     mRNA            complement(join(1405495..1406582,1406638..1407197,
                     1407250..1408056,1408115..1408204,1408260..1408386,
                     1408440..1408761,1409111..1409350))
                     /locus_tag="CNE05040"
                     /product="glyoxal oxidase precursor, putative"
                     /transcript_id="XM_571033.2"
                     /db_xref="GeneID:3257605"
     CDS             complement(join(1406319..1406582,1406638..1407197,
                     1407250..1408056,1408115..1408204,1408260..1408386,
                     1408440..1408622))
                     /locus_tag="CNE05040"
                     /codon_start=1
                     /product="glyoxal oxidase precursor, putative"
                     /protein_id="XP_571033.1"
                     /db_xref="GeneID:3257605"
                     /translation="MASLNMVTLLTLLPFLSLVVASPSPQDGATPGYTANKRGSSNAP
                     TPLSFESVGDTGVSAQQMFLGNDKKVYVIDKAENNPITINGAYGTHPAWATEYDIETN
                     EYRTLDVYSNTFCAGGNVLGNGTWVIFGGNQPVTTGGVASTDAAAYSDTDGGSAIRMI
                     NPCTDETCEYIQGETSYDKSQGTGGWLQMTGKRWYPTVETLEDGSLIVIGGDKNGGYV
                     NTAAQDNPTYEFFPPRDGDPVNLQFLTDTLPVNLYPLVWLLPSGKLFMQAYRKTILYD
                     YTTKVTTDLPDMPYATRVYPASAATVMLPLTPANNYTVTLLFCGGSNTTQWGDDGSAG
                     YNVTAVPADGTCVRISPDTNNPQYEDDDYMFEGRSMGQFVILPDGTFWMGNGVAMGTA
                     GYGNEQYSVGQSYGQDPLYMPALYNYSAPKGSRWNRTGLSASANERMYHSTAILLPDS
                     SVLIAGSNPNADFTNDQWRSRTDSEKWYPWYYNEKRPTYSGMPTNLYYGGDSFNLTMS
                     GTDEDTAKDTKVVLIRGGFNTHAMGFGQKMLELESSYTIDMNTGNTTIHVSQLPGNPG
                     PTLFQPGPAMFFVVVKGVPSIGEFIMVGNGQLGDQNTTNNAVLPASTIVTIATTSASA
                     SATDSSSTATSVDSASSSSSSSSESGAAPALLSGMGMGSAIVVVLSALAVLA"
     gene            1414639..1417534
                     /locus_tag="CNE05050"
                     /db_xref="GeneID:3257888"
     mRNA            join(1414639..1414873,1414949..1415036,1415103..1415192,
                     1415264..1415348,1415420..1415514,1415601..1417534)
                     /locus_tag="CNE05050"
                     /product="hypothetical protein"
                     /transcript_id="XM_571034.2"
                     /db_xref="GeneID:3257888"
     CDS             join(1414740..1414873,1414949..1415036,1415103..1415192,
                     1415264..1415348,1415420..1415514,1415601..1416503)
                     /locus_tag="CNE05050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571034.1"
                     /db_xref="GeneID:3257888"
                     /translation="MAPATSLSVDDKTKVKKAIPTSSSTNKIITATVARIYQAKPGAN
                     SWSYSGVEGALVFCVDKAKGGLWFRVVTLSSGRGVIWEHELPIEIEYNQEKPFFHTWQ
                     GDEMQFAFVFASEHEAHDFYKKVANRSKYAMKAKEKKEKKEEKSAPTKKRKGKIDKSM
                     ISGPSVDSFRHVAHMGFDSEKGFSSTGVDPSWQKLLEQLTQKGFSEKDIKKNEKFIKD
                     FVDQSGGIEKATAPPPAEAPKKPSRPPAPPTSRRKPAPPPPASRSARPSSVAQPSAPS
                     VPPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARP
                     PGGAPPPPPPPPTSAPSAPPLPTASGGRSALLASIQGRGVHSLKKVDPSEQKVSALAG
                     GDTAGTGTGTGTGAAAVGAGAGAVAGGGAAAAVAATTEDTPDLASSLAAALSKRKADI
                     GSDEEDEDSDDEWD"
     gene            complement(1416850..1420141)
                     /locus_tag="CNE05060"
                     /db_xref="GeneID:3257509"
     mRNA            complement(join(1416850..1417558,1417637..1417799,
                     1417873..1419049,1419116..1419369,1419555..1420141))
                     /locus_tag="CNE05060"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657301.1"
                     /db_xref="GeneID:3257509"
     CDS             complement(join(1417326..1417558,1417637..1417799,
                     1417873..1419049,1419116..1419369,1419555..1419596))
                     /locus_tag="CNE05060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512928.1"
                     /db_xref="GeneID:3257509"
                     /translation="MAQSADSACGPSNMRPTPPPLAVPSSVQHASSATNSLSASQASQ
                     ATSVLTDDEEDLEDYRPGGYHPVNIGDEFNNGRYRIVRKLGWGHFSTVWLARDNVANR
                     HVALKVVKSDGHYTETALDEIQLLQRVVSSAPGHAGRHHVLDLLDSFRHTGPNGSHVC
                     MVFEVLGENLLGLIKRYQHRGVPQHIVKQIAKQVLLGLDYLHRECRIIHTDLKPENVL
                     ICIDDVESVVQAELASCPAAVPTKLVGVPPSQGRLGNQTPRKDGIFIVGSQPLPSPSS
                     SYSSSPMLDKYGFGMSKISGASAAKAGNQPSGVGGPSYPPTQPKKSATTEAIGTDLEN
                     VKLGEGSSLKWEKTATPAPAPPKGPSLLSQQLHHPPASPPLNPSVPSGSASVSTNHTI
                     NTATDETEVSTPATTPDHVTRLSDERAPEAGDPTTLPPPFPYDPVSLERITVKIADLG
                     NACWVDHHFTNDIQTRQYRCPEIILGTRWDESVDMWSAACLFFELLTGDYLFDPQPGV
                     KYDKDDDHIAQIMELLGEMPRSLALSGKYSHEIFNRRGELRHINRLRFWPLTSVLKEK
                     YLMEHEDAELLSSFLMPMLAYLPGQRAKASDLLNHPWLEGVVVQGELEMAQSLHKS"
     gene            complement(1421207..1427068)
                     /locus_tag="CNE05070"
                     /db_xref="GeneID:3257725"
     mRNA            complement(join(1421207..1421923,1422028..1423187,
                     1423267..1425488,1425576..1425848,1425910..1426235,
                     1426330..1426473,1426532..1427068))
                     /locus_tag="CNE05070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657302.1"
                     /db_xref="GeneID:3257725"
     CDS             complement(join(1421885..1421923,1422028..1423187,
                     1423267..1425488,1425576..1425848,1425910..1425965))
                     /locus_tag="CNE05070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024512970.1"
                     /db_xref="GeneID:3257725"
                     /translation="MSYLADSYIFPWHFLLPTKRRISRRLSILSSYYSIIFSDTSHCR
                     YTHMNTSHNCEPETDIVQPHHAVTLPFKPDPLYPILCIFVVCCFFLFPPFLSLFVCLL
                     SQPKKVPLKAITPLFTVDQLPKVISPSPAMRSPFHSIFFSHKSSRPPSPSPQHQRQHP
                     AHLGCPSTSSSPPLVPPQFPFELPLSVNSNMGQVNGRIELETEGQNHGSKNSGEEGGG
                     GRASDNTSKPAMITPTSTCAYHQGPHTQPPLPEFYCPPHSAPVITSNFHNTPLQAISA
                     TSTNKSIGLIRSFSQSQRSRSRQHRRADTVSTPTAITAGITFVPSSSGENDMKVCRVD
                     KPNKVGRAEKDERVERVERINDKQELKAFEAMVIEAETEVGIHIRQNNQDHDGQGVGP
                     LEGSTWSKGFRLGMGKGKGTESTTMIGYKRSLATAPHATASRSPPSTSTIRQTIPYPI
                     SSSITPLHLCPSSSSPTSPGFSPDSHSSTHSYSLGKRAGTKSARSGSVKSARRAEREW
                     RAKVAALSTRVGAGGVGGNGARGGGEGSPCALKYRALSDNISGHQHQQHYDRERERGK
                     SPNNWRRGPVPPRRSTTPAPVPLSSLGGRMVPTLPVSYPNWTPSPDHRSLPFKSVTQQ
                     LKPQTQTSSIIHTPTWAPLRDSVSISSPNAHSGTSKPFPFTTSANSTNLALHANTDSN
                     STANLIIAKSKLGRKSFETLGHYTPFAPSSPPSSSPSPSAADLPAQAQDTGNDDDNCL
                     GNGEGDENGFENINDSGHDVQISVSRSVSIFSMPSTNGQELDAKERERGRQVSVAAST
                     LLALDGAGRKVIEDQELKNEMAEQKEMVKPKVVDGDENENENEDEKKDDDDIREKKLV
                     NDSEEEEGKKNTASQLLSAEVTGSPASPPSALTLTEPAKPSIPTTPIRVTHTTSAALM
                     PATPILSTSTTSSSPPTPYSPVTSYILSASLDQLGWSRAIIPGSGLGFGGGLADGLGL
                     EEKLRSKEGVASLLRVDPNVEPNNMKRTGSFKAIKGVEVRGKEKEKEKEPKTPIRPRH
                     PFTLGKQDSPAPPTPPSKSPLPGEKIKIGGDQKHDGNAKESALSNTIVRQLPSRPVPA
                     PPSANSISTPTFVSNSLPTSTVPFTFSFSKETTVTASISPRANVASSFQPNNNTKNRP
                     SSAASRRTLTALQPCRNLPSHSARSPPKHFNKDGGFSRANSSVTSIKTDAVGTRDKFP
                     LMKRYARGGRGGVDLTPGMESGVRPPKSGLPRSDLERWLASTSIN"
     gene            1426074..1431018
                     /locus_tag="CNE05080"
                     /db_xref="GeneID:3257653"
     mRNA            join(1426074..1426436,1426494..1427065,1427272..1427324,
                     1427396..1428213,1428295..1428424,1428502..1428531,
                     1428594..1428696,1428758..1428805,1428875..1429285,
                     1429372..1429653,1429757..1429923,1430005..1430014,
                     1430104..1430271,1430373..1430417,1430504..1430573,
                     1430677..1431018)
                     /locus_tag="CNE05080"
                     /product="expressed protein"
                     /transcript_id="XM_024657303.1"
                     /db_xref="GeneID:3257653"
     CDS             join(1427746..1428213,1428295..1428424,1428502..1428531,
                     1428594..1428696,1428758..1428805,1428875..1429285,
                     1429372..1429653,1429757..1429923,1430005..1430014,
                     1430104..1430271,1430373..1430417,1430504..1430573,
                     1430677..1430805)
                     /locus_tag="CNE05080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512929.1"
                     /db_xref="GeneID:3257653"
                     /translation="MPGDINSPSPPSTPLSPTAYKIALNRISPGERLIYYLYLPFLFL
                     TLFLLAVLATLPYLFFKRARPRLLPDSKPDPKHPQSKYEWYGPEKDYPPGLALAPLGQ
                     GPGVKWRIWEMYGYFREFWHMTTRQGLQVGGVGSGVVMLIFQVEMMWHDYSAGNITGY
                     QDSSSGGEGNSSNELREDSTCAYATGTGIANWGSRLEPLAWYGCYHGFICIICICLIG
                     DELLNVRFGCFAPQWYRSGIGYTIMFLAAATLSTSPNWGVTSLIQLRYVIITVIFLFG
                     TYNLFRTFACALGMATSGFRHTDYRVGRKPLRPWTESEWIDPYYRQNFIPHKYDRYFI
                     TERWQFAVGDWSFPLERRPREDVERQMDELDGLNPFMMDGRIQKVWQRSPEEIRRMHG
                     KIGRTVIHGGPKKMPPHMTNDLKQRERIHIGIIDPRNPPTEEEEEEMVKALNEDKGYF
                     GIANWKPRTKSFGWWWFDMRRVWAIVCGLALMGVRIGLCVFDLDYSNLASYRNQYDQA
                     KIAWQATDNGGPDASKCQYYQGSSVPIFVITGEDSYSGVTANMIWLGVWHTFLIGMCA
                     AVIFVSMSNNMWWGMHWPFPPMTLIGPRMSSMSIGITLGFVAFATLQQGFFFSNDSVI
                     LVTRIICYASVIGFILFLYPNEPLRTSYTRDPFWPWLSRVAFRFMDRKKWHYSMKDFD
                     DAQG"
     gene            complement(1430627..1433024)
                     /locus_tag="CNE05090"
                     /db_xref="GeneID:3257592"
     mRNA            complement(join(1430627..1431019,1431092..1431543,
                     1431607..1432445,1432494..1432584,1432636..1432887,
                     1432934..1433024))
                     /locus_tag="CNE05090"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657304.1"
                     /db_xref="GeneID:3257592"
     CDS             complement(join(1431010..1431019,1431092..1431543,
                     1431607..1432445,1432494..1432584,1432636..1432887,
                     1432934..1433008))
                     /locus_tag="CNE05090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512930.1"
                     /db_xref="GeneID:3257592"
                     /translation="MQDRGKEAVRLCEQIVAHAFGDIVSRVASTLLNRGRLPAPTIAR
                     LSGLTPPVALSALLILMQHNLVQSNGASAKETGEDEQYEFIVEECLLRLRWGRMLAIT
                     HERVDFLAMQVVKQLMIFGKLRVPDIISGLGGDADAIRAEAITGSIIALLQNHFLQTT
                     APELQILESDQIARRFAANKRRLAQAQGSALLSANDITNCRLEAAHDVRTANESLRAI
                     TRVLITKPKVDKNTKRRKGGKAIEESDYVLKQDVHLRVNYDRYGVLMRNDLIVKAAED
                     RWNKGAGIVMRAVLDASLRDTSLLKDDRTHDPVGINSIISLIPPSSAPILLAGLGLSS
                     KSSIPDLVRTYLSILAGEDQLTGTGAGVFLQREGSTNPGYKVEFEAICVKMREAMLSD
                     LVREKLGDKAARVLAVVTRSSKAFETTIRDCAMLPLKDARYILAELQKLSLVETQEVP
                     KTAAKSRANMPSSSSAEYHLWAVDLSRCYSVLLSSVYKTMGNILQRRRAEMDKKKVVL
                     AREQRVLGLGHGQEGGRGLLQLKDQEDLAELDDTRNKLALAEMRSEMVVFVLRDLPGL
                     PGQNAM"
     gene            1433152..1436282
                     /locus_tag="CNE05100"
                     /db_xref="GeneID:3257878"
     mRNA            join(1433152..1433260,1433304..1433507,1433563..1434005,
                     1434065..1436282)
                     /locus_tag="CNE05100"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657305.1"
                     /db_xref="GeneID:3257878"
     CDS             join(1433228..1433260,1433304..1433507,1433563..1434005,
                     1434065..1436039)
                     /locus_tag="CNE05100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512931.1"
                     /db_xref="GeneID:3257878"
                     /translation="MPAITSDSKIPVLTIRHFTDELDSLAYALEPEEREDTWEKFEKA
                     IIRFIAVTKGGGYQFTESYVEGVGRGGVGSKIVRCMLSDRGRLSGVAIELLQTFAPQL
                     GLHFKPLVNLYLEPLVVLLGRPNKVFLKRAEKCLAVIISNCQIPAILTSLRRGLDDNA
                     ASCRKGCSMGVERALKEWPIELWTEKWLVILEESLKKMATNKDPDVRKAGKNVWALFM
                     DAWPERVDEFSAPLTPTIKRYLDISGAGGPSKPKSTRPAPARKALPPLTSSTTSYCNK
                     PLHSSRPRAAHISSSAAVTEAGLSGRRSPHKEPTFNHEPSCASKAYHEYSQRERSRAL
                     ETASLAFSHADAPSRVFPHDNLPSSSNPSSFFSPPVRLEHHTQQAKPKPLSKPVRPVM
                     PTSFSVPALHTNPYSYVSSGKSGRTEEPVRPRRLGQAQRIKVTHPMDGEEGDQEREQR
                     EHGRELGREGPLRGAVRPGTAGMGGLGKKAGLGRAERRVVTAPLPTATGAVTNGTLEG
                     GAVRLRKREHDIAATGQEQADYGSTTRVHLPSQQETVLEIEPGLHHHQPEPQQQQQGL
                     FSPVAVHILKKNADSPLLPVLMGSRSRSYSTSSTPSLENQFAPTTSTPSIAHPSIPAS
                     ELVSPLKQKNVSEAEAQDEKKKDQEEEMEPVKVSLNEVYPLSPPSTKPSSEQKEELEL
                     AKRLELPASPKRGDGDDGQEKRREDKDSPERKGKGRQQAVVPISTLTTASIPAPALTT
                     TSAPVPPPSSTSATTVPPSRKPPVPTAASSRPLKPRSRVISGSSVSTKPTNKTFTKPI
                     VRKAFRPTSSTSSTSATATGAASAGGSGKNHLTAATIASRAKAAAATSSKPVVVTSST
                     SANASSAGVGGAAASSTGEKCKDTEERG"
     gene            complement(1436576..1438380)
                     /locus_tag="CNE05110"
                     /db_xref="GeneID:3257588"
     mRNA            complement(join(1436576..1436949,1437018..1437180,
                     1437259..1437402,1437503..1437632,1437701..1437779,
                     1437838..1437893,1437960..1438199,1438270..1438380))
                     /locus_tag="CNE05110"
                     /product="expressed protein"
                     /transcript_id="XM_024657306.1"
                     /db_xref="GeneID:3257588"
     CDS             complement(join(1436642..1436949,1437018..1437180,
                     1437259..1437402,1437503..1437632,1437701..1437779,
                     1437838..1437893,1437960..1438102))
                     /locus_tag="CNE05110"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512932.1"
                     /db_xref="GeneID:3257588"
                     /translation="MSSLAEQLQKAEKDLAAARERGLSSASKYEEKVKKLKEELAKPQ
                     PHPALQFNEVAQCISVMSAISLVMAASPLPIQLIPFYRIFSTLTMFAVTCYVARASVI
                     YYGYQQALAKFPKQDESSSAKANKAAKKPRQDLWANMKAHPSAFLTTRQAAPRIFPFP
                     LGKTRPEAAVREELWWEGGNAPHVGHFNRPKLPVPPNPNEDVLMKRVQASMAREAQER
                     LWKRRIRDIQVLSVIIMVSFVSKKIAAIALAILIYRTVSSEIDDMLSPPVDMEHVWKA
                     IDKLTGAAKNESAPKPTLLTGSTSYLYEHDGDWVKKLADVPIEGVTPPVLMTTANSWY
                     AGPGPE"
     gene            complement(1438748..1440393)
                     /locus_tag="CNE05120"
                     /db_xref="GeneID:3257619"
     mRNA            complement(join(1438748..1439253,1439319..1439424,
                     1439485..1439667,1439755..1440011,1440105..1440393))
                     /locus_tag="CNE05120"
                     /product="RNA polymerase II subunit 3, putative"
                     /transcript_id="XM_571040.2"
                     /db_xref="GeneID:3257619"
     CDS             complement(join(1438856..1439253,1439319..1439424,
                     1439485..1439667,1439755..1440011,1440105..1440294))
                     /locus_tag="CNE05120"
                     /codon_start=1
                     /product="RNA polymerase II subunit 3, putative"
                     /protein_id="XP_571040.1"
                     /db_xref="GeneID:3257619"
                     /translation="MNGYYDPQQHQSTNIEIPQGPTNQPRLLLRNLNETDATFHLSGV
                     ELAYANSLRRVMMADVPTIAIDQVLFMQNTTPLADEMIAHRLGLIPLISRNVSKGLRY
                     TRDCDCDEGCYYCMVTLRLKVTFSGNDGEQFMRVTSDMLEVVPSPGGPPPPNPYGPPP
                     ELSEEDRIIINNRDPEMGQPIGKGNPTVPPILIAKMGKGQEIDVLCKAYKGIAKHHAK
                     WSPLSTVAFEYDPYNKLRHTTHWFETDERAEWPLSSNAAFEPPPNPAEPFDYNAVPST
                     FYFSAESVGSIPVRSVVEQGLDLLIEGLANVVLGVQKEIGGEEEEGEDGAAADGVVGD
                     GMGVGMGGGLVEPNIPAGIGQDQMAMAGGYGGYGSQQGYGGSW"
     gene            complement(<1440603..1441665)
                     /locus_tag="CNE05130"
                     /db_xref="GeneID:3257675"
     mRNA            complement(join(<1440603..1440673,1440749..1440877,
                     1440953..1441056,1441151..1441238,1441393..1441462,
                     1441557..1441665))
                     /locus_tag="CNE05130"
                     /product="hypothetical protein"
                     /transcript_id="XM_571041.2"
                     /db_xref="GeneID:3257675"
     CDS             complement(join(1440603..1440673,1440749..1440877,
                     1440953..1441056,1441151..1441238,1441393..1441462,
                     1441557..1441577))
                     /locus_tag="CNE05130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571041.1"
                     /db_xref="GeneID:3257675"
                     /translation="MDIRQATIDDLLGMQNANLLNLPENYTFKYYLYHALTWPELSYV
                     AVDPKGRIVGYILAKMEEEPSDAPSGHVTSISVLRPYRRLGLANKLMKQSQEAMVAHY
                     DAHHITLHVRKSNRAAISLYRDTLGFEVHGMEKSYYADGEDAYGMRYVFKKPEESLKE
                     "
     gene            1441906..1443649
                     /locus_tag="CNE05140"
                     /db_xref="GeneID:3257530"
     mRNA            join(1441906..1442215,1442275..1442369,1442418..1442632,
                     1442695..1443027,1443077..1443649)
                     /locus_tag="CNE05140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571042.2"
                     /db_xref="GeneID:3257530"
     CDS             join(1441989..1442215,1442275..1442369,1442418..1442632,
                     1442695..1443027,1443077..1443598)
                     /locus_tag="CNE05140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571042.1"
                     /db_xref="GeneID:3257530"
                     /translation="MSAQDVRSILSLPPSTPLPTLSSSKKVPVPRKPDGITRELYALI
                     GDNAPSLADAQASLAAVKYREKPALKGKKVHWEWTKFTPAARRDNPVRLGHWARITDS
                     DPNDSVEYFGKFNLHGPSVMEYSQFEYDQHLVDPNWTLQETEYLFELLKEYDLRFIVA
                     ADRYAYVSPEGEKRKRSVEDMKDRYYTICRRLIRTRTASDPVHQQHLIQAYAFDKARE
                     IKRKQYASDLFHLTPAEIAEEEALYVEITRMQQNERRFRADRDELMRSVMGLDSGLVE
                     VDQSAMENAIGVDKNKKKRKAEDESAAPSPAPTPKKPAPNAGFDNSRCIYHLPTPSNA
                     NSLTSHLSQKHPPHQQAFLRGSRLPLPKPTAAGRITDLLAELGLSANRLVMPTRQNME
                     VFEGLLNAAAALVEMRRQVNRVEQELRVVRMQKEGLMPVTTNPSARVKGEAGVVTGGS
                     EATVKAVTPVKEC"
     gene            complement(1443970..1446102)
                     /locus_tag="CNE05150"
                     /db_xref="GeneID:3257545"
     mRNA            complement(join(1443970..1444624,1444661..1444909,
                     1444947..1445121,1445158..1445306,1445343..1445425,
                     1445473..1445771,1445823..1446102))
                     /locus_tag="CNE05150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571174.1"
                     /db_xref="GeneID:3257545"
     CDS             complement(join(1444035..1444624,1444661..1444909,
                     1444947..1445121,1445158..1445306,1445343..1445425,
                     1445473..1445771,1445823..1446098))
                     /locus_tag="CNE05150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571174.1"
                     /db_xref="GeneID:3257545"
                     /translation="MSNTAVPIMSNPPIRGAGNRFKRGGFHAARAQANPTRSLATTQP
                     GLIVKTTDSTPVPSGISTPAGIDRPRFRDFNGLSPEIFPSLPFETCTEVQAATLPTIL
                     AGDDVLAQAKTGTGKTLAFLVPVVQRLLSAPMPPSALTSILILSPTRELAQQINEVAE
                     RMSTALSKKFGTRSVVGGTNMDRDIKNLKSKRADILVATPGRLLDLMENGGIKARFAQ
                     LKMIVLDEADRLLDAGFRRELVKIFDYLPAPHAVPRQTLLFSATLPTEVHSIASIALR
                     KDYKFITTLTEEDVNAHEHVKQEVLVVSAEDLIPAAMEVMRNEESKNKDFKVIAFLPT
                     ARAAALFHDVFSSLPIPYPVWEIHSRLSQSKRASTTEAFRQAERGVLFSSDVTARGID
                     VKGVTAVVQIGLPSSSEQYVHRLGRTARAGAEGHGILMLGDFESHFLRDKTLQTFTLH
                     PYPTIAPEIMSRSRDAVNKALEFVSPESKAQAYQAWLGYYNSHLKSLRWSQADLVRHA
                     GDYARVSLRNGPQPPGLLAKTVSKMGLRGVPGLNIVKEVQKSAGGQDKPHTGKRGRES
                     DITSENTLRGGGRGGGRGGGRGGRGGRGGGGNGRGRWQPA"
     gene            1446263..1449524
                     /locus_tag="CNE05160"
                     /db_xref="GeneID:3257631"
     mRNA            join(1446263..1446410,1446504..1446610,1446678..1446728,
                     1446788..1446813,1446883..1447123,1447256..1447381,
                     1447483..1447663,1447728..1447802,1447871..1447934,
                     1447999..1448067,1448118..1448192,1448249..1448269,
                     1448332..1448511,1448576..1448728,1448819..1448877,
                     1448939..1449023,1449081..1449096,1449167..1449310,
                     1449378..1449524)
                     /locus_tag="CNE05160"
                     /product="expressed protein"
                     /transcript_id="XM_024657307.1"
                     /db_xref="GeneID:3257631"
     CDS             join(1446356..1446410,1446504..1446610,1446678..1446728,
                     1446788..1446813,1446883..1447123,1447256..1447381,
                     1447483..1447663,1447728..1447802,1447871..1447934,
                     1447999..1448067,1448118..1448192,1448249..1448269,
                     1448332..1448511,1448576..1448728,1448819..1448877,
                     1448939..1449023,1449081..1449096,1449167..1449310,
                     1449378..1449386)
                     /locus_tag="CNE05160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512933.1"
                     /db_xref="GeneID:3257631"
                     /translation="MSVQPIAKPITPTPKKINSCDACRSRKVRCERLFQTEAPRPGPS
                     VGQPSLPPCRQCADLGIECTTTWRPKRRGPPNEYLKKLMASDTDSQSHPVPVPVPMTT
                     IPSLPDSASLSPVLHSPLNRYIPVSPLSARPTSHQPHSLEDIIERNVAMSIFALFFDY
                     VHPLTPCLHRPTFLMEVQTMRDEKEPVFLALVLSVLASAMVQIPKPLLPTINNCPGRE
                     VADRCYQVSRLVSLNTYEPPTIEMVILRFLDSVYHIVSGRLGAHAASWGEALQLGVSL
                     GIHREASYAGLDPISAEVRRRMFGLLFTSDKAAACLRDRPIFLPTEDCDTLMPKAVDD
                     EYITRTEYRTFPVYETSTIAGFNIATRVFGIIGETLLLQRTVRRQSPLAPEDILARLR
                     RVKAISEDLAEVLIDIPAALRLADTPAPLQLRTNTQDWGQDIFAQLDLYFAQPESSRS
                     IAKESFLVLKGNIYVTHALARFALIGCRDEIMGQTNSLGGVTRTATETIVTYLYDTLD
                     RYETVIVDLLKALHSIPVQSLAVNGPSLVNKIRYVAVSLLDALDANNPVSPEGAYLLD
                     FLAILSEIEQTL"
     gene            complement(1449463..1453511)
                     /locus_tag="CNE05170"
                     /db_xref="GeneID:3257594"
     mRNA            complement(join(1449463..1449779,1449865..1450069,
                     1450168..1450618,1450684..1450780,1450855..1450968,
                     1451062..1451160,1451199..1451234,1451294..1451402,
                     1451462..1451886,1451946..1452203,1452298..1452422,
                     1452461..1452469,1452539..1452607,1452677..1452881,
                     1452936..1453019,1453078..1453511))
                     /locus_tag="CNE05170"
                     /product="Beta-glucosidase precursor, putative"
                     /transcript_id="XM_024657308.1"
                     /db_xref="GeneID:3257594"
     CDS             complement(join(1449597..1449779,1449865..1450069,
                     1450168..1450618,1450684..1450780,1450855..1450968,
                     1451062..1451160,1451199..1451234,1451294..1451402,
                     1451462..1451886,1451946..1452203,1452298..1452422,
                     1452461..1452469,1452539..1452607,1452677..1452818))
                     /locus_tag="CNE05170"
                     /codon_start=1
                     /product="Beta-glucosidase precursor, putative"
                     /protein_id="XP_024512934.1"
                     /db_xref="GeneID:3257594"
                     /translation="MDIDLARRIGEALGEECRARGVHCLLGPTTNCQRHPCGGRGFES
                     FSEDPLLCGHIALAWIEGVQSKKVMTTPKHFLANEQEYLRRSNNSVIDERTMHEIYLE
                     PFRIQCKARPAVFMTSYNRVNGLHVAEHPFLLRKILRGDFEFQGMIMSDWSGTYSSSE
                     AVKASLDLEMPGPALMRGSSLERDIIGGKLVPADIDECALRVLHYVQEAQQSGIDFEK
                     DEETIDTPYIRALLREAADSAVVLLKNDKSVLPISSPNGKKIAVIGPNAKTASYSGGG
                     SANLPPTYLITPLEAITTYAESVGAKVEYTIGSDSSRWTPLLTPFIHHPTMGKDAGPG
                     VQCNFYAQNPWENKVKPIFSKYNNSAFSYFIDGIPKEVPVRGYVSLKTIFTPDESGIW
                     ELGLGVAGQADLFIDGKKIIDNSTDQKEGLLFFNTGAEERTGELNVEAGKSYDLEVRF
                     SNFKQLNAMSPYTGRRGGIRIGGRKKRDVRAEIEKAVKLATESDVAILCIGTNSEWES
                     ESYDREDMKLPPGTDELVRAVLSSKPETIIVNQSGMPVEFPWLDDASAIVQAFFGGNN
                     CGTAIADVVFGVVNPSGKLPITWPRVLEDYPSHEGFGHPIDTVYCEGLGVGYRYFDRG
                     DHPKSAFPFGHGLSYTSFTFSELSVKSEACGAKASFTLTNTGEIDGAEVAQVYIHDLA
                     PIVERPEHELAEFVKVYLRPGESKTVSVSLDHKAFSFYSIQEKSWIGRKGDYEIRIGT
                     SSTLIHLSKPVHLARSFKWIGLQEPQVYEPTWI"
     STS             1449598..1450285
                     /standard_name="Eco26"
                     /db_xref="UniSTS:470917"
     gene            1453700..1456121
                     /locus_tag="CNE05180"
                     /db_xref="GeneID:3257831"
     mRNA            join(1453700..1453996,1454055..1454088,1454151..1454220,
                     1454277..1454326,1454386..1454452,1454510..1454621,
                     1454686..1454771,1454839..1455044,1455169..1456121)
                     /locus_tag="CNE05180"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_571045.2"
                     /db_xref="GeneID:3257831"
     CDS             join(1453924..1453996,1454055..1454088,1454151..1454220,
                     1454277..1454326,1454386..1454452,1