GenomeNet

Database: RefSeq
Entry: NC_006691
LinkDB: NC_006691
Original site: NC_006691 
LOCUS       NC_006691            1438950 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 6
            sequence.
ACCESSION   NC_006691
VERSION     NC_006691.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1438950)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1438950)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1438950)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1438950)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017346.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1438950
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="6"
                     /note="MAT-alpha"
     gene            complement(571..2193)
                     /locus_tag="CNF00010"
                     /db_xref="GeneID:3258194"
     mRNA            complement(join(571..940,1017..1319,1390..1508,1591..1760,
                     1827..2193))
                     /locus_tag="CNF00010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571271.2"
                     /db_xref="GeneID:3258194"
     CDS             complement(join(663..940,1017..1319,1390..1508,1591..1760,
                     1827..2102))
                     /locus_tag="CNF00010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571271.1"
                     /db_xref="GeneID:3258194"
                     /translation="MAPFTVNWGIISTGVISTVFAHDLLVDPASRNTKDVNHKITAVG
                     SRSVQSAQAFIDKLKESSEGKSWAWGVKNGVLDGVKPRGTYEEVYNDPDVTAIYVGTP
                     HVLHHRNAKDALLAGKHVLLEKPACLEVEELDELFMIAKEKNLFFMEAVWTRFQPITY
                     AVEEVIKSGILGKPKRFSADFSMDWNLDADSGRMANPALGGGSLLDSSAYPSVWAMLL
                     VHRHPLNTDKDPKVLFAHQTIYPRTGVDINSRWLVEWKGLCQGMLMTDLDNAGQKDST
                     AVLQCEEGDLVIAYPPNEPKTFYIHPRPSRFAGTITSSTTHHHPVHDGNNGMSYEADE
                     VARCIRDGKIESERMPWEESRVVQGWVDKVRKEGPSETAKLVGTAGQ"
     gene            complement(3140..4847)
                     /locus_tag="CNF00020"
                     /db_xref="GeneID:3258335"
     mRNA            complement(join(3140..3418,3471..3506,3555..3920,
                     3969..4303,4357..4847))
                     /locus_tag="CNF00020"
                     /product="maltose porter, putative"
                     /transcript_id="XM_571466.2"
                     /db_xref="GeneID:3258335"
     CDS             complement(join(3240..3418,3471..3506,3555..3920,
                     3969..4303,4357..4832))
                     /locus_tag="CNF00020"
                     /codon_start=1
                     /product="maltose porter, putative"
                     /protein_id="XP_571466.2"
                     /db_xref="GeneID:3258335"
                     /translation="MESYDVFLIGNFVALPAFRDRFGIFDEATGGYVIATKWQSALQM
                     SGQLGALIGVFLAGPLTSRIGYRWATLVGLMLMNATIFVSFFANSLPLFFTGQLLEGI
                     PWGIFIANAPAYCSEIVPMRLRAPATQVLQMFWAIGSIVVGAVTYRYNTRPDTAAYKI
                     PLALQWMFPTPLAILMFLAPESPWWLVRKGRLDQAARSVERLGRKSRLNAGEVVAMMR
                     RVIDLETSTSAPGYIELFRKTDLRRTLIVCGIYGAQNLAGNLIANQAVYFFEQAGIKT
                     NLAFALGLITSALQMVFVMASWFLTTYFGRRTLYLWGTGVNTALLIALGVAASCGTST
                     AASYAQASLGLIISVLFTFAAAPVSWVVIGETSAIRLRPLTTGIGRATYYIVEIPCIF
                     LASYMLNPTGGNLGGKCGYVWGATGLFCFVVAFFCLPEMKGRSYREIDLLFKRHTPAR
                     KFATTEIGVEDDE"
     gene            complement(5884..7419)
                     /locus_tag="CNF00030"
                     /pseudo
                     /db_xref="GeneID:3258375"
     gene            7536..10289
                     /locus_tag="CNF00040"
                     /db_xref="GeneID:3258097"
     mRNA            join(7536..7633,7700..7897,7959..8168,8779..9612,
                     9666..10289)
                     /locus_tag="CNF00040"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024657312.1"
                     /db_xref="GeneID:3258097"
     CDS             join(7628..7633,7700..7897,7959..8168,8779..8895)
                     /locus_tag="CNF00040"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024513010.1"
                     /db_xref="GeneID:3258097"
                     /translation="MSLSRTFLRQLRPASSSRVVLRSFSSSRSTFSETPAGDAPVNPK
                     IAPIVDSISSLSLLEVSELVTALKTKLNITEISLPAASSPASAAASSTSSEAPVEEKP
                     KEKTIFTVKLEKFDAAAKAKIIREVKALMPNMNLVEAKKFVESVPQTLKENIPKEDAE
                     KLQKTLQDLGATVSLI"
     gene            complement(10790..12347)
                     /locus_tag="CNF00050"
                     /db_xref="GeneID:3258059"
     mRNA            complement(join(10790..11170,11300..12032,12081..12347))
                     /locus_tag="CNF00050"
                     /product="phosphoglycerate dehydrogenase, putative"
                     /transcript_id="XM_571275.1"
                     /db_xref="GeneID:3258059"
     CDS             complement(join(11068..11170,11300..12032,12081..12264))
                     /locus_tag="CNF00050"
                     /codon_start=1
                     /product="phosphoglycerate dehydrogenase, putative"
                     /protein_id="XP_571275.1"
                     /db_xref="GeneID:3258059"
                     /translation="MSTSHLRIPPAEPFTPSREATVYLHTPFHPKAEIYAETKFKKVL
                     RPKDGKVDDLMKQIDGILLRTGDVTAEMVLAAPNLRIISRNGTGVDNVPLPTCLSRGI
                     AVTNIPGSNAFAVAELAIALMLTVLRRVVEVDKRIRGGERVPSIEALAPGLGGKKVGL
                     VGMGDIAYELAKLLRAFGCEVLIHSPSSPELRWTVEDTRYPVTISHTRMPSLRSLLEQ
                     CDVLSLHCPLNANTRYMIGREELGWMKSTAVVINTARGGIIDERALEEALKERKIGGA
                     GLDVFEKEPAYGESLGGLRDLDNVVLLPHLGGSTDSVTLDGCIKAVDIMASYLDGKGA
                     INRVI"
     gene            complement(12677..12772)
                     /locus_tag="CNF00060"
                     /db_xref="GeneID:3258330"
     tRNA            complement(12677..12772)
                     /locus_tag="CNF00060"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3258330"
     gene            13071..15844
                     /locus_tag="CNF00070"
                     /db_xref="GeneID:3258333"
     mRNA            join(13071..13298,13355..13730,13786..13913,13986..14353,
                     14409..14683,14765..14930,14995..15154,15225..15844)
                     /locus_tag="CNF00070"
                     /product="glutamate-tRNA ligase, putative"
                     /transcript_id="XM_571277.1"
                     /db_xref="GeneID:3258333"
     CDS             join(13113..13298,13355..13730,13786..13913,13986..14353,
                     14409..14683,14765..14930,14995..15154,15225..15752)
                     /locus_tag="CNF00070"
                     /codon_start=1
                     /product="glutamate-tRNA ligase, putative"
                     /protein_id="XP_571277.1"
                     /db_xref="GeneID:3258333"
                     /translation="MPDVVLPLVQTPPFVIIALAALQGIPVTWDAQSGEQGQTTYGDI
                     VGAENVRAELEKGVDGKEIPLPPLPTLLTSTSSFQDVSAVLDAFDDYLAYRTYFAGPK
                     FGFGDATIWGTIRGNNSAIGSIKKPGRPHLQRWFNHVETLDVPKAALESHRQAKSEME
                     KGKKTKRLESIDVVLPNAIKGKVVVRFAPEPSGYLHIGHLKAAILNRYLADQYQGKFI
                     LRFDDTNPLKEEGEFEEAIQEDLKMIEISFDKIVHTSDHFDKIQAYAEQLIKQGDAFM
                     DDTEGETVKEQRRAMIPSKNRDLSIEENLVKFKEMCEGTEEGKRWSLRAKIDYQHKNG
                     TLRDPVIYRYVEGSHHVTGTKYKSYPMYDLACPIIDHLDGVTHALRANEYWARHEQYQ
                     WFLKTLGFANIEIFDFSRVDFVYTVLSKRKLKYLVEKNVVKGWDDPRFPTVRGIRSRG
                     MTVQGLKNYILGQGASQQAVQLEWDGIWTVNKKVIDPVAPRYWAIAEDRMVSVNVIGR
                     ETEEPEVVSRPLHKKNPEVGEKKLVFASKLIMEQEDAKTFGENEEITAMDWGNAFVTS
                     KITTPSGDVSSLTITLHLAGDFKKTSKKVTWLAAPTDANPLIPVVLIEYDYLITKKKL
                     EEDDSLPEVLNPKTEYRTYALASKEVEGLKKWDIIQFERKGFYICQGTRDNQGRMEFG
                     FIPDGRAATVALKAKPAKEKTKVPGTAKGSWGKPGPKAVSTAAAAP"
     gene            complement(16407..24007)
                     /locus_tag="CNF00080"
                     /db_xref="GeneID:3258125"
     mRNA            complement(join(16407..16531,16590..16680,16735..16814,
                     16871..17036,17093..17147,17204..17358,17415..17568,
                     17620..17692,17744..17948,18000..18166,18218..18342,
                     18400..18713,18762..19113,19171..20268,20346..20824,
                     20923..22086,22152..23513,23564..23682,23734..24007))
                     /locus_tag="CNF00080"
                     /product="membrane protein, putative"
                     /transcript_id="XM_024657313.1"
                     /db_xref="GeneID:3258125"
     CDS             complement(join(16524..16531,16590..16680,16735..16814,
                     16871..17036,17093..17147,17204..17358,17415..17568,
                     17620..17692,17744..17948,18000..18166,18218..18342,
                     18400..18713,18762..19113,19171..20268,20346..20824,
                     20923..22086,22152..23513,23564..23682,23734..23890))
                     /locus_tag="CNF00080"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_024513070.1"
                     /db_xref="GeneID:3258125"
                     /translation="MLTEEPPTKSAPHYGQATAESGTFSYDDHYYDHQDVDLEDEIAR
                     LEEEAADSSDEEEGIDFVPMSEIWPSAMPNRLGQGYTTKNGVRRELDDPDDPRLSAVG
                     LQMSLPYEVESLVEMDDKLDFICAKLIESIKAREFGMGFRVWDSALSIWMTMGYPMKR
                     DVKIKLIFLYYETIFAPGLSASFIEDVANQFIALASDRTLTIYDFRIPWRPLYETLYL
                     ELFPHPNKLARHSMNLAPSLLNVAEEAQRFFHPSSVDEMLETILPQLQPNMDSILATQ
                     TFLVHFLPISHCQKWLPVIFRFWQGYNSGLWDDQASDLMGQLAIAHVDPARSDPSLLS
                     KIPHGFQNTPEEEVTNPSAKKRARHHQLRLLEVAGKVQEDADGLSYWVDESDPSLPPE
                     EKLGDPDWQGIRKDVGIFTDEQFEFLMSKCLRSLNVPVGGAVASQNSMSVTVADTRAS
                     KKILDAKKPIDRVQSLAETIVFSISEDALPLVSGGTGTATGTGTPSGVATPSAKGAVG
                     KMKDNLAAVGRKEELHRRYLAGSKALDHLSKLLTSCETFFHPSNSGHWSNFLCTFLSH
                     LANNFIERLKSEEEPSCKTPPAWRITPAIKREFVLILRPLALTAIFNKDMKAVASAVS
                     ALKKLSLLEPDLIMPAILERAVPSLQGLEETQRTPAVTYALAALASPLAARQIWRQGG
                     MYIADIFGLLLPGIDLNDPSKSALVSMCISNIVDFIYMGDISDGDSDIEMSGRVLAEV
                     ENARAVRKIPREKVEDDPNDPVQLEMEDLTPEEVNARIRMTTSTFRDWVTEFLGRVLL
                     LFANLPEEGGKSGRAGGKTEQITLQSVLHTCGNVFAALSPPLFDLVLDQIVEYCTTTC
                     RGNAVDAVGELVRNLAAADAPKVFKRLFPIIRQKIAAELKGGASSMRTTTTSIPLPSD
                     AGLHWWQSILIGTLIPGRVCLSDPEIKTQYIGLLRLMIDNTHSERGWQWTGKIIEKTV
                     SSLTSIYFSEMRMLNPSTWGSQDFTQNHHLYWGKLYRPSEVEPQWRTPSKEDVEMAID
                     VIGLADEAVGRIEALVKEEGRYADKEWTNEFCRAVNVVDKVLRGTYNLVAELEDQKVG
                     GEKAPSYLPGAFTAHLPTYKSGLILIDPADPRYQHVQSFRQRTGEILNLAATALRSAG
                     GGSDSSVDAVKLLVTTISTYLTAYGVRSKQFSSAQSALSGMVATKKMFEGQRKHHRTI
                     YLANASIHHQTRMTTLAYYRKRSELDDKLIISMLNFCVSPFVRVRKSAQNALDTIAKL
                     YRGVWVLCFPTLFQALRPGTDPDIMKGALYVLRYNHIGITRIGKDWRQLLELTECLLN
                     AHHENKASVQALVSKATDELIARIREPHAFDMNVRLERIQEAADELASVISCQPDPAL
                     VEIVHQGTVERLQQQETQWDIFVDKVLAIAKSPSLNWRYVLSAARFLLAVMRRDRPMD
                     LRLADFFMGNVQNPLPRIRDYGIVGTTRLLFSMTLRSLCQGSEELLFLEEPIDEYSKE
                     IPLEDTSPEFTQRYLTSFRETPDDESKVVLQDRQQSGWLAWGNTLEVSRFTGWDEPLF
                     PIEEASLPGKELIGKFISGEGWWERLASLWAQENERNYPSATHIDFILALSQLYGPSI
                     FHSIRPVVEGYLAEMESTKVYDRHKTRAMWEFLAGVLRGSMEWSGKDRKSLWDWFTPR
                     LPELHGNIRHDTIKCWDTSIEYVLCDQDPRRFKPLVDFCINTALSANFQGASAFDLTR
                     SVQLARSVIRCLQWRFNAWADDFVEVYFREVTCPYAEVRGLIASVLNAIDQLKFYPSY
                     PSAAALVSDILHDPKDNKDIMHIRSSFFQPQLEKIMGSLPVLKELRPHGPKAVLSDHD
                     TSATTAILWLTVELSDVHAVSAFPYIIPYLPQIFELRELNDNIDLQRNCGRLLAMITS
                     ITPALDLIDPLMSALINILQESSSWRTRIKVMPVLSLVYFRNLSLLSEPCKAQCLDVV
                     SACLRDPNQEVREMACATLSGFLRCSQRAMVVILKDRFAREIQSITLPKRRGAPGQVN
                     PEYQETLIQLHGAVLGATALVEAFPYTVPKFIPKLLADVLAPRVSDPAPISTTIRSCV
                     ASFKRTHEKYQDKFSEDELSAMNYAQAGNSYYA"
     STS             18851..19746
                     /standard_name="EcoV5"
                     /db_xref="UniSTS:470823"
     gene            24181..26261
                     /locus_tag="CNF00090"
                     /db_xref="GeneID:3258236"
     mRNA            join(24181..24350,24402..24598,24661..25011,25059..25975,
                     26023..26261)
                     /locus_tag="CNF00090"
                     /product="rRNA modification-related protein, putative"
                     /transcript_id="XM_571279.2"
                     /db_xref="GeneID:3258236"
     CDS             join(24232..24350,24402..24598,24661..25011,25059..25975,
                     26023..26145)
                     /locus_tag="CNF00090"
                     /codon_start=1
                     /product="rRNA modification-related protein, putative"
                     /protein_id="XP_571279.1"
                     /db_xref="GeneID:3258236"
                     /translation="MLVLTETSVGFVVFKLSSDAKIDNKDLWKEFETPEGANKALKVQ
                     AIQRFTSTASAVEDLTAVQDGRLTDSLSRFLLDTVGGADDGEKKKKKKKIEEMLVVSD
                     PKLAGTINKALSIPVLSDSSTQDLYRGIRQQLASLLGGVDQKDLNTMSLGLGHSLSRF
                     KLKFSTDKVDTMVIQAIALLDDLDKEINIYAMRVKEWYGWHFPEMAKIIVDNIAFARV
                     VKAMGFRTNAVTTDFSLLLPEDLEATLKSAAELSMGTEISDSDMTHIHSLCDQVISIS
                     EYRTQLSEYLRNRMQAIAPNLTALVGELVGARLISHAGSLMNLAKHPASTVQILGAEK
                     ALFRALKTKHDTPKYGLIYHASLIGQAPQKLKGKMARMVATKAALSIRVDALSDADSR
                     SDVSAAEVGISNRVKLESRLRALEHQAGIQSVRKVVSANGQQGRQQPRFEMSGVTGSY
                     NAATDNVPLNGDLLPTQPATEEVKEEKDEKKDKKDKKKKRKSEVAEAGDVTMDGDADL
                     SMVAGETKEERRARKEAKKAAKAAKKAAEESGDGDKKSKKRRADEDEDSEKKKKKKKK
                     DE"
     gene            complement(26337..30158)
                     /locus_tag="CNF00100"
                     /db_xref="GeneID:3258073"
     mRNA            complement(join(26337..27087,27163..27480,27687..27946,
                     28044..28712,28769..29630,29686..29788,29840..30158))
                     /locus_tag="CNF00100"
                     /product="3' tRNA processing endoribonuclease, putative"
                     /transcript_id="XM_024657314.1"
                     /db_xref="GeneID:3258073"
     CDS             complement(join(26400..27087,27163..27480,27687..27946,
                     28044..28712,28769..29630,29686..29788,29840..30065))
                     /locus_tag="CNF00100"
                     /codon_start=1
                     /product="3' tRNA processing endoribonuclease, putative"
                     /protein_id="XP_024513069.1"
                     /db_xref="GeneID:3258073"
                     /translation="MASAETYQPNWAVRAVTTPTKDTDLCLYVSFDNVRFLFGCGEGT
                     QRAFAQKKIGFSRLGGVFIGSGELKGRGGLPGVLMSASDAGLSKIDVVGPPDISQYLA
                     TLRSSVIRENLTVNVIPYPRDVTPGTPVKLYESRNITVHGVALIPTLDPFSATETNMV
                     YPPYDPYSATFNPSHLSPADLQKWCDHIVRDMFQNNAQARLSKRAPSATPSPSTSPRL
                     GSPIGSSKRPRTNNVFLAPDGTINAARPDPRAPLPLPSDSDVETQMLYICQAPDVRGK
                     FDVAKANTLGVPNGPLRGKLTRGESIEVPDPNVDGGTRVVMPEDCLVGGGKGGTLVIV
                     NCTEKTLQTLLDGDALHKWQKETPTGEREGEGGIDVMVHRVPRSVWGDERYQAWMQSF
                     GEKTKHLIANTTPAIDHTVFNSAAWNTLHLSLIEPTIFHPPFLRHASTSFPSFESNLP
                     SNVTFIHPNDFVKMYPPSPLETFPWHEKDLPFTVTENQADDAREKVKKEKKDYDVVCE
                     KARSIVRQLDMEKAKAKETADEDEQSDDIVVTTLGTGSAIPSKYRNVSSTHLAIPSLG
                     GILLDAGEGTLGQLKRRFGEGLKSILEELKMVFVSHMHADHHLGMNAVLEERFRLGIN
                     TPLYIIAPYLIALNLQETATWQAVGAEKGLKNVRFLCVERLGERMSVDVTEKDSSQKV
                     EWRQMEGGGKRRWPFVPLHGFSESVSKIQRLYLRQLFADLGLTAIYAPSVPHRGRAYG
                     LVLEGAPTGKDGLKGKGWKIVYSGDTKPSQKLVEAGKGATLLIHEATLEDDKPEVAAV
                     KGHSTFSQAIDVGKEMRAKYILLNHFSQRYPKLPKLPMPTSVVPVVETPPTESINAEP
                     NAIFGENATFSASSTSLQVSTEPIVSISFDFMSLRLGDMWKMPYYMEGLSMLFAEPED
                     GEDVVNAVQTTEGTGVDGKEGNEKGGNQGKGDGKEKTVANVSWGGNNASPVVAKPASK
                     SKRSLKKEAARAVKAKAEEERAAASVSGIMVGGIQKEEKKEKRGGSPGLEGPDRKRRS
                     TGIEESGVEEA"
     STS             26714..27673
                     /standard_name="Cla1"
                     /db_xref="UniSTS:470824"
     gene            33888..33985
                     /locus_tag="CNF00110"
                     /db_xref="GeneID:3258331"
     tRNA            33888..33985
                     /locus_tag="CNF00110"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3258331"
     gene            complement(34262..37048)
                     /locus_tag="CNF00120"
                     /db_xref="GeneID:3258021"
     mRNA            complement(join(34262..34616,34832..34854,34929..35240,
                     35346..35421,35474..35570,35633..35711,35792..36043,
                     36096..36279,36331..36421,36490..36567,36632..37048))
                     /locus_tag="CNF00120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571281.1"
                     /db_xref="GeneID:3258021"
     CDS             complement(join(34500..34616,34832..34854,34929..35240,
                     35346..35421,35474..35570,35633..35711,35792..36043,
                     36096..36279,36331..36421,36490..36567,36632..37008))
                     /locus_tag="CNF00120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571281.1"
                     /db_xref="GeneID:3258021"
                     /translation="MYYLFLLLSSLLILSTLAKPTLDPQLHRQLLLNGRPQIGLWKAL
                     LQEQVAREASTSESNVDHQRPFQTIKPSSSIFEPYCFPQFISHFDESVNGTFCQRYWV
                     DASSYRPGGPIYLLDGGETSGEYRLPFLEKGILDILSNATGGLSVVLEHRYYGESVPV
                     SSFSTDDLRFLNNAEALEDSAYFIENFKLPASLSNALPFELEETAFHPNNTPWIYYGG
                     SYAGARAAHMRVQYPNLVWGAIASSAVTHAQIDFPQYYDPIQEYGPPECISTLRRAII
                     FIDNILDHPRATGFPQLLKGLFGLGALEDDDFADVISSPLGYWQEKNWDPAVGSTEFY
                     NFCDALTAGGAGTKIGLIRVPASVLNYAKYIKENIVSKCPRTPGEPDSDIVVCFGTKD
                     PEKFRETDLSQTWRLWLFQVCTQWGYFMPAPPSPSPRILSSRLTLAYTSAICPLAFPP
                     GEHFSIPSEPDVEEVNRRGDYAIEADRLAFVDGDRDPWRPMTPQRNGTRGKKGGMDMN
                     KPGWIIYDGVHHYDENGLTQHEAEPARIQAVHEWEKMFVSAWLEEWKIKKGMA"
     gene            complement(37445..39048)
                     /locus_tag="CNF00125"
                     /db_xref="GeneID:36392883"
     mRNA            complement(join(37445..37627,37680..38571,38622..39048))
                     /locus_tag="CNF00125"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658548.1"
                     /db_xref="GeneID:36392883"
     CDS             complement(join(37682..38571,38622..38979))
                     /locus_tag="CNF00125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514476.1"
                     /db_xref="GeneID:36392883"
                     /translation="MSVINNIGTLTQTMDDSVLELPLRSQNNLVDRSIEEATTYSPPP
                     PYNMQLSAFPSQPKEVTEALLEGQVNCSGERNTCEGQTRGNNLGTDNLEAKSQSAILY
                     LDKYEKVRHSGRHRWSLDTTDTDLTLVDIPSSPQCSTIKGMRPLLLPSRLQQSSSSIS
                     NKSKMTNTYALPRDRPPMRSTYSYMGDKEDITGDRMVRCGRGMIARRGLGADFKLTRN
                     EKEERIYGAVLCLPSDMGLGLSSESDTESEASFSPPIPIPSDVSFALSSLADFLSPTD
                     PHSLMSPKDKEGPSSKGCLQAPGSPSKGSGRRMAWAKNVEARLEADREGMVPVARFVP
                     SAISSTSTGWFSLFLSFFFKQPQHRPKPPKPTPAPNIPLHILLLLLEIISTIARGIKY
                     AVLTGVKVWVVMEVVWRGIESEV"
     gene            39223..41567
                     /locus_tag="CNF00130"
                     /db_xref="GeneID:3258114"
     mRNA            join(39223..39371,39424..39678,39730..39855,39896..40059,
                     40109..40345,40396..40522,40564..40809,40857..40982,
                     41039..41202,41254..41567)
                     /locus_tag="CNF00130"
                     /product="expressed protein"
                     /transcript_id="XM_024657315.1"
                     /db_xref="GeneID:3258114"
     CDS             join(39253..39371,39424..39678,39730..39855,39896..40059,
                     40109..40345,40396..40522,40564..40809,40857..40982,
                     41039..41202,41254..41516)
                     /locus_tag="CNF00130"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513071.1"
                     /db_xref="GeneID:3258114"
                     /translation="MADEVIEEYMQPRELSDDELWMAWGKFDKLPADILYDLDDYSTP
                     THYSSMRITYDLMSPGASADLHSLRLAKASIWETAEKLMTPFDDRGMSFSRSYQNTKF
                     GNLQKPLAKRLDELENLKEKANKKYRDGDFQEALKGYTTAWKEVLPHHVEALPECDPN
                     RPRLGYLEAVVFANMSATCITLSKAISKKDGERKFTRMALRCAWVTFELREFAAATTV
                     RNALLRANETLRKLHGSNQKLAPQYQQMSQYYTQQCKALENISKDTLFKDLDAELKIA
                     PPSLAVLQTFGPRAWAQDWIQALPPILRPPPVETMEQRKKPRDLTPYELWAGWGDLPI
                     GEWHKGLESFEMDILHPYLRVMYELSSSGRRRELNNLRLAKFDILRTIMLSTIGDVEF
                     DLFMKMIKGKPVDERPLKEKVAIAELKKANANKIYRRGDILEAAAEYLFAWSMILPYH
                     TTALAPSDPIRADLGKFESALWCNLSAAFIGIGKEPGDEMGSAGFRGLAYRCAWAAFE
                     EREYATVSTVKNACLRAKDNFYLSRLGGGNDLEKQVTDVRTFFVKQAELLSDLPKDMM
                     YADAPASKKLPIPDRETMKHFGPNIWPREQDMEELHEPFTFM"
     gene            complement(41651..44993)
                     /locus_tag="CNF00140"
                     /db_xref="GeneID:3258468"
     mRNA            complement(join(41651..42318,42387..42571,42623..42775,
                     42828..43204,43256..43803,43853..44214,44270..44362,
                     44434..44993))
                     /locus_tag="CNF00140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571284.2"
                     /db_xref="GeneID:3258468"
     CDS             complement(join(42247..42318,42387..42571,42623..42775,
                     42828..43204,43256..43803,43853..44214,44270..44362,
                     44434..44989))
                     /locus_tag="CNF00140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571284.1"
                     /db_xref="GeneID:3258468"
                     /translation="MTPSRDSALASASASRAQSYKGSPSINPRYSTGNPASTPPLAAN
                     GVPPPRPNRAGTLPLDLSLDRDPSPQPASARSPASQLPPVLPSPAVSPGVFSPPTLGQ
                     PFAAPVGPAPGNPYFPSATAAIEKGMEDVKMSGPVGVGVPMGVVEPREKELPREPGSA
                     AMGGRSRSGTGRSSKDKKSMFGFVSDLLGKDKPPVISKPYDPVHVTHVGFDFQTGKYT
                     GMPPKWQQVLDDNGITQDEQERNPNGVMAVVQYLKHQDEGEDEEEEVWAKMKNAQPPA
                     FPPPSAAPSQPTTPGGGVGSREMSREPSNEALGAAGTQVVDFTCPRMAPAPPTKPSLN
                     RMLSERHAPASHRPAELTTPAPLAAAPRVTQAYSSALSHSPHLPPPHPTSSAPPTAPA
                     PHLDRSYSQRAPVSGTKTKVLDRANTTRSPGSSAGIAQGAGTGVGLTKSQSQSGHKSR
                     DPSREPKDSASSSGGLSRNQTTTRQQQGATPRRREKEKKENEDVIRQLRMICTPGDPN
                     LVYKNFRKIGQGASGGVYTAIDRQTLPVAIKQMNLEKQPKQDLIINEILVMRESAHPN
                     IVNFKDSYLWQGDLWVVMEYMEGGSLTDVVTAHCMSEAQIASVSREVCEGLRHLHSKG
                     VIHRDIKSDNILLSLNGDVKLTDFGFCARIADPTTTKRTTMVGTPYWMAPEVVLRKEY
                     GPNVDIWSLGILAIEMLEGEPPYLTENPVRALYLIATNGTPKIKDWDKLSTVFRDYFK
                     VTLQVDPAKRPTAAAILKHEFFKHTAPLISLAPMIRSSRKS"
     STS             44141..44557
                     /standard_name="Hae7"
                     /db_xref="UniSTS:470825"
     gene            45122..46468
                     /locus_tag="CNF00150"
                     /db_xref="GeneID:3258467"
     mRNA            join(45122..45398,45440..45594,45657..46468)
                     /locus_tag="CNF00150"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_571658.2"
                     /db_xref="GeneID:3258467"
     CDS             join(45312..45398,45440..45594,45657..46338)
                     /locus_tag="CNF00150"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_571658.1"
                     /db_xref="GeneID:3258467"
                     /translation="MPGCLSVGQGTARALAAALGKRLVGVHHMQAHALTPLLTSAAAP
                     EFPFLILLLSGGHTQLVLAKGLFKFKILLDTLDSKIGDVFEKSARLLALPSGPKAPGA
                     ILEHYASLPALPPYDTHPLPASQLIPIPLTTLHAKNTLAWSFAGMLAALQRAVHDRRQ
                     RQPAWDEPDRRAFANLVQTALTTHLLTKLAQRIALLPPDTRAQLGGIVVSGGVASNAY
                     IRSQLDRLVKTENGLFPPAGRNLYYPPLHLCTDNAAMIAHTALIRLQTGLRSDPDDLK
                     LRAKWSLEDMYDDVPEEAYMVKGAKEVGMGL"
     gene            complement(46402..47411)
                     /locus_tag="CNF00160"
                     /db_xref="GeneID:3258289"
     mRNA            complement(join(46402..46616,46659..47045,47101..47203,
                     47256..47411))
                     /locus_tag="CNF00160"
                     /product="Rho small monomeric GTPase, putative"
                     /transcript_id="XM_571459.2"
                     /db_xref="GeneID:3258289"
     CDS             complement(join(46554..46616,46659..47045,47101..47203,
                     47256..47302))
                     /locus_tag="CNF00160"
                     /codon_start=1
                     /product="Rho small monomeric GTPase, putative"
                     /protein_id="XP_571459.1"
                     /db_xref="GeneID:3258289"
                     /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTV
                     MIGDSPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLICFSIASPASFENVREKWFHEIS
                     HHCPGAPCLIVGTQVDLRDDPKQVERMMSGSGRGGGGGRGGLITQEQGERLARELGGR
                     KYVECSALTQKGLKNVFDEAIVAALEPPVVKKTKKCLIL"
     gene            47597..49662
                     /locus_tag="CNF00163"
                     /db_xref="GeneID:36392884"
     mRNA            join(47597..47757,47836..49194,49244..49662)
                     /locus_tag="CNF00163"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658549.1"
                     /db_xref="GeneID:36392884"
     CDS             join(47719..47757,47836..48828)
                     /locus_tag="CNF00163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514477.1"
                     /db_xref="GeneID:36392884"
                     /translation="MVYAPQRRHAMASLTSIAQILAYLQYLHSPSLLILIARLLTHVQ
                     IQVISLIPPSRSLQNLALMLTLVNIVAGILHWLDSAHGGGGGGGMVLDFVGTRPLGLA
                     CVWILDVLIWGIHLLALVLSYINSIGGTHDYKRSTKFPYPDILLPPPPPAAPQSTPQT
                     TPPFPFSFPFPFPFPWSSTSSKYGVIFQEDEDEQAGDDLESGEHHGGPSPAWGTSTPT
                     STSDPDPFPFPLPPPPSPPSPHWTNPPTIFSLSLSHLWTVIRYLPAPSPARVVEGGTP
                     AVTPAATPAVTPRNERRGLAGMNRLGGAAAVGGISIGAESQSERAREREGADGEGRIP
                     GSYWVNRDW"
     STS             47883..48091
                     /locus_tag="CNF00163"
                     /standard_name="GGC8"
                     /db_xref="UniSTS:470827"
     gene            complement(48821..50637)
                     /locus_tag="CNF00165"
                     /db_xref="GeneID:36392885"
     mRNA            complement(join(48821..49180,49235..49299,49361..49921,
                     49987..50002,50061..50204,50271..50637))
                     /locus_tag="CNF00165"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658550.1"
                     /db_xref="GeneID:36392885"
     CDS             complement(join(49163..49180,49235..49299,49361..49921,
                     49987..50002,50061..50204,50271..50546))
                     /locus_tag="CNF00165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514478.1"
                     /db_xref="GeneID:36392885"
                     /translation="MFLPQLSVNIATTVSRPPLRRSELSLPIVDPRFLQITLDYLHCP
                     DSSPAKDGEDMEDNPIISYRRTKGALRRFFGTGSHFYMTGFKMENGTSISRMELIKAW
                     ACASQALVFFHEIFLYRLDDVQVGQDSFRNSANKLFWEASGCQRVIQSAMVDLSVYEG
                     EAPWEMPTAWLPLPDSYDISNLGEFGEQSMICDAILSGNRSLNLEGGQPTITPLFILA
                     ARHMLALHEQGYDQIFWKARPISKETGEPVPPVRKMYHLPPGFPIDDREIRLRIRLSN
                     GEVRVEDCEDQEDKDLGNDGLIVDNISDSTLARTSEYDSQSSFSTSSISPLHGYNKNP
                     NTSSALVNWLFPSNSNNLRKRRAFS"
     STS             49274..50064
                     /standard_name="Hind1"
                     /db_xref="UniSTS:470829"
     gene            50867..52071
                     /locus_tag="CNF00167"
                     /db_xref="GeneID:36392886"
     mRNA            join(50867..51513,51587..51647,51733..51931,51988..52071)
                     /locus_tag="CNF00167"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658551.1"
                     /db_xref="GeneID:36392886"
     CDS             join(51387..51513,51587..51647,51733..51931,51988..52014)
                     /locus_tag="CNF00167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514479.1"
                     /db_xref="GeneID:36392886"
                     /translation="MSQEELQNKVAQRMGLVDFGPREGSQRESENDRLYRRSVLYNRF
                     PVTVGLVGSIGTLIRSLQEYTQWEFQILIAINSFLSLYLPLRRFLQDPMARQFRSRIR
                     KNSWEAYDGWMELLNTALNLFVGVLTAWVIRNRDV"
     gene            complement(52835..55020)
                     /locus_tag="CNF00170"
                     /db_xref="GeneID:3258339"
     mRNA            complement(join(52835..54269,54348..54649,54761..55020))
                     /locus_tag="CNF00170"
                     /product="expressed protein"
                     /transcript_id="XM_571286.2"
                     /db_xref="GeneID:3258339"
     CDS             complement(join(53094..54269,54348..54649,54761..54833))
                     /locus_tag="CNF00170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571286.1"
                     /db_xref="GeneID:3258339"
                     /translation="MSGNQKQPLHIIVNPAAGQGKGPAFLDEHIIPILNHFRQSYKVY
                     PTTAPLHAGEIGRSILDSRRELGKGGEPVVGGERDEPNVVIIIGGDGTAHELIEGVTV
                     DQQAENEDQGWGRWELIVLPFGTANALYYSLFPPSDPLPDTSILSSLPYRPSPEVTAQ
                     ILPLVSFLKRSTSPLPLPITLTTLLPPPSPPHDVAPKTSRNIKPIPTHVVLSTSLHAA
                     ILESSEKLRETHPGNERFRIAAQESMGIFFDASAWLFGSGSKVGGEERVKVDVEQWDP
                     RVGSWVKPFTEHRALVDEGGKNGKGIELQGPFAYFTSTATVSRFEPAFVISPLTSLRP
                     PPSQQIQQDKNADGEGSRDNKNEYIYITVLRPLRDPCVLSTFPASSGSDQSERPDRGD
                     RSERWAKRAHEVLGKAYHNGAHIDLTYPLNKGENKGNVSGEGDGEEGCEAEVKGQGEP
                     VVELYRCAAFSWKPTAITQTDRTKEKGSERARLVCADGAIHRIPEGGKAEVGLMVPSE
                     KGGFYVWA"
     gene            56311..57657
                     /locus_tag="CNF00180"
                     /db_xref="GeneID:3258071"
     mRNA            join(56311..56647,56735..56904,57004..57657)
                     /locus_tag="CNF00180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571288.2"
                     /db_xref="GeneID:3258071"
     CDS             join(56386..56647,56735..56904,57004..57594)
                     /locus_tag="CNF00180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571288.1"
                     /db_xref="GeneID:3258071"
                     /translation="MLALGVLVLALHIFGGAFAAPSKLVLDTPFQNDQIKFGVFSEPT
                     TVDKPLTGNIAYELRETERTFLLNVPENYVHGKAHPLVFSFHGAGGYSEKQQRITELS
                     DPSLKIAGKSFLTVYAQGVNNTDWNMTHIWKGAPYENTTVDDIAYVYDILRTVSSSYT
                     IDKSRLYACGKSNGGGFTALLACRPDTSALFAAFAPVSPALYQGTFAFHGCQTERGVN
                     IFHSHGVEDTDTQYHGRTPEGGSFGPEPDVRQWRREWAERNGCKGRWPGQWAEPKVEE
                     IYPGVWEEVWDCPKGEVKALSIEKLGHAWPSTAGWDLAGFPNQTANFNFTNPHLVDFF
                     SEHQLV"
     gene            complement(57649..60208)
                     /locus_tag="CNF00190"
                     /db_xref="GeneID:3258441"
     mRNA            complement(join(57649..58890,58941..59028,59067..59398,
                     59449..59897,59950..60208))
                     /locus_tag="CNF00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_571457.2"
                     /db_xref="GeneID:3258441"
     CDS             complement(join(57748..58890,58941..59028,59067..59398,
                     59449..59897,59950..60055))
                     /locus_tag="CNF00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571457.1"
                     /db_xref="GeneID:3258441"
                     /translation="MGKRLEDASCAICIDSLFNKRDDLDDIIPIATCECGHVFHEPCL
                     LEWFKTQSQAYLAAAREAGVPGRHGSPTLSDAPVECPSCRAECFADPETGNPIIHRLY
                     ITFDGRSSSVQPASSPLRRDIDRQAKRREEEALSLAKRAKMLTEEVAGLGAESKEEEM
                     EGMIKRTEGLVKDLELSAKAASGIKTYVGGLIVAVNKLRSALEDHPVIHALQGRIFQL
                     ESSLKETNAEMKTIIPNEIRKAKEAEQAKADKKIKRIMDELEVIQRELEKEKVARRAG
                     KKEMDERAKENEKKIMILESQLRREAKEKEDLQATLRERTKMLKMYQSKADSRKELKA
                     KVQKLEAENARLQADLKASTNAPQRSRKISDRSSSPEVFDYQQLNKSASPQRDIMYGE
                     IPGEDDDPIIQEIPPLDLDLTLPYARSRTSRAQLIPPTSADESSLLIDMPSFHDDSLR
                     HVTGLPASPKRSRSGKELDTRQHPTARTISFDLDEGLKRRKASKSKYFPVSHSSEFGS
                     GGVVKEQGMEKEKAREKEGGKESRPRKRDRKGGDLFASDAEESESDDEPVPVPQPRQN
                     KINPFATSKQSTSSRARLPTTSAIPIPDSSLQRAKFCPDNEPDYQLEPEVNHDGQSPR
                     GCMVVEPKRVPLRTKEKEQVKDASKIGDKGKGKEMMSTGALGKQKGSEQKSVVDWLGI
                     RDPNGRPKAGTNLMLGRQIKKRL"
     gene            60363..63832
                     /locus_tag="CNF00195"
                     /db_xref="GeneID:36392887"
     mRNA            join(60363..60682,60745..61026,61084..63832)
                     /locus_tag="CNF00195"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658552.1"
                     /db_xref="GeneID:36392887"
     CDS             join(60419..60682,60745..61026,61084..62562)
                     /locus_tag="CNF00195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514480.1"
                     /db_xref="GeneID:36392887"
                     /translation="MSLSYLPLFNIFPTLSLGLVKEPTMFLRTTVQFQPFQYAPPQVV
                     SNDIVCAPTYQSTVANVDDATLNDEMSVVSRNLINTPCPPEDLVIIERTRQVPGGRDV
                     AYLKSIGLKLDNAQGANAAHQPQRSSVADTNALFFAPGNHAQSSFPVSLARNPSEASE
                     ATANNPVNPLPASPPWPPLESPDRSSASIPDDWELTHSKRVDDMMKKLYQRSNRSLPQ
                     FPPHLEAFTCISPLSSLSPSSNHSNFTPTPLIPSTVPSNPQTASSQSLPLPSVFLSPT
                     WSTITTRDNSQGLRETRSAPNLPAISSMRVSTPSSKTNFNTTARAGEPAELVSEKGQD
                     TMSDVRSRRGDDSMTLRRLADVIESAQRYVKQHEQKKPLHFLSVRTVPQIAVQKPAPS
                     DSSRQPRDFQTNQRFHFGTPSIPIPTFHSSTFNPQKLPSSGPFRVSKSSSDVARLNSS
                     PYVASTRSRPWSPPNSPPSNQNLKLDMTSPTRLRTGKSTSSFIRSGPIVHEPPGTGRS
                     EYQSPLKLRTPIIPRQTPDWAPEPFLRLRHTPSNLPLSHASFANSHRTPPIILEPPYL
                     TGTNQAFPSTFMPQHTIKPTSIPTTTSSSTTVIIKVPSDNLTAADAPRANDALQSPVI
                     LRKTSPVEPKTSRTSLSTAAVQKSRNPIRKKVSTAFNKAKSHYSKLLKKP"
     gene            64647..66240
                     /locus_tag="CNF00200"
                     /db_xref="GeneID:3258017"
     mRNA            join(64647..65604,65669..65966,66030..66240)
                     /locus_tag="CNF00200"
                     /product="expressed protein"
                     /transcript_id="XM_571447.2"
                     /db_xref="GeneID:3258017"
     CDS             join(64673..65604,65669..65921)
                     /locus_tag="CNF00200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571447.1"
                     /db_xref="GeneID:3258017"
                     /translation="MPRTRSQTVALKNKAASLDRLPIELQTKIITHLKDIDPKSLLVL
                     ARVSKSLYYQCIDHIYYEVKLKRSNRKQFFRGLNSGRFLREGEFKRWYKKPHQQPLFG
                     QSVILRRLLLLDKVHRIIIADGPALEKTFDIAISAAIKHSFVSYSLYQDIEPQPLFRN
                     LGQGKKGLPCMIWKEGAMDHFDDLIQDSYLEDWEYAELHDESASEGSNNLARERLDDL
                     YDLSLCQPGTPFCLHLPDSWCHDSQKFLDGIFKRNALKTLAMHNVKLCDWRFGKSSGY
                     YTPDEMHLFLLAQGLPKDTYERPLPHREALGKFLSHFSPEDTRCKIHIYNYARKGAES
                     EEDVKRKVLMVCRREYARKREFSLLYGNEEADEEPSDGCPFRGELVIHFEKAVCKFCG
                     CH"
     gene            66513..67821
                     /locus_tag="CNF00210"
                     /db_xref="GeneID:3258224"
     mRNA            join(66513..66732,66780..66848,66901..67036,67101..67619,
                     67675..67821)
                     /locus_tag="CNF00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657316.1"
                     /db_xref="GeneID:3258224"
     CDS             join(66699..66732,66780..66848,66901..67036,67101..67619,
                     67675..67783)
                     /locus_tag="CNF00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513014.1"
                     /db_xref="GeneID:3258224"
                     /translation="MDMSGMDGMDDMSSTSSNMSMSMKMYFHGTIGGDMLWFASWMPS
                     SAGATVGVCIGLFILAIFERYLVAFRRACDAAWRRGQVGYVRPCSNGPLISSSGKSTS
                     LPPPVLFNRRSSTKKEKDVYNPLTPSDYALESNQDGSVEPATPYTPFIHALRESQEGS
                     SAPSYAHSQQGQAQAQEPGMGCNPCAEGRVAEIERCKEKAVETGLAHSHLPKAVRRSL
                     DPGREGRWSRPFRLAVDVPRGLLQALQTLIHYLLMLVVMTFNIWWMISVVIGSGVGEM
                     LFGRFGSSHVGH"
     gene            complement(67790..69274)
                     /locus_tag="CNF00220"
                     /db_xref="GeneID:3258313"
     mRNA            complement(join(67790..69036,69111..69274))
                     /locus_tag="CNF00220"
                     /product="expressed protein"
                     /transcript_id="XM_571292.1"
                     /db_xref="GeneID:3258313"
     CDS             complement(67947..68984)
                     /locus_tag="CNF00220"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571292.1"
                     /db_xref="GeneID:3258313"
                     /translation="MSQAFTTSEEPVFETLYPVAHLILHQLSLIAPLKTLTLSKYYYK
                     HTIPTLYHTVTVCHKLFHSLSQHSTVEAWLRTAEALSRTRILLIRSMESAVVSTHFNI
                     SSCPDPIAALEWPVKNLFSNVKRLEYDWEVVNSQFLNRYSVCYTSQNVDNTLIRLLPS
                     SFQETVAHVLFDGRARYHYVLDELRRIAECRPQMTTVIFHTPSNNQVPLRSAIMQLPF
                     IWPYSRIRIIISLINAPYDTKCPRWEDEDLMSLVCGVWKSAVALDNVVYKAKTSASIA
                     LGPVVNKMEIYMSQAEEAEALFARLYSESPEPPRFMSRIENVTWNDFAEEYIDFVELS
                     EDVLGIYGLLE"
     gene            complement(69743..75698)
                     /locus_tag="CNF00230"
                     /db_xref="GeneID:3258026"
     mRNA            complement(join(69743..70096,70156..72626,72679..72796,
                     72850..73673,73850..75216,75291..75698))
                     /locus_tag="CNF00230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657317.1"
                     /db_xref="GeneID:3258026"
     CDS             complement(join(69974..70096,70156..72626,72679..72796,
                     72850..73673,73850..75216,75291..75460))
                     /locus_tag="CNF00230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513016.1"
                     /db_xref="GeneID:3258026"
                     /translation="MIWPVNIPQMVNGNDSGSPSSSIEEVSQEEEVGIYGKETIMISF
                     ETDSGVCSGSEEGSREFATSSQASLTTQSSDSSLIFIFPPTHPSHTSNTPKKFQPPFP
                     SSVHEPPPTFRHPPLPLTAIGHRHRQKHRLSVSYLDFTPSIETAQALHASASYSSNDP
                     TTTALSAQALIAQAKRARTKSIRKRRSSAPSLSSPSTVRRSNTSSSIISTISMPRASP
                     FGPCESAINNGESPPASPHTPVSPTRSNGREPGSPWRGLRRALSLSSRESSNAKRGSS
                     RTSVLAKDEACKVSGGDRRDGEGQSLGSIVQRPQDSGERSFIGPSSPTMSTAEEWGDL
                     GTLPRFPRPPSNGNRRRKSVRGLAGLGPPLLLLPKEGGEGDSSSSDSEGEEGRKTYAR
                     SPSRGLPSTPPSADSQSSQESCLPPQTPITDTSPSLPSSLLPPILLTPNTPTAPNTHT
                     PPSANKKLLKLLSPETVSAVVDKHHASQRTIGDFQSTSLPAVENNSDPQVKLLHSAMP
                     RGWQGSSPIPLPPSSQPSQHRLQPSVPYSTRTFPSSFSSQNDTADTIAISPPQSYANS
                     SIASPNSRSTAASGSSGSSVCSYTTVGSSLPSHQQWHIAERSAIATVVEEDNTVIEEI
                     RDEFITKPLDVKRRSPLTQSASTNSVNRSKPTSNYFSRERSNSQHETINSAHSKQSSQ
                     SSHPFASFSQPASLPTAKETFLSPQAPRRLERFDSSVINSSRSSPNLAGTYKMTQSVQ
                     QLALVSTEDDRDGDVTCPVCVEPMGFTYRLPGEKPPIVPECGHALHEECFTHVYGEVP
                     PEGSRKVLGVCGVCRQPMKLADGAAKKDKLSAIMGQSGKSSRPAPSIRGTSGRGITPL
                     TPPDPTADDPIDNSRPSVSNGQLPKVIVPTLSIKSEFSTISKNRKGKQMITAMVIIDV
                     PPAPDRGKYPAATRQLDEGRFSPQPSPSPTSARELATSPSLREFNTSDPFAHVLQDLK
                     NRVVDLKQLSVDSLGQLRLFDILTVRKGSLTRDFQVYLFQDALVCAAEEKKSGFRQMF
                     SSSNSMRSDHSGHSSKSVLKLKGRIYLRHVSRVLDQSTPSELNLVILMEDKSLESFIL
                     TFKDRGSHETWRATINRLIEDNGGLKERAGKILGSGAPRSTSSGLAISFSDLTSPTSA
                     SYTITPATSNFTPVSPKDQSSGDLAYNVPLAPIHTPIDLVLVLSLPAFTPGQSIPLKI
                     KLMRSSLEFLLALLGPKDRISLVSCEMGVNGTLRKTPFLSTTRYESRKRLETFVETLG
                     TGKLEKDEFEVSVGSDEKLDVVTAMNVGLDVVLQRKAKNPISSMVIVSDTTDIIKRTQ
                     MDLVAARLDAANILVHAVGYGRSHDPSPLWIVTNHTLGTYSFVKEWYHLRETLAGIVG
                     GMMNVAMDNAKVHVSCVENDFRIMRVQGTTQAVVTGTGKDIDIELQVLRYGDSREILI
                     ELELENRDESQKYSDEGSNESGDGSDPASQRGGSPRRAPSSNLGIDMLSVAHSSYDEA
                     IDEVPICEVDLAFRDPAAGRSVFRLPHPQLLTVAVIPRTPSSTSPADPAILRRRMELL
                     ASDMLTRALLIASRKNYVQADRILRETKRIIETMQDNMRQHVSENASSRRGRSKREVQ
                     AIMAVEGLEGPLHDLEALLDGMEEQKGVFDRDCRNFTAQQSGVLRSQRAWTTRSLSER
                     TYCATGVQNIIQMSAEWQSRFQ"
     gene            79707..81374
                     /locus_tag="CNF00240"
                     /db_xref="GeneID:3258105"
     mRNA            join(79707..79878,79936..80128,80180..81374)
                     /locus_tag="CNF00240"
                     /product="expressed protein"
                     /transcript_id="XM_024657318.1"
                     /db_xref="GeneID:3258105"
     CDS             80289..81065
                     /locus_tag="CNF00240"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513017.1"
                     /db_xref="GeneID:3258105"
                     /translation="MSFNLVPSPPRLSGPSSSLDHTSRHDDNFSFSEFPEFPDFASRS
                     KSGERRESGSSSCDSWSLGSSPTDECDAERSPERKGKRVLSDGVEDGKAEEDGDGDEQ
                     GIHSSPLLNSASPSLRPRPTLSRFTSDPGRSSVSHSQSHSHSHTFAPVPPQRAVRPRG
                     LTPLTPLTPSIPSSSHPTSSGISPASSHPHRPSGLPKSQPLSRALFARMADTPHSGMS
                     LGIAANGSKGKGKGQKIIVPTKSFRTSFTLDMTASELARR"
     gene            81695..84122
                     /locus_tag="CNF00250"
                     /db_xref="GeneID:3258506"
     mRNA            join(81695..82211,82263..82347,82418..82476,82551..82806,
                     82869..82915,82976..83046,83123..83221,83273..83513,
                     83567..83698,83763..83902,83969..84122)
                     /locus_tag="CNF00250"
                     /product="expressed protein"
                     /transcript_id="XM_024657319.1"
                     /db_xref="GeneID:3258506"
     CDS             join(83430..83513,83567..83698,83763..83902,83969..84068)
                     /locus_tag="CNF00250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513083.1"
                     /db_xref="GeneID:3258506"
                     /translation="MRMYAAKSACRDDGNYRASFLRSELVARVLQVLNLGPASLKKGN
                     GHYGAPTTAQRSKATASSISTIMYASSLVHFVLSVAPKIDNVDIALHDTVYHSGIFFF
                     RSLKEVEQQAIIDFYDGHARDDRGEGDGRISSMWQDLWRWRRSQQRRGE"
     STS             84140..84931
                     /standard_name="Hind23"
                     /db_xref="UniSTS:470828"
     STS             84744..85029
                     /standard_name="AAC2"
                     /db_xref="UniSTS:470830"
     gene            85305..88456
                     /locus_tag="CNF00260"
                     /db_xref="GeneID:3258354"
     mRNA            join(85305..85590,85637..86285,86335..86731,86794..87029,
                     87079..87138,87189..88456)
                     /locus_tag="CNF00260"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_571449.2"
                     /db_xref="GeneID:3258354"
     CDS             join(85457..85590,85637..86285,86335..86731,86794..87029,
                     87079..87138,87189..88208)
                     /locus_tag="CNF00260"
                     /codon_start=1
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /protein_id="XP_571449.1"
                     /db_xref="GeneID:3258354"
                     /translation="MPRSLSRSVSPRPRSPSLSPPRPDSRSSRGRSLTPDDIPAYKRK
                     RSPSPNPRDRPASPPTRRRRSQSPYRNSNRAEIDRPNVKDIDPNRRRARENALLEKQI
                     NMALADDGDADGTVATTKKSADEIARAEFAKLLGSRSGGAYIPPAKLRAMQAEAAKDK
                     TSAEYQRISWDALKKSINGLINKVNISNIKHIVPELFGENLIRGRGLFARSVMRAQAS
                     SLPFTPVFAALVAIINTKLPQVGELVLIRLISQFRRAYKRNDKTVCHATSTFIAHLCN
                     QYVAHEIVALQILLLCLDRPTDDSIEVAVGFMREVGQFLSENSPKANNTVFERFRAVL
                     HEGQISKRCQYMIEVLFQVRKDKYKDNPAVPEGLDLVEEEEQITHRVTLDDELQVQES
                     LNLFKADPNFVQNEERYNAIKREILGDSDDESGTESGSEYSESEDDEDEDVAPEKAGI
                     QDMTETNLINLRRTIYLTIMNSLNFEEAVHKLMKVNIPEGREIELCNMVIECCSQERT
                     YSNFYGLIGERFCKLHRIWTDAFQEAFQKYYDTIHRYETNKLRNIGRFFGHLLASDGI
                     SWAVLHVVHMNEEETTSSSRIFVKIVLQEMVEEMGINRVAERFRIPDLKPAFAGMFPM
                     DNPKNARFSINYFTSIGMGKVTEDMREYLQNAPKLLAAQQAALAAAESSDSDTDSSSD
                     ISSSSDSDSDTDSDASSYSRRSRRRRYSSDSRSPPPRRRRYSSDSRSPSPPPRRRQYS
                     DEPRSPSPPPRRRRYSDDSRSPSPPPRRRYSGDSRSPSPPPRRRYADDSRSPSPPPHR
                     RRYSDDSRSPSPPPRRRRYSDNSRSPSPPPRRR"
     gene            88724..90732
                     /locus_tag="CNF00270"
                     /db_xref="GeneID:3258023"
     mRNA            join(88724..88868,88943..89237,89297..89674,89720..90732)
                     /locus_tag="CNF00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_571451.1"
                     /db_xref="GeneID:3258023"
     CDS             join(88746..88868,88943..89237,89297..89674,89720..90627)
                     /locus_tag="CNF00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571451.1"
                     /db_xref="GeneID:3258023"
                     /translation="MPLTASQQQALSQLWAVTSSATDAARERDERLLRENGWDVQTTV
                     EQIFSMADDANLSSPGDAGPSTSRNRLGAHDPDQDPLLPPIPPGARRLSGTGARRPRP
                     KPRAAPGTTGIGIGIWDIIVWPVGMLFSIVGGVWYFIVRTFVPLSFLPHIPSFLLPPS
                     PSPPSIPRPPQDPTTAHLAFLQSLSSLTGLPPSELPEIYVGPYREFLTHIRKELLVGL
                     IVLVSEEHEDDESFKKGSLADKDVVQALRSEGVIVWAADISSREGYQASQTLLATTYP
                     SLTFLSLLPSTSSLPTTSSSPKLTLLNTLSGPPSTITSPTSIITTLQTAVLPRARPFL
                     NRLKSERLAVEEARYVRAEQDRAFRASEAKDRERMRVAKQKEEAERIKKEREEKERRE
                     KEAIKEKRKVWRRYARKHLLSPSNGPIRVALRTPLSSARHLHHFTPSSSTLPLYIFAE
                     TLLIPASAKKEDDPDTPPEGYDPLAYLSSSSSDTNANGTRISDIIGEEEVGDWPFTLV
                     TAYPRQTIPCVLAEGEKVWETVQKAGGAMFLEKREGYTFGLSEEEEEGESEEEIVSDS
                     D"
     gene            complement(90375..94199)
                     /locus_tag="CNF00280"
                     /db_xref="GeneID:3258179"
     mRNA            complement(join(90375..92619,92690..92841,92892..92989,
                     93045..93792,93857..94199))
                     /locus_tag="CNF00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657320.1"
                     /db_xref="GeneID:3258179"
     CDS             complement(join(90873..92619,92690..92841,92892..92989,
                     93045..93147))
                     /locus_tag="CNF00280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513066.1"
                     /db_xref="GeneID:3258179"
                     /translation="MQTSLSEAGSLGNDFNKTLAVTTSKGASITFSGMGSAIYLYGTI
                     GPDYGLAQLSLNGNVVAPSMNLSSPWLMAYELLWFRTDLDSSQMTNVTMTNLDESKMA
                     LDFIILTANDNALSELSSDSSSSFISSVGGKLILYLAMPLSIIFLISVFSFWLIRRRR
                     RLRRRTRPRLQESILSLHASPSPIKGRSEKQWYLPSPRRPRLTPSGTSDRSSLTLSVE
                     DVFISYEEAMGKELSNKWYNSPTTPWPSSQRGRTTERSVFASAFGLPTVTDEITWSEG
                     SQSPESPQRSQRSGRSGRSGYSDRSGSISRFGTSNGRRERDEGMMSVLEENDGATTTY
                     TDSRRTTALPAYSLEETFMTHYTPSDAENSITHGTPIHVHSANTSPSSRYPTVEQEKV
                     TQFHTFRDVSSSPTASVPGHSGNTTSSFRFQRLSSDEPPPSPMTKRASTIAPSDIISI
                     FGVPPASERRMSMMTDHTSNSACHPWLSLPGCAAGEFPPPLPTISTYTGFNLASTITS
                     SGSGRPTPTINTDMERKAFGLPYMTPQSVSGLGSGARSSRILTPPKKVPPSAWPTDTP
                     LSHCSFDTNPISTSTSYPTSTFTSDYTSISTSYGTPKVIHFTTTHANLIPWAPIPYTI
                     PVCESPLAGVAGMGVDMNGGGGLGWHKRSLSNWSHLTARSAARPDSDVMPFESFIYSL
                     NGAAMEEAERQRASEGA"
     gene            95719..99280
                     /locus_tag="CNF00290"
                     /db_xref="GeneID:3258022"
     mRNA            join(95719..96362,96425..97530,97667..99280)
                     /locus_tag="CNF00290"
                     /product="nucleoside-diphosphatase, putative"
                     /transcript_id="XM_571453.2"
                     /db_xref="GeneID:3258022"
     CDS             join(96041..96362,96425..97530,97667..99172)
                     /locus_tag="CNF00290"
                     /codon_start=1
                     /product="nucleoside-diphosphatase, putative"
                     /protein_id="XP_571453.1"
                     /db_xref="GeneID:3258022"
                     /translation="MAPSVTPLTTHYALVIDAGSSGSRLQIYSWRDPDLERAEILQDV
                     KNIERQGSSSSSRGGGRWWWDGEDGWKGKGKGKGKEMEEMALRRLVRVGKGVEGDDWM
                     KRVEPGISTVDPDNIPEYLAPLLTHALQHIPPSVHSSTPIYVLATAGMRLLPSQQRDA
                     ILQATCDTLRNDYPFLVPGPTEEGPCGENVRVIDGEEEGIWGWVAVNYLMDGFGHAPS
                     PSSISNPGTSSSSSTNLLPLAPLASAPPDSSSSSITPVDIAHHSPTFGFLDMGGASTQ
                     LAFSPSASELLTSGFPLDKLRTVSLRLLSGEQVDWPVFVASWLGFGTNRARERYMTSL
                     YEEWAAAHPSPSAQDLATPIPDPCLPKNLTITPSLSSQPPLIGTGSFPECLTSLHPLL
                     EHSTPCPTSHCLFGGQPTPHIDFERHDQRGFIGISEYWYTMQHVLGVGGVWDWGEWEK
                     GMKEFCGKEWGLIKGEMENGDWEDVNMDSTRLEMQCFKGAWISNVLHEGIGIPRLVDV
                     GGNDTLTGGSLGDTNAEAERRAREKGLFEGSGQEQGKHHFQSMDQVGETAISWTLGKV
                     VIEASKAVQPRSQEMEGWWMHHLNLGSMRLPLSLPIPKHLEGKLEDLGLSAVWVYAVV
                     AFFLVGMLFSRSNRRRGVGSSGSGMGRRRKPSLSSPPLPARPWFTFPSFFSAPPADPS
                     LSIEDGPDSSPTSSTSSASFSGSGTGGASGKSRIVPGRLRLWSLRISNTINKYLPPSL
                     PFSLGNSNPRQRGGTRELWTGIGLGLPRARHNSMPMIGMGLNTSPGAGLLSPSGGGGY
                     SQPGSPRPVSTPFFSSVAAPGIGGLNMGVGSLTPETALTGISSATSVSPSPSLASTSS
                     PPPPRSSLKSGKSGRPFKSRQNSNNLHPHHGPHGLHSVGEGIGLGGGGAGWNDPPLAM
                     LSGPSSGPGPSGSGAADDGGVLTPTANGGLSNGALSRNSSRANLSELGLAQRSMSRTG
                     TPGFD"
     gene            complement(99248..104500)
                     /locus_tag="CNF00300"
                     /db_xref="GeneID:3258382"
     mRNA            complement(join(99248..99525,99576..99735,99789..99894,
                     99947..100051,100100..100199,100251..101758,
                     101820..102812,103038..103244,103302..104006,
                     104055..104374,104422..104500))
                     /locus_tag="CNF00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657321.1"
                     /db_xref="GeneID:3258382"
     CDS             complement(join(99384..99525,99576..99735,99789..99894,
                     99947..100051,100100..100199,100251..101758,
                     101820..102812,103038..103244,103302..104006,
                     104055..104374,104422..104443))
                     /locus_tag="CNF00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513127.1"
                     /db_xref="GeneID:3258382"
                     /translation="MFGPYTSRPQSLTEPQLQSRHPYAAMPSLPSLPFAALGAGHQLG
                     KDPATASELMKNQRPESEAFSRGAGAEGGMKRPYFFGNTGVDTPGGMSGTSPGMGTFG
                     LEGKEVGSKMPTALGSSNKTPIPTQAPNPVGLPESPRQGAPQPKVDSDQEVQYHIHKP
                     HHKFPFSHAEAEAKQREGMEDARAAALAQLEAAQHIVDAKLESEMMEILGMMSGARLD
                     GVNAAGGPGGNAPKGPRQTFDTNTSGPSFGHILHQDGVPISACPSMRVAPEGFASGRP
                     LTELSEVFRIPFGVPIGMSIPRPLMVMRDSAGAPGDLGLGMPALLNIIQGHGEGSPLR
                     RKQEDRSAYVETVEDEEEVLSPIRTDVRTEVPSKTSSPAEGAAAGFGSTAQSVPQGDV
                     FPAKTESNVLGDPSTAKSNAGRIGFTAHSPSQPTQPPTEQLMASTAHPLKTSTHHAHH
                     SAAASSKVGSKTPGAKSKVPSKAASKAATTAASKLPTALKAPKARVPSVGSQATTVRL
                     PPATYTKGERAMSHAHVYPQSQARSQVPFPTQSQCEYTAVPEAPSPGSQAQSPPQLDQ
                     KTIYSQVRKKNTPTIIPGQFRAQEYFPSTQSANDAVEHHHELEKMQGATGEGSIVASQ
                     HGSVAPTTMSNVKRIVDASRYHDETLCQLLDAARLNLIGEEAKKALQRAARARVIELR
                     ELRAAGELEVGLLSPAVVLPSHAEETPKRAKRSKSKEKGRTVSGKSANSAKSEKGAAK
                     QEPPIWAQDIMNRLSMFDHRFAALETQKDTRGPHKSQVSRDMRSKLIEELIFNDLHSS
                     IFTNGINTPHGSTNSVPFGQSVAAPMPAAPLTASEDISFSLGQKQRAASDMPSHYSHK
                     PLSQHVPGIATCTQYGGTQTPVQYAPSQVPATQYVPTQPPPTQYSQQAGAASQVRSVG
                     PLTERRPSAQGDLIWGSEVELPHPNESISFPHIAGPTINVLPPTESNMGNNKASTRAS
                     PRSRTFSASKSHPSTTVGGRMAPDDGRIDVITEQPLSVGAMPDPREKELPPQPSESVK
                     NQPPDPTLFDNMTAAQRTQPGTVTGSAIPKNMAQSAYSYGPPDQYPPSAPRLRTANTQ
                     VQSAADVGVNAGIVTGSIYGTAIEPPTTSFFPGQTMRHIAVPGTTVPPAPVSPMHSDP
                     VPPTSQPFSEPLSTIHMRLHETKSSPFTATAPGKSTSAPRDCIHVVDPLFSPMAGWKP
                     WDMLTQRLYSWALIMEEKSFVRALEDISLGRQVEAFPLSVFLMLAYKRWVRRNLSETT
                     AAPCDKLFVPPNLAVAINIAVHSRRYHEAKEILLELWDCLGMKEHPRIIVALAPLGDE
                     TDQWAAHRYDLSSKHLTTYRVSHLAEIRTDGRSFWWWEAIRQAWPELQIPEMQELEKR
                     GGQRIINEHRPPEYKHDNSLYAANISRNLLLGYRPERQHDLVKQREIIWAEVKRLLHK
                     KRTGRLVVEPDSPEHLYDT"
     gene            106954..109592
                     /locus_tag="CNF00310"
                     /db_xref="GeneID:3258233"
     mRNA            join(106954..107371,107454..107693,107760..107855,
                     107926..108282,108362..108533,108610..108746,
                     108833..109085,109165..109592)
                     /locus_tag="CNF00310"
                     /product="high-affinity methionine permease, putative"
                     /transcript_id="XM_024657322.1"
                     /db_xref="GeneID:3258233"
     CDS             join(107062..107371,107454..107693,107760..107855,
                     107926..108282,108362..108533,108610..108746,
                     108833..109085,109165..109414)
                     /locus_tag="CNF00310"
                     /codon_start=1
                     /product="high-affinity methionine permease, putative"
                     /protein_id="XP_024513072.1"
                     /db_xref="GeneID:3258233"
                     /translation="MSGGSSLDEKTSSLDHGYKASTLAIVNSSSAAEKAGRPHFFIEE
                     SSSHGAFVGEQGGNGAQVTIQDVWGAPVESKNPLGYSVGWWSALFLNITMLIGTGIFS
                     FPSSLLKSLGSIGLTLIYWPIGLLISLAGISVYLEFTSYFPSRSGAEVVYLEQAYRKP
                     RFFFPVAFAVQTVILSFVSSNAIVVAEYIFKMTDHTPSDWESKGVGIAALTIIILPVF
                     FSTNISLRLSNILGIAKIITLLIIIIPGFVALGGHFKVVPDPTANFHNAFEGTTNNGY
                     NLSNALVNIIFSYGGYTNSFNVANEIKNPIRTIKYTANTAVIFVAVLYMLTNIAYFAV
                     LTQEEIKGSTQVTATLFWEKLWGSKVSKGLTILPVLSASSNILNTIVGHSRMIREIGR
                     QGVLPYPKFWVTTWPIGTPTGALFAIWFVSLIVIVVVPAGNAFNFIVALQNYPSSFFL
                     VLMTLGLFIVRRDRRRLSLPRPEYRSWTIVVLFFLAANTFLIIMPWVPPTGGVNNSSF
                     GFFYAASSLTGLGIVFLCGFYYVLWSKLLPKWKGYKLRQTVITLADGALTHKMVKVKN
                     EDVDAWDVTHDPSGRLLNEDEDLVEINEEHASLRDLKE"
     gene            complement(109676..111745)
                     /locus_tag="CNF00320"
                     /db_xref="GeneID:3258321"
     mRNA            complement(join(109676..109867,109927..110016,
                     110066..110612,110661..111493,111540..111745))
                     /locus_tag="CNF00320"
                     /product="nicotinate-nucleotide adenylyltransferase,
                     putative"
                     /transcript_id="XM_024657323.1"
                     /db_xref="GeneID:3258321"
     CDS             complement(join(109777..109867,109927..110016,
                     110066..110612,110661..111493,111540..111613))
                     /locus_tag="CNF00320"
                     /codon_start=1
                     /product="nicotinate-nucleotide adenylyltransferase,
                     putative"
                     /protein_id="XP_024513019.1"
                     /db_xref="GeneID:3258321"
                     /translation="MASNGFKSPAPVLPAMGLHSFHNDSPPFGGTATSEMPDVPSLSL
                     EPQQHSRPVLSTNPSARQQGPARTASNTSQTISNPEPVSSGTRETPSKAISSLKSIQP
                     PTPPVPITSDDELSSTRSRRLISGYLFGNPPSPTCTGPETSPVTAASHTSTAEESRDP
                     MMSRKFSPTLEKARDVENRMAEELDSPPLTDDSQIDPRDALEMDSTPPPPSLESPKPA
                     NSDLVSMNEPLSSDVGAGEAKVKGRKSERARKRETGYDALEGRNDGEADLDLNAPQAE
                     GGGSGAYLAGKAEYRFPRHRLRTKMHDENKIPLVIVACGSFSPPTYLHLRMFEMAKDE
                     IVESQTYEIMAGYYSPVSSYYKKSGLAPAPHRVRMCELAVEHTSTWLMVDPWEAGQPE
                     YQRTAFVLDHFDEMLNGGEHGKGGLVMRDGTRRRYKIMLLAGGDLIESFGEPGVWSEP
                     DLHVILGRFGCLIVERAGSDVWAFLLSHDILYHHRRNVVVIKQLIYNDISSTKVRLFV
                     RRGMSIKYLLPNSVIQYIQDNKLYHGSDPKGMIGKH"
     gene            complement(112687..115710)
                     /locus_tag="CNF00330"
                     /db_xref="GeneID:3258337"
     mRNA            complement(join(112687..113004,113068..113123,
                     113175..113317,113384..113880,113930..113975,
                     114038..114332,114386..114453,114504..114573,
                     114644..114707,115140..115315,115378..115454,
                     115508..115710))
                     /locus_tag="CNF00330"
                     /product="gamma-aminobutyric acid transporter, putative"
                     /transcript_id="XM_571300.1"
                     /db_xref="GeneID:3258337"
     mRNA            complement(join(112687..113004,113068..113123,
                     113175..113317,113384..113880,113930..113975,
                     114038..114332,114386..114453,114504..114573,
                     114644..115315,115378..115454,115508..115710))
                     /locus_tag="CNF00330"
                     /product="gamma-aminobutyric acid transporter, putative"
                     /transcript_id="XM_571301.2"
                     /db_xref="GeneID:3258337"
     CDS             complement(join(112851..113004,113068..113123,
                     113175..113317,113384..113880,113930..113975,
                     114038..114332,114386..114453,114504..114573,
                     114644..114805))
                     /locus_tag="CNF00330"
                     /codon_start=1
                     /product="gamma-aminobutyric acid transporter, putative"
                     /protein_id="XP_571301.1"
                     /db_xref="GeneID:3258337"
                     /translation="MIRGERGARREGRGCCILFHLTKVGTVLIGGARSSCLIAWILMT
                     LTAAVLAEICSALPLSGSIYIWAAEAAGPKYARLTGYIVAWWACTAWMTFCASVCQTS
                     ANYLLSLLTIYEIPFPGADGLSTSNVKFRAVQWALSEGILGLCIAFNYLPQKSYSWVF
                     KGSMCLMAVDLILNLTWLPVRVHMTYGFRSAKEVFTSQYNGTGAPAGWNWMLCFLVAA
                     ASITGFDASGHISEETRSASTKSARGILTSAFFSGLFAFVTSVLFLFCTPPLDVWHEF
                     TAQQPFVQVYALALGRGGAVFMACLAVVGLMLNTSISIVASSRLVFAVARDGVLPLSG
                     WVGKVTEDGRPKNAVTVMTVFGALILCTILPSTVAFTSLVSAAGTPTIAAYALISFCR
                     LFITPNEFKNSKFSLGMWAKPFYVIAFVWNCIVFATYISPFYFPVDASGFNYSVVIFG
                     AVTIFGFLSWLLTKPETWLYQGRIQKMKEEAVVEMMGDDKDGQGKV"
     CDS             complement(join(112851..113004,113068..113123,
                     113175..113317,113384..113880,113930..113975,
                     114038..114332,114386..114453,114504..114573,
                     114644..114679))
                     /locus_tag="CNF00330"
                     /codon_start=1
                     /product="gamma-aminobutyric acid transporter, putative"
                     /protein_id="XP_571300.1"
                     /db_xref="GeneID:3258337"
                     /translation="MTLTAAVLAEICSALPLSGSIYIWAAEAAGPKYARLTGYIVAWW
                     ACTAWMTFCASVCQTSANYLLSLLTIYEIPFPGADGLSTSNVKFRAVQWALSEGILGL
                     CIAFNYLPQKSYSWVFKGSMCLMAVDLILNLTWLPVRVHMTYGFRSAKEVFTSQYNGT
                     GAPAGWNWMLCFLVAAASITGFDASGHISEETRSASTKSARGILTSAFFSGLFAFVTS
                     VLFLFCTPPLDVWHEFTAQQPFVQVYALALGRGGAVFMACLAVVGLMLNTSISIVASS
                     RLVFAVARDGVLPLSGWVGKVTEDGRPKNAVTVMTVFGALILCTILPSTVAFTSLVSA
                     AGTPTIAAYALISFCRLFITPNEFKNSKFSLGMWAKPFYVIAFVWNCIVFATYISPFY
                     FPVDASGFNYSVVIFGAVTIFGFLSWLLTKPETWLYQGRIQKMKEEAVVEMMGDDKDG
                     QGKV"
     gene            complement(116036..120624)
                     /locus_tag="CNF00340"
                     /db_xref="GeneID:3258248"
     mRNA            complement(join(116036..116500,116556..117384,
                     117436..117715,117775..118026,118084..118230,
                     118292..118559,118615..118760,118812..119110,
                     119167..119362,119409..119525,119575..119745,
                     119799..119922,119974..120172,120218..120624))
                     /locus_tag="CNF00340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657324.1"
                     /db_xref="GeneID:3258248"
     CDS             complement(join(116723..117384,117436..117715,
                     117775..118026,118084..118230,118292..118559,
                     118615..118760,118812..119110,119167..119362,
                     119409..119525,119575..119745,119799..119922,
                     119974..120172,120218..120581))
                     /locus_tag="CNF00340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513076.1"
                     /db_xref="GeneID:3258248"
                     /translation="MELPDSPPPLDAPSPPHFLDAPQDRWNVFYPAVQTLVNALGGYE
                     EVESPPDSGIFETVYRPGDSVLGVLKDLKKLWRKDDEDDERTVARCMYRAELMKELVA
                     IVVECAERGEWGRKVALVACDLIAALTWPIDVAQELKEIEDEGPVVTDYASLLRAQLE
                     YKALFLKTTKPLKSILSLMVPCLAKPRKDEKDSRIISLGLHVVRNLLAIKDAVAEGTA
                     TGEKEEFAHLQSDLITQLDSLTYLQLFLTLASCADKTDLNPFNVIVLDILHLIFRGIK
                     PSELVQDQKRVPIDSLARLLEKEKKQKALNSRVGSTRHSRFGTTITVKTAEQRVVLHR
                     QTAIIENPGKILDMTKRKKAVVAKRMDDLTVFVNLSSDAMVILQSFSKSFLEICYNTF
                     IESILRDIRMERTKIRPSDNIRVFYLSSFFIEYLLLLRHKLLEKGGSRRLEELPLGLV
                     AQIAEMDSVKWLFARLRICWDDKPKAWTELQACIECFTQILLLIDDMSTSTNEEDVEV
                     AEILQHQLYYNYDILDSALAVVREYKNQSIAYLDSIIHFAYVLLRMLEKYSKTKAFMF
                     IRKRKNTHKKRKERQAASQANADREQRKIPEEYGDEGEEAFAPDEDAPSYAEHAFTFQ
                     SFEKRFAQEAVVNTLLTYLERFLEFDGPEPMKRVVGLMHRQVIKAHAEGLYFKVSTLI
                     IFRRILDKQHVLPAAPSSRDLITLITYILRKFFKHVEKEPFTLVEALSSKSRGKWKTV
                     GGGSDDDDDEMAGQRGRIKEKMGPVELQFIKKHKFSWSQQMSIAFAIIWGDGHGYLIK
                     WIVEVLEQVLAAKQEIVLTTDGGINGDEDEEDEDGNARVRRFGRPSDEAISKFTQFDL
                     QPEESEQITAVTSNPHFRLMLKLLSFDLPPPPMELDFEEDVSSEELALAREKSDSAWF
                     LPANVLPSDIEASIGALKQYMEEPPTLDDDPKKLLRRKARATRRRRRSPSVESYDSET
                     GEVRPGHQHKKNPRQKRAKKAVETQNYKSAAFIEDSDDEDPEATRRFFENEERLRREM
                     DELAAQGGHPMMERGVKRKRGKKNGKGAISDTPPPSQRGNDRET"
     gene            122079..124488
                     /locus_tag="CNF00350"
                     /db_xref="GeneID:3258153"
     mRNA            join(122079..122348,122526..122607,122660..122780,
                     122835..122932,122982..123278,123334..123561,
                     123618..123743,123799..124488)
                     /locus_tag="CNF00350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571303.1"
                     /db_xref="GeneID:3258153"
     CDS             join(122146..122348,122526..122607,122660..122780,
                     122835..122932,122982..123278,123334..123561,
                     123618..123743,123799..123972)
                     /locus_tag="CNF00350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571303.1"
                     /db_xref="GeneID:3258153"
                     /translation="MLSETNERQSLLPSETSTIRAVSDSEENPNNVSAGYGAAESQAP
                     PKEGKLHHKKFKEIWALLIGLAFAVFCSALGATIVANLTIEIGSYFHAGALSSWLGTA
                     YLLGLTAMTPLYGRLAQVMGRKGVMILALTFFLNGTFLCAIAPTMYFMLFARAVAGAG
                     CGGLLTVTAIIISDLVSLADRGLYQGGINLLFGAGSASGAVLGGYVYDRFGWRAAFWV
                     QVPPVTFTFIMVLWKLDVEREKGEDDGGKTAWEKFKHIDWLGSFVLMVGISSFSIFSS
                     LLTSSDYSFRHPLPLTLLITSSIAFPLFFYIEKRAHQPILPLSLLTRAQPSIVLAGFM
                     LTTATNFSRLYMQPVYLHVTRGLNGSETGLLLIPSSIVGSFSSLYAGWHMRYYKEYKW
                     FQVVMSLIPWLQAISIMVGWGPETSIHRLWSEMALGALGGGAAITSLLSK"
     gene            124729..127324
                     /locus_tag="CNF00360"
                     /db_xref="GeneID:3258503"
     mRNA            join(124729..124938,124990..125017,125077..125212,
                     125283..125356,125406..126188,126237..126544,
                     126603..127324)
                     /locus_tag="CNF00360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657325.1"
                     /db_xref="GeneID:3258503"
     CDS             join(124855..124938,124990..125017,125077..125212,
                     125283..125356,125406..126188,126237..126544,
                     126603..126905)
                     /locus_tag="CNF00360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513154.1"
                     /db_xref="GeneID:3258503"
                     /translation="MGSSMPPPHVRAWYSYAFAAEVFSACALAIFLPITLEQMAREVG
                     YYAPELTETCVINDSSSDVTGRLCKARILGVWIDTASFSMYVKSIAVACQAICIISIG
                     PLADIAYWRKRLLLTFAYSGSLSGILFLLFPPLPYAWTPIMAAILNIVGNATYSTSIV
                     CSNAFLPGLAKEDVDVQKAWEEATSEGLQDGLRDVHEDTDEENTGSVSREDEATHLLP
                     DRLIPAVCAISTQDLALSDPLAKLIEPSNAKKHYESRLSLTTSRLSSTGTAIGFFSGV
                     SVLTLLLIPVTALGGSTFSMRLAIGLSGVWWALFTVPTCIGLPGGAPGHGSDFSASQV
                     KKAWVKIGKMVAPKQIHQLPNLYIFLLAWIFLSDGFHTTTYAAILYASSVLSMSAPKI
                     ILVGILVQLAAVVSSVLVPRVQRRLSTTSSKPVTNYKVLLAGVVAAAFIPVYTCAGLV
                     LPFGGLRSEEEMYVLAVWFGLVFGPFLSYSRAVYAELIPPGHESTFFSLFAFTDKSAS
                     FIGPAAVGLISDLTGNIRYGFLFLLVMLVVPIPVLGRVAVERGRREAVEWAERSRKEM
                     SDERV"
     gene            complement(132949..136217)
                     /locus_tag="CNF00370"
                     /db_xref="GeneID:3258496"
     mRNA            complement(join(132949..134106,134159..135502,
                     135583..135716,135942..136217))
                     /locus_tag="CNF00370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571479.1"
                     /db_xref="GeneID:3258496"
     CDS             complement(join(133391..134106,134159..135500))
                     /locus_tag="CNF00370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571479.1"
                     /db_xref="GeneID:3258496"
                     /translation="MMAGSETSSPTDFAFGPPALASGDAAFTCTPYKPEPLKPTFASP
                     TGVSPSTGSFTPAANAAPGHSYFPDSYNYGVSSASSFSSASGSAAGGSFSSVDNLPGI
                     SKNFVRPNLADTRRPATAGGALQSRSPYSNFMMSKKNSVSGSVSQDAQKLGERGDMRK
                     PEGTIEEGNEMLGLGGSTEEDGDGQGSQNVSPENENTVNPQLLPTNRRSSAPQYNIPG
                     SNWGQFPPSSSHDAANSSLGLPSAPAHMPMGYLQQQQAAHHSLNSQNRPPAFAGRPQT
                     SDGLPSYTNYHGAVTLPSAQSIARQIPGMTDTSSFFHHSSGSAHLPFKDDRHFPSTNF
                     PGDRAFTFDPLRSSLPPSFPGQIRASYAPPPPVPTAGSDSGGSSNNTNSTADQMQFMS
                     LSTGPGQKKRPRRRYEEIERLYPCGWNGCEKSYGTLNHLNAHVMTQKHGEKRLPAEFK
                     EMRKAWRKKKREHASAQASSQYMTNAAAWQQNYQRLSFASTTSAPDSDWDRRESSTST
                     LSVSTDGRPSFSYPTNYSWGVPPQGMPFQAGMMSVDSRPSTSSSNVSSVSMDGRFISN
                     QPASASASAMSMGPPTYLYLSGPPSLPGGVVPRHPSAPQHLPMPPPNPVDGFRPADGD
                     HPTPTVGNPFPIGPSGAGVVAGAGAGTGAAGQAGKALNFSTLTSPMEGSSGDFGSQFA
                     FTR"
     gene            140081..140885
                     /locus_tag="CNF00380"
                     /db_xref="GeneID:3258131"
     mRNA            join(140081..140175,140233..140306,140374..140637,
                     140691..140885)
                     /locus_tag="CNF00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657326.1"
                     /db_xref="GeneID:3258131"
     CDS             join(140292..140306,140374..140616)
                     /locus_tag="CNF00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513128.1"
                     /db_xref="GeneID:3258131"
                     /translation="MGVQHDQPNPSHYTAKSDVHNDTSAVPSQFDSKDVPREAGHSGY
                     TAEKSHDLKKAQNALHEGLQPAEDSRNNLSSSESGPRNAST"
     gene            complement(142811..144410)
                     /locus_tag="CNF00385"
                     /db_xref="GeneID:36392888"
     mRNA            complement(join(142811..142908,142965..143642,
                     143693..144410))
                     /locus_tag="CNF00385"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658553.1"
                     /db_xref="GeneID:36392888"
     CDS             complement(join(143171..143642,143693..144204))
                     /locus_tag="CNF00385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514481.1"
                     /db_xref="GeneID:36392888"
                     /translation="MTWLAGNRPLLEIYTELCKHSQLLSCFVRTHPMAVLESISKEFA
                     GGYKIPSVSQFGFSFSFLNPLFKHSPQRFLYSQQSSFNPYTHVYNALPQWNISIITSP
                     ISFLTLQRSSLLLLNLFTKPFCDPMALDEKFFDFILRLTMTLRTWTLILTLTLMPLTW
                     MATLNVTTIANIFYTDVPAKPSALEEDIEMIDASVYEDKITQPVHMEGSDTFKVFSAL
                     TDSEATSSSPLTYTLGSISISSTSNTFNIFSLDQSLHTFNSRTRFSTRPRRLLHAQSG
                     EAIKQKSFANMCAASRGRGRGRGRGRTYYEEDRKEEQEKYQPTSVNTASPD"
     STS             144346..144613
                     /standard_name="GTT8"
                     /db_xref="UniSTS:470831"
     gene            144628..150060
                     /locus_tag="CNF00390"
                     /db_xref="GeneID:3258319"
     mRNA            join(144628..144788,144847..144988,145053..145202,
                     145253..145615,145664..145779,145829..145928,
                     145979..146053,146101..146492,146543..146691,
                     146742..147587,147637..148064,148118..148460,
                     148514..148869,148919..149005,149059..149127,
                     149177..149680,149740..150060)
                     /locus_tag="CNF00390"
                     /product="DNA-directed RNA polymerase iii largest subunit,
                     putative"
                     /transcript_id="XM_571468.2"
                     /db_xref="GeneID:3258319"
     CDS             join(144721..144788,144847..144988,145053..145202,
                     145253..145615,145664..145779,145829..145928,
                     145979..146053,146101..146492,146543..146691,
                     146742..147587,147637..148064,148118..148460,
                     148514..148869,148919..149005,149059..149127,
                     149177..149680,149740..149952)
                     /locus_tag="CNF00390"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase iii largest subunit,
                     putative"
                     /protein_id="XP_571468.1"
                     /db_xref="GeneID:3258319"
                     /translation="MDTWAVVDQNEKHYVSSDVPRRIKHIQFQPFTPKDIVRISEVQV
                     SIAELYQNNEDGTRTTALQGPLDARMGPNEKGKKCATCGEDTQKCVGHYGYIKLVLPV
                     FHIGYFRPTINMLSCICKTCARVLLPETERASFLKRFRRPNLESLQRQSAAKAVLAAC
                     KKQNICTYCGAPNGIVKKSGPLRISHEPYRAAKMASMKDEWMATFKNAVAENQAVATH
                     LAKAVDDLNPLKVLNLFERITAEDCELLSLHPEVGRPEDYIWQYISVPPPCIRPSVAS
                     EAGNNEDDLTAKLAEIVNYNNTLALMMDLGRGIEMISSNWEVLGQAVALYINSQAPGM
                     QTIGSKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVIGPDPNLRIDEVAVPEKVAV
                     KLSYPERVTDYNLQLMRQAIINGSKLHPGANVLERKHENGSTVRISLNVMKDLEARKR
                     YARELQIGDIVHRHVRDGDIVLFNRQPSLHKLSIMCHRVRVRPWRTFRLNECVCNPYN
                     ADFDGDEMNLHVPQTEEARTEALELMSVKKNLVTPRNGEPIIAAIQDFITAAYLLSRR
                     DRFYDRQQFTQIVSYLDDANLKIEMPPPTIWKPVRLWTGKQIFNLLMRPNKESKVLVN
                     LEAKCRTLVDPAKEDRFPPDMSPNDGYLVIQNSEIMCGVFDKNTVGDGKKNSVFGVIL
                     RDYGPEEAAQAMNRLAKIAARWLANIGFSLGINDVIPGPILHASKDARVEKAYDECDV
                     FIDLAKKGKLENAPGCDQEATLESKISKTLSDVREAVGKICMQELSRHNAPLIMATCG
                     SKGSVINVAQMVACVGQQIIGGSRVRNGFQDRSLPHFRKKSKNPPSKGFVRNSFFSGL
                     TPPEFLFHAMSGREGLVDTAVKTAETGYMARRLMKALEDLCTHYDLSVRNSVGGIVQF
                     QYGDDMLDPACLEGDATPVEYVRSWTHACRTAGNQGRALYPYEVRRIAARIYPESFVP
                     PNFSPSLPKTKSRRRKEPTPPPPVVAPTLPKEWEGCHHKFRENTYKFVVDKIVKQMVD
                     QRLARGLPDADDEEMAEEYEALLNSDDPAVQRVLENANKVTEAQLSSFLENCRIRYLR
                     AKIEPGSTVGAVGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINAAKVIST
                     PIIAAELAIPESETAARIVKGRIEKTVLGDIAAVIEESWTNANAYIEVHIDMDAVRRL
                     QLEISLESIKWALVRANKLKIPEGSIHISQKTSRIRIWIDESDKDKGVGIYERLKFLK
                     RAIPSVQVKGLPAIERGVVTKDEKNEKIHRLLVTGYGLSEVMGTEGVDGLKTKTNHVM
                     ETQQVLGIEAARSTIYNEIQTTMKSHGMSIDPRHVMLLGDVMTYKGEVLGITRFGVQK
                     MKDSVLMLASFEKTTDHLFDASLYSKKDEIQGVSECIIMGTPAPGCGTSLASIVTPAP
                     PLPSKKPLLFEAAYKAGQHRMSKGMMVAAY"
     gene            complement(150060..151304)
                     /locus_tag="CNF00400"
                     /db_xref="GeneID:3258230"
     mRNA            complement(join(150060..150294,150348..150606,
                     150671..150780,150850..150906,150984..151304))
                     /locus_tag="CNF00400"
                     /product="UMP-CMP kinase, putative"
                     /transcript_id="XM_571305.2"
                     /db_xref="GeneID:3258230"
     CDS             complement(join(150137..150294,150348..150606,
                     150671..150780,150850..150906,150984..151227))
                     /locus_tag="CNF00400"
                     /codon_start=1
                     /product="UMP-CMP kinase, putative"
                     /protein_id="XP_571305.1"
                     /db_xref="GeneID:3258230"
                     /translation="MTVIDTIKDKLHHHHHHDKHAAAEPAAAQAQTQTQTQTPPTPVS
                     PETSKDASAAPDVEFSDKPVFDANKVTVIFVLGGPGAGKGTQCEKLVAEYGFKHLSAG
                     DLLRAERSREGSKYGAMITEYITEGKIVPMEVTIKLLENAMTETLSTPPSAPGWSNGF
                     GRFLIDGFPRKMDQALKFDESVCKSSFVLFFSTSEEILLQRLLERGKTSGREDDNKES
                     IVKRFRTFLETSLPVVDYYRERNKVVEIDSSPSIDEVYAVVKGEMDARLPKKGPAYE"
     gene            complement(151443..153228)
                     /locus_tag="CNF00410"
                     /db_xref="GeneID:3258372"
     mRNA            complement(join(151443..151796,151855..151941,
                     152008..152073,152140..152218,152304..152421,
                     152488..152729,152799..153228))
                     /locus_tag="CNF00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657327.1"
                     /db_xref="GeneID:3258372"
     CDS             complement(join(151675..151796,151855..151941,
                     152008..152073,152140..152218,152304..152421,
                     152488..152729,152799..152918))
                     /locus_tag="CNF00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513021.1"
                     /db_xref="GeneID:3258372"
                     /translation="MAAADVEMPLAESSSSLATLSRRQHLGQTFEAYRAELDDENALR
                     EKLIILSRSITQLSKKLIFHLHRGATSQPAQRQKNINEAEKKEREIAAVFKNIRQELS
                     DARPGESWESGFWKWRKSITPGLEEYIEGLSFMWYLQHGGLVPLDQVQKALSDENGEP
                     LIFVTPEDYILGMSDLTGELMRYATNALGTGDHETPLSICDFVRTVKTHFDAVNPDAI
                     RQLSKKQEETQRSLEKIEKVCYALRLRLIEFADRPDILAQMAKRALDDAADKGQGPAT
                     E"
     gene            153636..156191
                     /locus_tag="CNF00420"
                     /db_xref="GeneID:3258508"
     mRNA            join(153636..153937,153985..154460,154511..154657,
                     154711..155519,155584..156191)
                     /locus_tag="CNF00420"
                     /product="SLY1 protein, putative"
                     /transcript_id="XM_571469.2"
                     /db_xref="GeneID:3258508"
     CDS             join(153684..153937,153985..154460,154511..154657,
                     154711..155519,155584..156129)
                     /locus_tag="CNF00420"
                     /codon_start=1
                     /product="SLY1 protein, putative"
                     /protein_id="XP_571469.2"
                     /db_xref="GeneID:3258508"
                     /translation="MTRPSLLNAQTHALLTLLNLNNPPPANPAAAGPFPRPSSPGAPF
                     DDAAQPPLVWKVLILDDASQDVLATTLRVQDLREQGVTLHMQLHSARPPLADVPAVYF
                     VSPTLSNIRRIAEDLNPPLYASYYLAFTSSLPRSLLEELASLILSNDPSGQTGQLIAS
                     VTDQFLDFVVPSPNMFSLLPRRELRQDADGAAGKGKKGKDVREEWVEGRGSYVVLNDP
                     RATEVDIEEEVGRIANGLFSVITTMNMTPIIRCPRGNAAEMVARRLDAKLRDHIASTS
                     SRNTRDAYTVDALQRPLLAIMDRNIDLIPMLSHSWTYQALVSDVLDMKLNRVTVSSPE
                     NGRLTKKSYDIDSKDFFWAKNAGNPFPAVAEDIDTDLSKYKTDAAEITRSTGISDVND
                     VSQIDFTSNTANLKTAITALPELTARKQILDTHMNIATALLQSIKERGLDNLFQVEET
                     ASKQTKATILSVLNGATDEPGQTASPSPLDQLRLVIIYFLSTQDGALSKEDMKELEGV
                     LKEHGADTRALEYVKKVRDIHRMSTLAVQPAVAAQSQSGGGGEWTRGFSALGNRITDR
                     LREGGIPTVGLDNLISGVKSFLPARKDLTLTRLVEALMDPASASSQALQDTDDYLFFD
                     PKTSRARPGHAGGGGGGGGGGAGAGGGGAGGPGGGRSQFSEGLVFVVGGGGYVEYGNL
                     MDWANRSGGGGRDGGGGGAGAGGGAGAQGVTGQGGRKVTYGSTEILNPEKFLKSLEEL
                     GSV"
     gene            complement(156162..157872)
                     /locus_tag="CNF00430"
                     /db_xref="GeneID:3258143"
     mRNA            complement(join(156162..157086,157195..157295,
                     157385..157555,157684..157872))
                     /locus_tag="CNF00430"
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /transcript_id="XM_571478.2"
                     /db_xref="GeneID:3258143"
     CDS             complement(join(156324..157086,157195..157295,
                     157385..157555,157684..157776))
                     /locus_tag="CNF00430"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /protein_id="XP_571478.1"
                     /db_xref="GeneID:3258143"
                     /translation="MSNTIAYFDITIANEPAGRLTFELFDDVVPKTANNFKHLCIGDK
                     TNEAGVKLAYAGSSFHRCIKGFMLQGGDFTRGDGTGGESIYGEKFEDENFELKHDKPM
                     LLSMANAGPGTNGSQFFITTVPTPHLDGKHVVFGRVIYNRSLVRRIENIPTTSDRPDQ
                     AVTISSAGVLSPDEFAQLEAERQAKQAGSDGGDIWEDWPQDEEGVDAEKPEEALVVAG
                     KLKEVGTKEFKAGNFAVALDKYQKALRYLDVHPVLPNDSPAELVESFRSLRLPLLTNA
                     ALCALKLPASPNTSSLVVSLTSRALTLPNLSASEKGKALYRRAQAYVLKKDDEAAEKD
                     LKGALECVPGDAGVIKLLKDVEAKRKARREKERQAFAKMFG"
     gene            complement(158075..160740)
                     /locus_tag="CNF00440"
                     /db_xref="GeneID:3258156"
     mRNA            complement(join(158075..158386,158466..158888,
                     158970..159069,159156..159548,159629..159868,
                     159963..160153,160274..160740))
                     /locus_tag="CNF00440"
                     /product="basic amino acid transporter, putative"
                     /transcript_id="XM_571477.2"
                     /db_xref="GeneID:3258156"
     CDS             complement(join(158292..158386,158466..158888,
                     158970..159069,159156..159548,159629..159868,
                     159963..160153,160274..160382))
                     /locus_tag="CNF00440"
                     /codon_start=1
                     /product="basic amino acid transporter, putative"
                     /protein_id="XP_571477.1"
                     /db_xref="GeneID:3258156"
                     /translation="MDKDNQALDELPMLTGSKHANKRLFAAFMIFGLLNNVLYVIILS
                     AALDLVSADTPKGVVALFNIFPALITKVVWPLLSNGKIRYTRRVGFCTICSWFGIITI
                     ALSSSLSPRLLGISLASLSSGMGELTFLQLTTTLPTEATSKTALGAWSSGTGFAGVAG
                     AGIWWLLRGLGVKGGLGLSSFLPLFFPITYKYILPPFSHLEASSDSSPYQRLPMSSSL
                     SNNNNFRPPAILISVPSSEYVPQHTPLLSSGFIDRDRDRNRDGEELTDGDKRLMGMRA
                     SRLTTQEKMKLLRPLVVRYMLPLCAVYVEEYVINSGVAPTLVFPLPTYGLWSWLFKSP
                     RDYYPFWSLTYQTFVFLSRSSLSLGLPPIPKRLLPLPAIIQFLVLSLLFLQAKTFFFS
                     SPAYTPPADGDGGVDRSITIVFLLICLEGLCGGSGYVNTFYHVGREGSVSENYDADGD
                     NEMGGDRRTVNVTEMEKKAMEREFRIGAVGAADSTGILFASLISMPLEIALCRSQVDQ
                     GRTMCREL"
     gene            160848..164726
                     /locus_tag="CNF00450"
                     /db_xref="GeneID:3258489"
     mRNA            join(160848..161077,161147..161181,161260..161402,
                     161461..161716,161777..162285,162341..162449,
                     162544..162972,163036..163071,163144..163202,
                     163263..163400,163458..163920,164000..164081,
                     164141..164391,164443..164726)
                     /locus_tag="CNF00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657328.1"
                     /db_xref="GeneID:3258489"
     mRNA            join(160848..161077,161147..161181,161260..161402,
                     161461..161716,161777..162285,162341..162449,
                     162544..162972,163036..163071,163144..163202,
                     163263..163400,163458..163920,164000..164081,
                     164141..164391,164443..164530,164581..164726)
                     /locus_tag="CNF00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658554.1"
                     /db_xref="GeneID:3258489"
     CDS             join(161008..161077,161147..161181,161260..161402,
                     161461..161716,161777..162285,162341..162449,
                     162544..162972,163036..163071,163144..163202,
                     163263..163400,163458..163920,164000..164081,
                     164141..164391,164443..164530,164581..164615)
                     /locus_tag="CNF00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514482.1"
                     /db_xref="GeneID:3258489"
                     /translation="MDQSGVEPFTSKQAIPTNVVTFKGRRIPARIDPEARITYIVEVM
                     AASFATEEHHITLCLRDEEDNLVTQNNLPSKVYNHDTLKLCASPTTEALIVVASLKST
                     RRRSLAESTPDTPPAEDVLPLKLALFNFQKFVSEEEFTAEFLLKGGMRTLVKILESEN
                     GLTGNTLAYALQGIRGVLEYESAWADLTDTFITRILLLLIYATQPNVLRPATAIIRKL
                     VISRLSSSHHDNPPELLISASTKAPGLKPGLGPGPRHDVIGGKNRAKRKSRELTPAEK
                     DQHHHYKGHSLYGFDKLYILIKQLNIVSSGEDEGSVANAEYLFKILVKRLEGTGDLEL
                     VAQSLGLINACLRSGNQEGSRQYNELVWILEKLGICRYVSRLIPTSTNNIISPHILDF
                     QSRLCVILQHKRLRSVRPGQYKEHEKMLKDIWEAGKLGELAKKIGGEAGDGGWEAMSG
                     GQLGMSTGAGLGAEPGTGMGKFGLGLGEIDRGVKGWWMIGLGEEDQDGVLGEGAMFRD
                     VGELGLECLHWFATHEERFNNLVMEQQAKPAERRCPIGKASAECVKLLCEHYKISQAG
                     TGHHAPTSFQLFLLNFPNLHHLVLKFFLRMWQESNSCTPDFYRLTHLIRSHLTLTLSP
                     TTTSLIATTANTTRSSSSQTTSIDELLPELSKNWFHLEQDFLTTAYRTIRDRQMDFLE
                     KEGGMMRRNAVRSLKKKLGKEVWDVVCEQRVGCMLQGGWFNAARLLVPGMVVMAKANP
                     SKPLRFLRLSEDRKTIAWDDFEQRSGSPSFESLTHRIKISSISSVKQETSTPVNSRSP
                     NLISKLSFSLISSLPTATGVTLEKSLLDLDAIHAAQLAEWSDGIKVLKDGGMTSQDSA
                     NYIQILTELALNIRLLDITGDGVEIPENVDIGPAPRSVDFVFAK"
     CDS             join(161008..161077,161147..161181,161260..161402,
                     161461..161716,161777..162285,162341..162449,
                     162544..162972,163036..163071,163144..163202,
                     163263..163400,163458..163920,164000..164081,
                     164141..164391,164443..164580)
                     /locus_tag="CNF00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513022.1"
                     /db_xref="GeneID:3258489"
                     /translation="MDQSGVEPFTSKQAIPTNVVTFKGRRIPARIDPEARITYIVEVM
                     AASFATEEHHITLCLRDEEDNLVTQNNLPSKVYNHDTLKLCASPTTEALIVVASLKST
                     RRRSLAESTPDTPPAEDVLPLKLALFNFQKFVSEEEFTAEFLLKGGMRTLVKILESEN
                     GLTGNTLAYALQGIRGVLEYESAWADLTDTFITRILLLLIYATQPNVLRPATAIIRKL
                     VISRLSSSHHDNPPELLISASTKAPGLKPGLGPGPRHDVIGGKNRAKRKSRELTPAEK
                     DQHHHYKGHSLYGFDKLYILIKQLNIVSSGEDEGSVANAEYLFKILVKRLEGTGDLEL
                     VAQSLGLINACLRSGNQEGSRQYNELVWILEKLGICRYVSRLIPTSTNNIISPHILDF
                     QSRLCVILQHKRLRSVRPGQYKEHEKMLKDIWEAGKLGELAKKIGGEAGDGGWEAMSG
                     GQLGMSTGAGLGAEPGTGMGKFGLGLGEIDRGVKGWWMIGLGEEDQDGVLGEGAMFRD
                     VGELGLECLHWFATHEERFNNLVMEQQAKPAERRCPIGKASAECVKLLCEHYKISQAG
                     TGHHAPTSFQLFLLNFPNLHHLVLKFFLRMWQESNSCTPDFYRLTHLIRSHLTLTLSP
                     TTTSLIATTANTTRSSSSQTTSIDELLPELSKNWFHLEQDFLTTAYRTIRDRQMDFLE
                     KEGGMMRRNAVRSLKKKLGKEVWDVVCEQRVGCMLQGGWFNAARLLVPGMVVMAKANP
                     SKPLRFLRLSEDRKTIAWDDFEQRSGSPSFESLTHRIKISSISSVKQETSTPVNSRSP
                     NLISKLSFSLISSLPTATGVTLEKSLLDLDAIHAAQLAEWSDGIKVLKDGGMTSQDSA
                     NYIQILTELALNIRLLDITGDGVEIPENVDIGPGQCIFLQRLFCKLNHG"
     gene            165377..168590
                     /locus_tag="CNF00460"
                     /db_xref="GeneID:3258080"
     mRNA            join(165377..165780,165845..166061,166125..166207,
                     166266..166459,166514..166801,166861..166976,
                     167031..167149,167199..167318,167394..168590)
                     /locus_tag="CNF00460"
                     /product="alpha-glucoside transport-related protein,
                     putative"
                     /transcript_id="XM_571470.2"
                     /db_xref="GeneID:3258080"
     CDS             join(165593..165780,165845..166061,166125..166207,
                     166266..166459,166514..166801,166861..166976,
                     167031..167149,167199..167318,167394..167760)
                     /locus_tag="CNF00460"
                     /codon_start=1
                     /product="alpha-glucoside transport-related protein,
                     putative"
                     /protein_id="XP_571470.1"
                     /db_xref="GeneID:3258080"
                     /translation="MSKDPTAAEQVVLDRVKGDIEDYDDVVQSARQGMESEKSLSLKE
                     SLRRYPRAVAWSVLLSTSLVMEGFDAILISNFYALPQFVQKYGVELEDGWSITAAWQA
                     GLTNGANVGEIIGLCINGWASERFGYKKTMIGALIMMICAIFIPFFAQNIQTLLAGEI
                     LQGIPWGIFQTLTTAYAAEVSPVALRPYLTAYVNLCWVMGQIIASGVLRSVLSMEGQW
                     AYRLPFALQWIWPVPILVGCLFAPESPWWQVRNGRHDDARRTIRRLFSSPSDEEVENS
                     LSLMKHTNAIEKTMAEGTSYWDCFKGVDLRRTEIAAGAWMVQNLCGGAFMAYSTFFLE
                     QAGLPITQAFNLSIAQYALGICGTVVSWILMGSVGRRRLYLVGLAGMVVFLVIIGALG
                     FVSVSNSGAQWAVGALLLVYTALYDATVGPVCYTIVGEISSTRLRAKTVAIARIAYVI
                     IGIVNAVIMPYFLNSAELNWGAKTGFFWGGFAFLCLIWTFFRLPEAKDRTYGELDVLF
                     ENKITARKFASTTVDQFADHEGHFDNIIAVETFDGKLSSKPSIAHVEYSLTGLEK"
     gene            complement(168487..169387)
                     /locus_tag="CNF00470"
                     /db_xref="GeneID:3258160"
     mRNA            complement(join(168487..168828,168884..168964,
                     169017..169387))
                     /locus_tag="CNF00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_571476.1"
                     /db_xref="GeneID:3258160"
     CDS             complement(join(168598..168828,168884..168964,
                     169017..169340))
                     /locus_tag="CNF00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571476.1"
                     /db_xref="GeneID:3258160"
                     /translation="MILDISTPFPSLEPNTLYSFSPYPLLPRRHLNHVLLHPPNDQPQ
                     PQPQAGPSTSSLRGVNYCKERDEINKLMRRAERRALMGKNPAGMMLGREDEEVAIEED
                     VLEHEQMNVNMFGHRFLLPFGRRQTQMEMDSAPSPSPSEPDNEHRQEDNSMAIPVNTL
                     PDEDDDEARGQDLDASIEDMDDTDEYDDFGDGAEGVEARDLDGDMEDMDEE"
     gene            complement(169782..171188)
                     /locus_tag="CNF00480"
                     /db_xref="GeneID:3258250"
     mRNA            complement(join(169782..170556,170609..170822,
                     170885..171188))
                     /locus_tag="CNF00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_571475.2"
                     /db_xref="GeneID:3258250"
     CDS             complement(join(169822..170556,170609..170822,
                     170885..171090))
                     /locus_tag="CNF00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571475.1"
                     /db_xref="GeneID:3258250"
                     /translation="MAYRTLTRSLPRSLVTPIRFPFRSLSTTLRRSDILSDLEEKLHP
                     RELVERKKKLMEEKYADKLRKAAEKEGVQDIEELKKKVLQPKLDAAKEAARLAEEKIK
                     AEKQLKEDPVEKKVVAERKKKLEKKEVSQAEGDKSGIKPLSSIINLPLIHLTPHDTNA
                     ISQIWNAYHTSHPTLSNSFLSASLPASTYASMLALAKQNPFFVIPLPRLSEAPVEAAN
                     HPEMKTDEYEMFYLQWLFHPTPTASSPPSSEPNPEPLPLTTSAIFTPLEEFKKSGEWA
                     QPYLVLTHYPDLAQTHSLVLMRGEISPASASGPPGSLANPGFLLSQQQAQLLALALQR
                     FYCTDIPVPGESAKQKDERLKRQDALRGFRERPEEWNWTGLVEMAYGGLV"
     gene            complement(171471..172855)
                     /locus_tag="CNF00490"
                     /db_xref="GeneID:3258292"
     mRNA            complement(join(171471..171931,171984..172117,
                     172174..172195,172246..172316,172386..172490,
                     172546..172585,172642..172662,172716..172855))
                     /locus_tag="CNF00490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657329.1"
                     /db_xref="GeneID:3258292"
     CDS             complement(join(171551..171931,171984..172117,
                     172174..172195,172246..172316,172386..172490,
                     172546..172585,172642..172662,172716..172733))
                     /locus_tag="CNF00490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513075.1"
                     /db_xref="GeneID:3258292"
                     /translation="MRLTHDFVSNAPSHLNPLKERELELRGLQIPVIENLASHQGTYD
                     TLNLNDNSITVLGNIPNSPRLQAIHAANNQISSISPSLPPNIPNLVTLVLTDNAISSL
                     ASLIPLETLTSLRHLSLRGNPVTQQEHYKEFVVWKVAKGNLHTLDFERIKDSVRESAR
                     KLLTDPLTSLPNSLAHQLSIPTTSNIPGSTLSIKALPSNGVQKGPGAKGRLMTPDEKR
                     RVVEALTRAQTADEVRKLERMLADGLVPDGGVDEAVEGAVEVNGS"
     gene            173011..175303
                     /locus_tag="CNF00500"
                     /db_xref="GeneID:3258140"
     mRNA            join(173011..173367,173475..173506,173558..173686,
                     173740..173821,173874..174008,174057..174174,
                     174228..174326,174376..174644,174695..174941,
                     174997..175303)
                     /locus_tag="CNF00500"
                     /product="septin ring protein, putative"
                     /transcript_id="XM_571311.2"
                     /db_xref="GeneID:3258140"
     CDS             join(173120..173367,173475..173506,173558..173686,
                     173740..173821,173874..174008,174057..174174,
                     174228..174326,174376..174644,174695..174941,
                     174997..175032)
                     /locus_tag="CNF00500"
                     /codon_start=1
                     /product="septin ring protein, putative"
                     /protein_id="XP_571311.2"
                     /db_xref="GeneID:3258140"
                     /translation="MADSYYENQSHSPSPQGEQYSNDKIHHSERIASPNGGGVSTEGY
                     LANKNTEPTPVAAAPARKKLSSWVGFSNLPNQVHRRSVRRGFQFVTMVVGESGLGKST
                     LINTLFETKLYQPKQIPTPGADRGKTVQIESISADIEENGVRLKLTVVDTPGFGDFVN
                     NEESWKPIVDNIEARFDAFLEQENRVNRSKLLDNRVHACLYFIQPTGHSLKAIDIEFM
                     RRLHNKVNLIPIIAKADTMTDDEIIAFKQRILADIAHYGIQIFQPFQYENEDEETIQE
                     NEEIISKVPFAVVGSDSLVQSPDGRQVRGRSYPWGVIEVDNEDHCDFVKLRQMLVRTH
                     MEELREHTNDVLYENYRTEKLRAMGVQQDESVFRETNPAAKQAEERALHEAKLAKMEA
                     EMKIVFQQKVQEKEQKLKQSEEELYARHREMKDALEKQKQELEDKRRKIESGRPLTPE
                     KGSIQQKKRFGLGK"
     gene            175307..178076
                     /locus_tag="CNF00510"
                     /db_xref="GeneID:3258458"
     mRNA            join(175307..175440,175505..175620,175668..176402,
                     176462..176558,176613..176692,176745..176888,
                     176941..176979,177034..177144,177195..177249,
                     177296..177347,177399..178076)
                     /locus_tag="CNF00510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657330.1"
                     /db_xref="GeneID:3258458"
     CDS             join(176165..176402,176462..176558,176613..176692,
                     176745..176888,176941..176979,177034..177144,
                     177195..177249,177296..177347,177399..177980)
                     /locus_tag="CNF00510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513129.1"
                     /db_xref="GeneID:3258458"
                     /translation="MPFLDHISVPSITALFSLVLFLSTPSLAVRQMTVSNKCSSSIYV
                     AVGGKGGALTTTGGAAQPAGWKQVPGDFSFNVPDGWNNGRIWARTGCTLNGDTLDCVI
                     GGCSGNTVNCSGTEYGKPGATLAEFTIDVNSMDSYDISIVDGYNLPMEITSSDSSCAK
                     GSCGTETDILTQCDPSLVYPKNSDRIYSCNSACGNLVQFQDGTGGSLISADVNNSPVC
                     CVRNGVAVHHVNCPNTYIPFYQTMKKMCHNAYVYSDDDMYEDAVFTCSSTGKPSYTIT
                     FCPNGDGVGLDPPSSSSAVSQDSTPGDNSGNLLNGPAAVSIWTAATGTLIENGVGATA
                     TNAAHSQMNTGVASSVAVTAATSVTGAQVMSASARSKAITSSAVAAVNSSQSSSNRHT
                     HNGGVAAIELATTSAPAMIRSAAPKELDESTTTYTSNGNVYVKVVVVETKLVHGRDMK
                     CRRGKRWVGEREVAC"
     gene            178276..183791
                     /locus_tag="CNF00520"
                     /db_xref="GeneID:3258096"
     mRNA            join(178276..178653,178711..178778,178831..178849,
                     178901..178925,178976..179032,179086..179180,
                     179244..181185,181239..181316,181372..182865,
                     182920..183376,183432..183512,183563..183791)
                     /locus_tag="CNF00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657331.1"
                     /db_xref="GeneID:3258096"
     CDS             join(178425..178653,178711..178778,178831..178849,
                     178901..178925,178976..179032,179086..179180,
                     179244..181185,181239..181316,181372..182865,
                     182920..183376,183432..183494)
                     /locus_tag="CNF00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512994.1"
                     /db_xref="GeneID:3258096"
                     /translation="MDRKGSSSTPCKKSGQTLSPASNVYASNSSKKKSEKREGRDESG
                     DVANYDSSDMTDGSEFESPVEDEEDNDQIFYIDAIMYAHFRDTRSRKDGLGWYGWHYG
                     VMASYLKSLSDTEEPLSSFETELNVAPLVTSFWQAVDKPIPKGKLEPPGRKGDYYEIA
                     PDQMEDILLTCYPKRTWKIYSRRRAKQRAHQLAPPKIRAKPLRIQKRDSDHYNYERYK
                     RRRKVMQEAEEKQKKAHGIKKKEEKGSPEWASTSISDSDSTEMSLDDENNVPSMSDKR
                     AQGKRKEGPRRTKKHVQSSSEDENQTELKETTIERKRRRIPSSALSSVSSPSDSPRSS
                     KQKEQSLQPSIEVEIPIAVDRMRSRQPSQGTGPTQLSFGQLQPGIFDPDPPVTATFRG
                     GLSDAPRTVAATVVSSISAIEPFPETQQSGSQPLPSFPPSQAPRVSTQTQTRSSRQHS
                     PQPQPQLQPQPQPQSQPQPQHQAQSLPRTQPQPQTPNSLSASSVSGLPAATNKSQPKS
                     TSLSANQIQETIADANNASKTPVAAFPQHNSRQGSKDNAGNTAGASQNSVAPIDQQQK
                     QTTTGSVESTLRGTVNRFSEGSTGEASRPSTTPSTSRTLIPNQSGNLSHQISVSSLQE
                     PIDLTSSPPDIAIELPSTAIPASAGQNAPIHPANNATAVRKKYEQPKRIKTINDADTG
                     TQAIDIRAIRNSRKEQEHDVEAPHLSPQAPESQRPKELTRAQRRKLDEENLTSATRLS
                     TAMLHRQSPQDIGARPSSQSGQSSKGPVSRADSGERRTASVSTNAASMSPTAARKRLD
                     STSSETYHRASASRTSERFSPQLSPRLSKGKEDSGGGKKVPKRSLQDGNGSNTASPSV
                     APPKIVTAVTTTPVQGNASAGILPGPTHDSFTVVDPAPSPTTNVQEDNGESVFTPPRG
                     QEDSLFTPPFGGTDEVSENAPVSFPTPADQAPIQQTPQTLLDLHLGSPMPEDHSIVQA
                     AQKARLEKERLEMERLQKQREEQKWKEQQKKDRIDAMEKMKKMREMQKAEADKKKTER
                     VEKEKAEREKAVFSQTQPTQKPLMASRISQSYQPRQPVPQAQQLNQVIAPMPTQPLAS
                     PAVQTSDRPYTQPSNSALISFFVPPAARQTTPVPDERANNEATRQTANVLAQSSADQA
                     QHRSITPVVQPASRSASQPPTLPKSQSSVQSATQQLSQAPSHSSTQLIPLPTPHQTNE
                     ASSTVPPKSTATHPSTPSQDVQTPPKRINHDIIYNLDTLLRLRQIRLDGPTEVFNGLP
                     TPTSGTLEQPNHSFPALCPVKSQGGIITFAPSLILEEPKLFEKVMEALKKTPFWGAYL
                     APPVITYFDQSWGDEDLCPDAMESFAILIANLTLDGGFGQLFLADTPQSNGNGLAVSC
                     NPPASYDCDACLAWFQWLQQATEVSSFKDLADLCRLVKPGYFERKDQSVWTQAASSAT
                     RQDAEGVVIDQLIDLSRMRTRDDLVEYDRFVYVGRLELSASAEARRKKYGAGIEFLTP
                     EEFMRIAEDGASKS"
     gene            183811..186443
                     /locus_tag="CNF00540"
                     /db_xref="GeneID:3258419"
     mRNA            join(183811..184451,184507..184611,184672..184799,
                     184854..184869,184929..184938,185000..185064,
                     185118..185200,185279..185538,185595..185608,
                     185658..185747,185801..185811,185875..185891,
                     185940..185967,186025..186115,186179..186443)
                     /locus_tag="CNF00540"
                     /product="diacylglycerol O-acyltransferase, putative"
                     /transcript_id="XM_024657332.1"
                     /db_xref="GeneID:3258419"
     CDS             join(184096..184451,184507..184611,184672..184799,
                     184854..184869,184929..184938,185000..185064,
                     185118..185200,185279..185538,185595..185608,
                     185658..185747,185801..185811,185875..185891,
                     185940..185967,186025..186115,186179..186245)
                     /locus_tag="CNF00540"
                     /codon_start=1
                     /product="diacylglycerol O-acyltransferase, putative"
                     /protein_id="XP_024512995.1"
                     /db_xref="GeneID:3258419"
                     /translation="MPLKRPSPGPHPLDLNPYERLQFEEKENRRSHNDTDHHATLTSR
                     QEGLRRRAALGENVDISADGESKEDEGYSAEKRNDRLSSPEDTKTGEGKGKKSPLMSN
                     LKLDDFRDTLEAGIERKFAPLHIPPHRRLQTAAVALWALLLPICMIVLLLLLSLPPMW
                     LILIPYFIWISFDRAPIHGGRPKEWARKGFIWKYFADYYPCSIVKEAELPPNRPYLFG
                     YHPHGIIGMGAFATFATEGTNFSEYFPGIKPHLLTLGSNFKIPFYRELLMIHGCGSVS
                     KRSCANVLSQGPGSAIAIVIGGASESLSAHPGTADLTLKKRFGFVKMAIREGADLVPV
                     FSFGENDIYAQLANAKGSMVYKLQKKFEKVFGFTLPLFYGRGLFNYNYGLMPFRHPIV
                     SVVGKPIHVERDPHPSDEKVQELQSKYIAELTRIWDKYKDLYARGRTKELTLVE"
     gene            186555..187803
                     /locus_tag="CNF00550"
                     /db_xref="GeneID:3258490"
     mRNA            join(186555..186685,186756..186821,186887..186991,
                     187068..187273,187331..187434,187492..187803)
                     /locus_tag="CNF00550"
                     /product="tRNA specific adenosine deaminase, putative"
                     /transcript_id="XM_024657333.1"
                     /db_xref="GeneID:3258490"
     CDS             join(186680..186685,186756..186821,186887..186991,
                     187068..187273,187331..187434,187492..187775)
                     /locus_tag="CNF00550"
                     /codon_start=1
                     /product="tRNA specific adenosine deaminase, putative"
                     /protein_id="XP_024512996.1"
                     /db_xref="GeneID:3258490"
                     /translation="MATYIPPEEQDQIDLAWMREALIMAEEALTNDEVPVGCVFVKGG
                     QAIARARNRTNEWRNATLHAELEAIDHLLPSHPAPLSTITLYVTVEPCVMCASALRQV
                     GIGRVVYGCGNDRFGGCGSVIPVNNSPRLDSHPAYVAVGGFYREEAIMLLRRFYMSQN
                     PNAPKPKKKATRVLKTDIPPPPSRNTTPQSSRPSSTVPSQRRPVPSTDASTTGTSTPI
                     LSEGENKLREQVMRDDGLPIGSTMVSTPNETPVPQERK"
     gene            complement(187808..191974)
                     /locus_tag="CNF00560"
                     /db_xref="GeneID:3258089"
     mRNA            complement(join(187808..188852,188914..189019,
                     189083..189955,190003..190591,190646..191974))
                     /locus_tag="CNF00560"
                     /product="expressed protein"
                     /transcript_id="XM_024657334.1"
                     /db_xref="GeneID:3258089"
     CDS             complement(join(188829..188852,188914..189019,
                     189083..189955,190003..190591,190646..191894))
                     /locus_tag="CNF00560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513074.1"
                     /db_xref="GeneID:3258089"
                     /translation="MAENILGLLLVTSSSRGRHVFRYPPDPASPNVRLAQPIYPSATF
                     TATEADVEYKHPRAGGVGMRRRPFDDRSSNASIRRSLFGPSTRGSSKNERDRKGKKKA
                     DDLRARYMNPLAEANGSDYEDEDSEQDDSSSDERSDFEVMWKPGTTNGANDATGTGLA
                     KVAHRQTNGEDDPRASGVRNLDPSLIDLSRRGSSSTTTATVTGADRNNDHADKDAKKL
                     AIESQYNYALGWPLEVLADMLTPPRSACNRRFELCVGNVVFLGHPVCATPDGKWEAPP
                     DEDELEERAPSRGRRMRDQGGTMTNLDTVDEGIEAYTSAITKFASIESETKRSSQSNH
                     KDDDVPNLTMFHLVLIIDKPDPKPGTESHDEHHSQTMGIYDEIYREIAFKWTAAAYNL
                     QCESNLVAREAWMIVKYKEKCLNEGIGITECCRWTATHCHIDRTLNYLYLRLHQLRTQ
                     PANGLHSYLPTTITNRLAHITIQTVLSPKPVNTDEAWAHWGEMEEMLSDKDSEESLSD
                     WEDDWGAGAMMGMKRPELIVKPWQTLLLIDEDKNQNQEALFFGIVGLPAAVDDDDAVN
                     NWTNGRKSPVRNRTRRGSKITAEDDAIEDGETVLRRTLIEACDVTKPLYEIAHLLRYD
                     LEGVVIPLARDLVQSKKAILIDVVNPRLRTVVMPTTIDEHNSSFDQYTARFARDFPDL
                     PPFPRFISAISLSPIPFRKVIPNPDPDHATREKYMSALLWLLKQDLVVQVHTRARVFA
                     KSEIKVEAWKRLWYRRRQRWIEMTKERLEREKTLARSPSDQSDILTPRASENHTNPLD
                     ATSFSSLGTTPIANTFTVPPPNSSSKLDHSYMDYDPALEMDSDEEFDGLNGPQKFSLD
                     VAHPTKHEIPNFEPSFIFKPARAQKDEARWLRVIREKADEVWASKFDLCVQYFDGVTT
                     FEEITYRTGLQRKELEKILQLYNGDVVTFVHP"
     gene            complement(192650..194852)
                     /locus_tag="CNF00570"
                     /db_xref="GeneID:3258088"
     mRNA            complement(join(192650..192948,193002..193347,
                     193400..193634,193702..194075,194128..194440,
                     194602..194852))
                     /locus_tag="CNF00570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571472.1"
                     /db_xref="GeneID:3258088"
     CDS             complement(join(192742..192948,193002..193347,
                     193400..193634,193702..194075,194128..194440,
                     194602..194770))
                     /locus_tag="CNF00570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571472.1"
                     /db_xref="GeneID:3258088"
                     /translation="MTLVTRSAIRLSRRGGQQLKNARANAALFNTAANQAKNIVPKLA
                     ASSSRVTLPAKAANAARTYATPAGLQTGSIKTVIGAVVDVHFDSDNLPPILNALDVQF
                     GEGQTAPEGGRLVLEVAQHLGENTVRCIAMDGTDGLVRGQKVVDTGAPIKIPVGPAAL
                     GRIMNVIGQPIDQRGPIKGVREAPIHADAPPFVDQSTQAEVLETGIKVVDLLAPYARG
                     GKIGLFGGAGVGKTVLIQELINNIAKAHGGYSVFTGVGERTREGNDLYHEMRETGVIN
                     LEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGS
                     EVSALLGRIPSAVGYQPTLSTDMGGMQERITTTKKGSITSVQAVYVPADDLTDPAPAT
                     TFAHLDATTVLSRSIAELGIYPAVDPLDSKSRMLDPRVVGQRHYDIATKTQQILQSYK
                     SLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFAVAQVFTGIEGRLVPLKETVNA
                     FEEILDGKHDHISENSFYMVGGIEDVKAKHEKSLKEQGA"
     gene            195012..195737
                     /locus_tag="CNF00580"
                     /db_xref="GeneID:3258326"
     mRNA            join(195012..195589,195643..195737)
                     /locus_tag="CNF00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_571238.2"
                     /db_xref="GeneID:3258326"
     CDS             join(195044..195589,195643..195690)
                     /locus_tag="CNF00580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571238.1"
                     /db_xref="GeneID:3258326"
                     /translation="MPSFPARLFATSSRLAAAHATHATHVPASNLPPVLYRRIAKHIS
                     QLRAAGETTQTVSIPNPFLLHRSTEKATYAARDSYSWHKPQISPRRQKQLLQFYPAEE
                     LPVSALNTQSEKRSVVWEDGTIVTWAGKVREKTQKVKQGPYAGRKIMFKGHLDERKRP
                     QKLAERQERLDGMPKRIADWRKNKADEKVKGRPSLPF"
     gene            complement(195643..197233)
                     /locus_tag="CNF00585"
                     /db_xref="GeneID:36392889"
     mRNA            complement(195643..197233)
                     /locus_tag="CNF00585"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658555.1"
                     /db_xref="GeneID:36392889"
     CDS             complement(195730..196302)
                     /locus_tag="CNF00585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514483.1"
                     /db_xref="GeneID:36392889"
                     /translation="MIVHLKNGEEKGLENVASRYWYDWEDWTVSQPWDYAKEDGKEEV
                     KVDIPDKREEVPRQVVMNRLAEVVESVGGCTLPRPEFDMRVQRVAEEIKMFDERGYQF
                     RIEKVSRQMTKRKTYPLVRLAVMVMKGREKVRTPGAVMLIELGEKKGLARSHVKGFAV
                     FYEGEWPVCHQYRSSIPPPTLEGLKQLLEG"
     gene            197431..200138
                     /locus_tag="CNF00590"
                     /db_xref="GeneID:3258288"
     mRNA            join(197431..197735,197788..197836,197907..197993,
                     198051..199378,199434..199564,199637..200138)
                     /locus_tag="CNF00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657335.1"
                     /db_xref="GeneID:3258288"
     CDS             join(197603..197735,197788..197836,197907..197993,
                     198051..199378,199434..199564,199637..199834)
                     /locus_tag="CNF00590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513073.1"
                     /db_xref="GeneID:3258288"
                     /translation="MKPSVAFVILMCLCEAVAVPRALSGNVKDVFRLEKRQQDTGTSD
                     APSSQAASSAAASSDTGQSIVLTTTLVDSSSIAPVSSATISSVTTSDVGSFTVSSTIQ
                     STSATSSTTASSAGPSSVSPSPSLVSPSSNDLSTSSTAGPTSAEPITTSSPESSVQPS
                     SSSSPVPSPSSSSESSTTVPSSSSVPTSSEATSSPEQSVAAPSTSTAESSAAQSVQPS
                     TSPSATPSASQSSVSPSTAPSSAAPEPSSSQAGPTSTEPSSAVPASSDPPVSSAVASS
                     SSASQAPSSAVASSSSASEAPSSAVASSASVPSSSVASSGPITSEPASSQPAASSEAP
                     SSASSSTPSSNLSPSQSLPQSSGNPSAVSSGPTSQAASVSASASPQVSPSVTTSAGVV
                     ITPSGSGSQTSGEAPATSSSPAPSSVPAQSSASNTPSQVGSQTISGAASVTSSSPAVT
                     SDTPSTTPADTPITASSSRPSTTAGGPITVTATNTYTTPFTTTNAAGSVSTGNAVRTV
                     TVIVTANDPNQSTQPTETESEGPGVVVVTVTATDPGATTASDGGVVVVYVTETASTTD
                     QSGRPTNVIETITEHVRVSIVAGVTLTAYSTAGNGGSLQSIGAASPIKDYNHGIFIAF
                     GMGIFSMLVTALHLLWQ"
     gene            complement(200034..202938)
                     /locus_tag="CNF00600"
                     /db_xref="GeneID:3258247"
     mRNA            complement(join(200034..200696,200766..200885,
                     200955..201073,201128..201243,201308..201595,
                     201650..201843,201909..201991,202056..202272,
                     202337..202938))
                     /locus_tag="CNF00600"
                     /product="trehalose transport-related protein, putative"
                     /transcript_id="XM_571538.2"
                     /db_xref="GeneID:3258247"
     CDS             complement(join(200330..200696,200766..200885,
                     200955..201073,201128..201243,201308..201595,
                     201650..201843,201909..201991,202056..202272,
                     202337..202524))
                     /locus_tag="CNF00600"
                     /codon_start=1
                     /product="trehalose transport-related protein, putative"
                     /protein_id="XP_571538.1"
                     /db_xref="GeneID:3258247"
                     /translation="MSNGPITTEQVVLDHVKGDIEDYDDVVQSARQGMESEKSLSLKE
                     SLRRYPRAVAWSVLLSTSLVMEGFDVILINNFYALPQFVQKYGVELEGGWSITAAWQA
                     GLTNGANVGEIIGLCINGWASERFGYKKTMIGALIMMICAIFIPFFAQNIQTLLAGEI
                     LQGIPWGIFQTLTTAYAAEVSPVALRPYLTAYVNLCWVIGQIIASGVLRSVLSMETQW
                     AYRLPFALQWIWPVPILVGCLFAPESPWWQVRNGRHDDARRTIRRLFSNPSDEEVENS
                     LSLMKHTNAIEKTMAEGTSYWDCFRGVDLRRTEIAAAAWMIQNLCGAAFMGYSTFFLE
                     QAGLPTTQAFNLSVAQYALGICGTVVSWILMGRVGRRRLYLAGLAGMVVFLVVIGGLG
                     FISVSNSGAQWAIGALLLVYTALYDGTVGPVCYTIVGEISSTRLRAKTVVIARIAYNI
                     IGIVNAVIMPYFLNSAKLNWGAKTGLFWGGFASLCFIWTYFRLPEAKDRTYGELDVLF
                     ENKISARKFASTTVDQFAGHEAQFDDTIPVETFDEKLSGKPSVTHVEYMPTDSKK"
     gene            203277..206217
                     /locus_tag="CNF00610"
                     /db_xref="GeneID:3258280"
     mRNA            join(203277..203597,203665..203703,203769..203951,
                     204008..204214,204274..204679,204741..204936,
                     205006..205199,205254..206217)
                     /locus_tag="CNF00610"
                     /product="alpha-glucosidase, putative"
                     /transcript_id="XM_024657336.1"
                     /db_xref="GeneID:3258280"
     CDS             join(203685..203703,203769..203951,204008..204214,
                     204274..204679,204741..204936,205006..205199,
                     205254..205740)
                     /locus_tag="CNF00610"
                     /codon_start=1
                     /product="alpha-glucosidase, putative"
                     /protein_id="XP_024512997.1"
                     /db_xref="GeneID:3258280"
                     /translation="MVCVISDPDWWRQAVVYQIYPRSFADANGDGIGDLKGITARVPY
                     LKALGVDAIWLSPFYPSALRDGGYDVADYRDVDPKIGTLEEFDEMTAAFQKVGIRVIV
                     DIVPNHSSDDHEWFQAALKAGKGSPERERYIFRDGLGPNKDQPPTDWICSFGGSAWSP
                     SGMNDGQWYFHWFDSSQPDWNWENPDVKADFLKTLKFWGDRGVSGFRIDVAHGLAKDM
                     SEPLPNWEQLTKLTHQKLTNGNSELDHPLLDRKEVHDIYRSWREVFNQFNPPLMAVAE
                     AWVAPDQKPLYASSEGLGQTFSFDILLCNFDAEEYRQCIKSSLAGSKKSDSTTTWVLS
                     NHDVMRHPTRFGLPNVPNANHAMTTDTYNKFLKTKLTDPKVDIEQGLRRAKAATLMIL
                     ALPGSTYLYQGEELGLQEVVEIPDEERQDPIFIRTKGEEVGRDGCRVPIPWVADEKNF
                     GYGPGKRAHLPQPAWFKDYAVDVEEKDANSVLSLYRRALGLRKGLQSAEELEWVENPN
                     KEVLHFRRPGGWEVVVNIGKDSVDLPKGSVLISSSNNALKGGSIPGETTVWLKSA"
     gene            206383..209950
                     /locus_tag="CNF00620"
                     /db_xref="GeneID:3258303"
     mRNA            join(206383..206590,206667..206803,206861..207416,
                     207497..207559,207625..207746,207815..207868,
                     207935..207995,208062..208211,208272..208411,
                     208475..208585,208639..208680,208741..208765,
                     208840..208978,209063..209216,209299..209814,
                     209885..209950)
                     /locus_tag="CNF00620"
                     /product="expressed protein"
                     /transcript_id="XM_024657337.1"
                     /db_xref="GeneID:3258303"
     CDS             join(206481..206590,206667..206803,206861..207416,
                     207497..207559,207625..207746,207815..207868,
                     207935..207995,208062..208211,208272..208411,
                     208475..208585,208639..208680,208741..208765,
                     208840..208978,209063..209216,209299..209814,
                     209885..209910)
                     /locus_tag="CNF00620"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024512998.1"
                     /db_xref="GeneID:3258303"
                     /translation="MSHPENNGVGSSGLPNGADPSRPAPKRKSRSTRGLLNKVVALED
                     QMQHVQSNLENVVSLLLRLAPTALPAGSQPSTNSIRHDIAQPGSTGSHNRVQTPLSGF
                     CEKYEQRPVSSLEQWVQQIAGDVASTTADLQQQSVPRDRTAGGSVAEGSEMSSEDERD
                     HTVEEETKEGLSFMRDMLRSEEKKRLHADGHWDSPGEPGLSSHRDQEHIAADDRGHRA
                     EPDGRLRNARLKRKRGANDWEPPEWLPAGMRDPIDLGFCSEAQGRNLFDMFFQGAHSF
                     MPVFDPSRDSWESLRHRSPFCISAILFVGQKIKDAGHEPSNLQRLLREHAESIGKTTL
                     FCPIADTEALQAMIILASWGDTGWRPGSHAVSMAIDMELYKCLPRLAERLRTPSAFTS
                     DRDEDTERRLVIGSRLWLLVCKMAIEMAYNYGRPMLIDETLMIPHLHALLKHPAHLPT
                     DGRIVAFCELLYLRLTLHRNAISGNHQELDQLLQVYNDEALGWEERWRNYYIQQGVSL
                     DNILVTDLTTQRCFGSVLANSCLLRDIRSPHDIERLSPHRRRLLLASLDDARLIASRI
                     ITTEKDKLLHANHYSHVALASVTRIYIRLATLFPGSVDLRKVAKDLSQLTEVLARFPG
                     FHFAQQLRYAISKARQKKILPPETRPTSPRSLFNQSVECTRQNQPKPRSSSVPSMSWF
                     NHFPPSEPPPHQHHGESAPERPGSTGNTMTSGSPVEFDPFLAEHVLNETFNQVRPLDG
                     ISEWNPQPGETGNWNQSSQGGNQAEWLPSQPSIGTAIPDAHNSFLSWLEFPVLDFSDF
                     GTQ"
     gene            210217..211696
                     /locus_tag="CNF00630"
                     /db_xref="GeneID:3258128"
     mRNA            join(210217..210319,210375..210618,210748..210904,
                     210964..211333,211388..211696)
                     /locus_tag="CNF00630"
                     /product="electron transporter, transferring electrons
                     within CoQH2-cytochrome c reductase complex, putative"
                     /transcript_id="XM_571714.1"
                     /db_xref="GeneID:3258128"
     CDS             join(210254..210319,210375..210618,210748..210904,
                     210964..211333,211388..211513)
                     /locus_tag="CNF00630"
                     /codon_start=1
                     /product="electron transporter, transferring electrons
                     within CoQH2-cytochrome c reductase complex, putative"
                     /protein_id="XP_571714.1"
                     /db_xref="GeneID:3258128"
                     /translation="MLHQALPRLSKAARAPLQNMAKARFSSSATSQPVLASRTAVFAS
                     TLAAAGSVAWYGHLYGLPFLPEASANSAAENGLHPAVWPFEHYGPLETFNHSAIRRGY
                     QVYREVCAACHSLDRIAWRNLVGVSHTVDEVKAMAEEVEYEDGPNDEGEMFQRPGKLA
                     DYMPAPYPNEEAARAGNAGALPPDLSLIIKARHGGADYVYSLLTGYCDPPAGVKVAEG
                     MNYNPYFPGGGIAMARVLFDGLVEYDDGTPATTSQMAKDVVTFLSWAAEPEHDQRKKM
                     GMQALIILSSMFAISVYLKRFKWAYLKNRKIVYEPPKPSRHHAL"
     gene            complement(211806..215929)
                     /locus_tag="CNF00640"
                     /db_xref="GeneID:3258486"
     mRNA            complement(join(211806..214580,214634..215379,
                     215430..215929))
                     /locus_tag="CNF00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657338.1"
                     /db_xref="GeneID:3258486"
     CDS             complement(join(212878..214580,214634..215379,
                     215430..215449))
                     /locus_tag="CNF00640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513088.1"
                     /db_xref="GeneID:3258486"
                     /translation="MMDQVLDSGQNKPVWHLIPLPLSQINPSAVRPQYPRGRHVPTLH
                     SFCLATISRNFHVVEPMSFTGVHPVLVRRIFSRIRADRGYEEIQESEQISSNPDEATI
                     WAYDALLEGADAGSFTLALPAIPTLAHLPPNPRTPNVQHPLNYLPSLFASSLLNPTTS
                     LLTSLTLDGMDRAVNDQNVQALRYCTHLDVLWMKGCRITDNGIRLLGSALELPGQKDL
                     KEGRGLWRLRAWFLGGCKGVSDRSAKVFARWPGLVALDLRDTSCTEASFAVINRTLQA
                     LFSGQNPKFQACTDGLVPLFASNLPPADIVSSLCLTLIKLPKEKSDLVSLNVTSTSRP
                     IPDKFLPPSSRAIPSSSSVSASGKSYVPGIGFIYGSNLSSCIEEEDRDPQPFGTSISL
                     FNPSSSPHKDAFSQVEEENPTPAEKRKRTIAKKLERNGQAHLVGKAQKEKKPTKTPKA
                     KAAGVAAAAQAGEWWDDADGQAKNFYSAASASTSTYSNAYPMLSAEATQANARGQGEG
                     DRRLMLVRVVHDEWFRLTYTTANALAQAQTKEVNWAREGQMAEKRGKMVGDIMQATES
                     VREASRRAVEANKATANGQAADRVRTSGPTDGSVLPTQTSMRSEEILRRRMERQVVDP
                     SGITTTVPSTGSSPSISQASDGSQNPFKKPYTSKPFATKYYPRKYTGSASRSPPRTKK
                     PSPFAPHSRLVGKAPNRGGTNTSSSISTPGKPSPLTGHSPSQPLQPSSSPPMSSPVAA
                     TSVQRPSTRSNPFAPKPSSIHRSSSPVSSAQEDDSLDFGFSSGASAKKRAFGGAPGGE
                     GKRRGMKMFSGKVNGVVLKSAREA"
     gene            216065..220767
                     /locus_tag="CNF00650"
                     /db_xref="GeneID:3258384"
     mRNA            join(216065..216150,216320..216354,216700..216785,
                     216851..217135,217188..218553,218609..219613,
                     219667..220058,220118..220374,220430..220767)
                     /locus_tag="CNF00650"
                     /product="pyruvate carboxylase, putative"
                     /transcript_id="XM_571482.1"
                     /db_xref="GeneID:3258384"
     CDS             join(216325..216354,216700..216785,216851..217135,
                     217188..218553,218609..219613,219667..220058,
                     220118..220265)
                     /locus_tag="CNF00650"
                     /codon_start=1
                     /product="pyruvate carboxylase, putative"
                     /protein_id="XP_571482.1"
                     /db_xref="GeneID:3258384"
                     /translation="MTAVGELQTPIEAWVSHLGIDTSRPGTPNAPGTPAIPHTITGLR
                     KRQAGHSGPLKKLLVANRGEIAIRVFRTAHELAMSTVAIYSHEDRMGAHRYKSDESYL
                     VGKGMSPVAAYLAQDDIIRIALEHEVDMIHPGYGFLSENAEFAKKVEDAGIAFIGPRP
                     ETIDALGDKTKARTLAIKTGVPVVPGTPGPVESYDKAAAFIEKYGFPVIIKAAMGGGG
                     RGMRVVRDQESFKESFERAVSEAKSAFGDGTVFIERFLDRPRHIEVQLLADGEGNCVH
                     LFERDCSVQRRHQKVVEVAPAPHLEESVRQAILSDALKLADAVKYRNAGTAEFLVDQQ
                     NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGVTLQQLGLTQENIHRRGFAIQ
                     CRITTEDAAANFQPDTGKIEVYRSAGGNGVRLDASSGYAGAQITPHYDSLLVKCSVSG
                     ATYEVARRKMLRSLIEFRIRGVKTNIPFLIRLLTHEVFESGKTWTTFIDDTPELFKLV
                     HSQNRAQKLLAYLGDIAVNGSSIKGQMGEPGLKTEAMIPTIVDAEGNAVDTSKPCLTG
                     WRNIIVEQGPEAFAKAIRNYKGCLIMDTTWRDAHQSLLATRMRTIDMANIARETSHAL
                     QNAYSLECWGGATFDVAMRFLYEDPWVRLRTLRKLVPNIPLQALVRGANAVGYTSYPD
                     NAIYDFSKKAVEAGLDIFRVFDSLNYLENLKVGIDAAKKAGGVVEGTICYSGDVANPK
                     KTKYTLQYYLELTDALVKEGIHVLGIKDMAGLLKPEAARLLIGAIRKAHPELPIHVHS
                     HDTAGIAAASMIACAAAGADVVDVAIDDLSGLTSQPAMGAVCGALEQTGLGTGISYEN
                     IQALNQYWTQIRKLYQCFEANVRASDSGVFDHEMPGGQYTNLQFQASQLGLGTQWLDI
                     KKKYIEANKLCGDIIKVTPSSKVVGDFAQFMVSNNLDAQDVLERATSLDFPSSVVEFF
                     QGYLGQPYGGFPEPLRSNIIRDKARIDERPGLNMAPLDFKKIKAELREKYGPQITDFD
                     VASYYMYPKVFEEFQGFVEKFGDLSVMPTRFFLAKPAINEEIIISIETGKTLTIKLLS
                     IGPLDQSKGTRECFF"
     gene            complement(220644..222228)
                     /locus_tag="CNF00655"
                     /db_xref="GeneID:36392890"
     mRNA            complement(join(220644..220907,220961..221094,
                     221154..221391,221439..221504,221561..221784,
                     221834..221855,221914..221986,222055..222228))
                     /locus_tag="CNF00655"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658556.1"
                     /db_xref="GeneID:36392890"
     CDS             complement(join(220887..220907,220961..221094,
                     221154..221391,221439..221504,221561..221784,
                     221834..221855,221914..221937))
                     /locus_tag="CNF00655"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514484.1"
                     /db_xref="GeneID:36392890"
                     /translation="MKLDRDSEKIVAEVTDTILGRYGHSLTWEIKAGAMGKPLPTASE
                     WILSHFPDIREQLSVEEFIEEGARMKAKLFKEVEPMRGATALVKGLYEAGIPIALATG
                     SSMQNFIYKTTHLPHIFGHFPPSCIITADSPGIKGKPNPDIFLAAARSLGRDVGISDE
                     CSELQKEERRKGLVFEDSVPGVLAGVAAGMNVIWVPHAEVKALNPEETYGAREVLAHL
                     EEWDPTKWNLPLLPGFANDLPLKI"
     gene            222447..225356
                     /locus_tag="CNF00660"
                     /db_xref="GeneID:3258296"
     mRNA            join(222447..222649,222702..222883,222931..223136,
                     223197..224505,224562..224623,224686..224893,
                     224967..225356)
                     /locus_tag="CNF00660"
                     /product="transcription factor iiib 70 kd subunit,
                     putative"
                     /transcript_id="XM_571484.2"
                     /db_xref="GeneID:3258296"
     CDS             join(222576..222649,222702..222883,222931..223136,
                     223197..224505,224562..224623,224686..224893,
                     224967..225001)
                     /locus_tag="CNF00660"
                     /codon_start=1
                     /product="transcription factor iiib 70 kd subunit,
                     putative"
                     /protein_id="XP_571484.1"
                     /db_xref="GeneID:3258296"
                     /translation="MSVQRCPQCGPDGQLETDLSAGNIVCQRCGQIVEEGILVSEVGF
                     AESAGGRVHVQGTFVSNYATGVAGSRGGRGGQQNIENIKAQGASRIEALSRQMHLSSA
                     ITRGAIRFFSLAVDNKFNRGRKTDYIIASCLYLQCRLKKDAHMLIDFSEHKGINVFEL
                     GATYLKLRSTLNLLDPMPEVDPAIYNLRFAHRLNFGAQVNTVAADASRLVRRFRADWM
                     TQGRRPAGVCGACLIIAGRMSNFLRTPDEVAQVVKVHPNTIKKRLLEFAQTDMAKKTV
                     GEWRSLSESQLDEVSEIEKPPIVREQERKRAQEERKRRYLDGEIGEEEEDKEDAEEEG
                     RPIKKAKLDKDKGHASDDDEQMIGALQAAAHDFEDANVASGEDDEDDTLDPLAPSDYV
                     QQLESARDDPTQAREERRRNRTDLLKSIKGFGQADTVEDVDMDELEQLASDAERLEDE
                     DEENEENDAALEPTQLKVVSQAEGSAKKHEIFDAWDDEAAVITFFEEKYFHGEKNLYQ
                     ANMANRIKMWWGNRDPKEVHQEMEAVKRARWLREKNARQLNTDLDDLDDDELEAVFVL
                     DEDAKQARARMWLSSNGKWLEEEKEKQEKRAALQRARGNDPSKNKPKRKRTAPHKGPY
                     KSSDQAVQSVIKSKQFSGRVNYDVLRGLGLTGSSTAGLVVMDDEKEEYEEDEEKGEDE
                     GGYDNWNEY"
     gene            complement(225315..226140)
                     /locus_tag="CNF00670"
                     /db_xref="GeneID:3258345"
     mRNA            complement(join(225315..225683,225739..225841,
                     225906..226006,226073..226140))
                     /locus_tag="CNF00670"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_571241.2"
                     /db_xref="GeneID:3258345"
     CDS             complement(join(225438..225683,225739..225841,
                     225906..226006,226073..226075))
                     /locus_tag="CNF00670"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_571241.1"
                     /db_xref="GeneID:3258345"
                     /translation="MAPKKVRAPQEAAVSLGPQVAEGENVFGVAHIFASFNDTFVHVT
                     DLTGKETISRVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITALHVKLRATGGT
                     GTKQPGPGGQAALRALARAGMRIGRIEDVTPTPSDSTRRKGGRRGRRL"
     gene            226307..228504
                     /locus_tag="CNF00680"
                     /db_xref="GeneID:3258482"
     mRNA            join(226307..226411,226469..226540,226591..226635,
                     226698..226790,226847..226920,226980..227189,
                     227239..227548,227603..227749,227810..228504)
                     /locus_tag="CNF00680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571486.2"
                     /db_xref="GeneID:3258482"
     CDS             join(226373..226411,226469..226540,226591..226635,
                     226698..226790,226847..226920,226980..227189,
                     227239..227548,227603..227725)
                     /locus_tag="CNF00680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571486.1"
                     /db_xref="GeneID:3258482"
                     /translation="MIKPPPEAFQCHNNHDVRTLLLSLLLCTGLIISYLPQHIRIISA
                     KSSEGFSPWYLLLGATSSASGMLNILIVQWPLFRCCRTLSAGSCFESLLGFLQVTLQW
                     LLFTIILVLYLIYFPKHLKYQRVIPVSSPDSSVAESNYGAVQDQENDEEEPNKAKVTT
                     TPEWRLAVTLGIVVALHLGLLLLLSLALLVYLPSTIPPHPLLRLLATFLGVSATILAI
                     LQYAPQIHKTYKARLVGALSLGTMAIQVPGSVLFVLSLAFRPGTDWTSWLPYAVTGAM
                     QGALLVICLLWKRRQKALGIDDFGKPLINAEETFAGEQRQLVQEQ"
     gene            complement(227828..228729)
                     /locus_tag="CNF00690"
                     /db_xref="GeneID:3258132"
     mRNA            complement(227828..228729)
                     /locus_tag="CNF00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657339.1"
                     /db_xref="GeneID:3258132"
     CDS             complement(228085..228489)
                     /locus_tag="CNF00690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024512999.1"
                     /db_xref="GeneID:3258132"
                     /translation="MVKGPVLISCGGAFSVLSVVKSLLKLLFPMQTWPSPWLFWLYGL
                     VSVVLSALLSPAAIWTDQLPKHLQANLGQYMNSTQLATIYGSIAKARAVTEHRDLVIK
                     SYLDTAWYLEVPTLCLCCSSRCWSFDFQLLAW"
     gene            complement(232020..232120)
                     /locus_tag="CNF00700"
                     /db_xref="GeneID:3258264"
     tRNA            complement(232020..232120)
                     /locus_tag="CNF00700"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3258264"
     gene            232254..233164
                     /locus_tag="CNF00710"
                     /db_xref="GeneID:3258418"
     mRNA            join(232254..232653,232704..232775,232832..232907,
                     232966..233164)
                     /locus_tag="CNF00710"
                     /product="Golgi to vacuole transport-related protein,
                     putative"
                     /transcript_id="XM_571243.2"
                     /db_xref="GeneID:3258418"
     CDS             join(232288..232653,232704..232775,232832..232907,
                     232966..233114)
                     /locus_tag="CNF00710"
                     /codon_start=1
                     /product="Golgi to vacuole transport-related protein,
                     putative"
                     /protein_id="XP_571243.1"
                     /db_xref="GeneID:3258418"
                     /translation="MIHAVLIFNTNGKPRLSKFFTPLPPLVQQSLISQIFSLISDRPA
                     GVCNFLDAPDLVFPTPKSMVKTRQEERNGLGLEGGRDGEEVKEMEDDTRVIYRHYATL
                     YFVFVVDGAESELGILDLIQVFVESLDRAFENVCELDLIFHFDEVYHVLSEIIQGGLV
                     LETNINEISACVRAATKNRKESSASSNPLIPSVLAAPGGRGGNRGGSADGARRWLAAM
                     GV"
     gene            complement(232821..234701)
                     /locus_tag="CNF00720"
                     /db_xref="GeneID:3258447"
     mRNA            complement(join(232821..233378,233430..233500,
                     233550..233746,233799..234076,234132..234405,
                     234464..234701))
                     /locus_tag="CNF00720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571534.1"
                     /db_xref="GeneID:3258447"
     CDS             complement(join(233190..233378,233430..233500,
                     233550..233746,233799..234076,234132..234405,
                     234464..234624))
                     /locus_tag="CNF00720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571534.1"
                     /db_xref="GeneID:3258447"
                     /translation="MRPLRPEEEQWIFSKHALENTPSRSHGVSLEEELERRKSTIMQM
                     RSLLARVVYVRDHPDPKAKLTSTPYRNVILLAATFVHRFYMRRSLEDFKESLMAATLL
                     WMASKLEENQLKVRHLVNVCLDKYEQSKPSHWRIQWRPMENGQDPSDGYRFWEKRIVV
                     GEQLALEALCFDLFVEHPWVIIRRAIDGLDARIAKLEEAEEKELGNKGGANGANGKRR
                     GPKITEELIMSLAWPISSEASLSPLSILYPSPIIAFTFLAIIISLIEQTPLSRGISAA
                     SEIVDRFELDIRFTMDGPEGEDLKTVKDCLESFTEYVKMGLIDRNLVRYLTPEPRSID
                     EIKPFKRSFTLATSNESSNTSAEVVETSDTRSSAQEEESQVKTENSSKLTPGESQ"
     gene            234852..237437
                     /locus_tag="CNF00730"
                     /db_xref="GeneID:3258293"
     mRNA            join(234852..235498,235546..235841,235897..236062,
                     236122..236253,236302..236674,236726..236929,
                     236992..237114,237168..237437)
                     /locus_tag="CNF00730"
                     /product="glycine-tRNA ligase, putative"
                     /transcript_id="XM_571244.2"
                     /db_xref="GeneID:3258293"
     CDS             join(234866..235498,235546..235841,235897..236062,
                     236122..236253,236302..236674,236726..236929,
                     236992..237114,237168..237340)
                     /locus_tag="CNF00730"
                     /codon_start=1
                     /product="glycine-tRNA ligase, putative"
                     /protein_id="XP_571244.1"
                     /db_xref="GeneID:3258293"
                     /translation="MAIPRPLVNSIRSFATRTIPTRKFNLRKSSKMVAAASVSHPSEL
                     TVPNKTAHAFDKSTLDALLARRFFFAPSFEIYGGVAGLYDYGPTGSALQANILDAWRK
                     HYIIEEDMLELDTTIMTLSDVLKTSGHVDKFADWMVKDVKNGEIYRADHLVEGVLEAR
                     LKGDKEARGVKEEEKKEEEDDKKKKKKKIVKTEAVKLDDNTVAEYEYLLAQIDNYTGP
                     ELGDIIRKHKITNPTTGNEVSEPVEFNLMFESNIGPTGHIKGYLRPETAQGHFVNFAR
                     LLEFNNGKVPFASAQIGKSFRNEIAPRQGLLRVREFTMAEIEHYVDPLDKRHARFNEV
                     KDVVLTLLAKGVQSEGRTEIVKKTVGEAVAEGIVDNETLGYFLGRTQLFLTKIGIDPA
                     RLRCRQHMANEMAHYATDCWDFEIQSSYGWIECVGCADRSAYDLTVHSVRTKQPLRVQ
                     QRLDQPRTVEKLECTFDAKAFGMKFKKDATMIKETLLGLEKEKLQCIKDELENGSSNV
                     QCADGKSYEITPDLVKINPITVTEHMREFIPNVIEPSFGIGRILYCVLEHTYWAREQD
                     AARGVLSLPALVAPIKCLIVSISQDAQLRSKIHEVSREMRKRGIASRVDDSSATIGKK
                     YARNDELGTPFGCTVDFATIQNGTMTLRERDSTSQLIGPIEDVISVVDQLVKGVLDWE
                     GASQKLEAYSGVQDVDA"
     gene            237907..239330
                     /locus_tag="CNF00740"
                     /db_xref="GeneID:3258201"
     mRNA            join(237907..238073,238126..238845,238905..238976,
                     239033..239126,239184..239330)
                     /locus_tag="CNF00740"
                     /product="pyrroline-5-carboxylate reductase, putative"
                     /transcript_id="XM_571245.2"
                     /db_xref="GeneID:3258201"
     CDS             join(238049..238073,238126..238845,238905..238976,
                     239033..239126,239184..239214)
                     /locus_tag="CNF00740"
                     /codon_start=1
                     /product="pyrroline-5-carboxylate reductase, putative"
                     /protein_id="XP_571245.1"
                     /db_xref="GeneID:3258201"
                     /translation="MGYTLAVLGCGTMGIAILSGVISSLETRASLPRNPNASSEPPSG
                     ISTPTASQFLDAPEASLPSTFIATVGREETGRKLRRTLADMGSIGKQVQVRAGQGNVK
                     TVDEADVILVCSKPQIARSILEEEGMSKALEGKLLISICAGVTISQLKSWVPESTRVV
                     RAMPNTPCKIGEGMTIVTPLSDALSRTLILNIFTSCGRCRFLDEKHFDACTALAGSGP
                     AFVALVLEAMADGGVMMGLPRSEALELAAQTMQGTGRMALQTGLHPAQLKDSVTTPGG
                     CTIAGLLTLEDGRVRSTMARAIQVATNHASGLGQDKK"
     gene            239590..240882
                     /locus_tag="CNF00750"
                     /db_xref="GeneID:3258024"
     mRNA            join(239590..239738,239790..240882)
                     /locus_tag="CNF00750"
                     /product="expressed protein"
                     /transcript_id="XM_571246.2"
                     /db_xref="GeneID:3258024"
     gene            complement(239657..241450)
                     /locus_tag="CNF00760"
                     /db_xref="GeneID:3258231"
     mRNA            complement(join(239657..240960,241012..241450))
                     /locus_tag="CNF00760"
                     /product="expressed protein"
                     /transcript_id="XM_571669.2"
                     /db_xref="GeneID:3258231"
     CDS             join(239658..239738,239790..240641)
                     /locus_tag="CNF00750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571246.1"
                     /db_xref="GeneID:3258024"
                     /translation="MSTEETARPLEPSVQATELPKEASLASLPSESYPEIHQGASLLL
                     ALRLQDRPILLIGGGVVASSRLYFLLESGAHITLISPLPLDPSISHYISHPSTASQIT
                     HLSRPYAGRSDPVKVKDFDLVLTAIDDNDLSREVCEMCREERVMVNVADIPPQCDFYF
                     GAQMRRGPLQILISTGGLGPRAGAMLRDLIVDALPDDIESSLEGVGALRRDLRERAPG
                     VGGKGGKKRMEWMKAICDKWGLGQMKKFNDVTVRKRILDEGWEKGIVLGPEHLEKKGD
                     DWTAIAGKVVGNMLALGMAAGFAIWLRAYNTAKR"
     CDS             complement(join(240675..240960,241012..241415))
                     /locus_tag="CNF00760"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571669.1"
                     /db_xref="GeneID:3258231"
                     /translation="MASTSSQTTPLEPTLYSLLPPSLHTSILSHLSLLAIHAEPLHLI
                     ERIYTTTNPVLPGQTRNLRFRSIRIAGTVRDKGKGKEKDDGDWVHTLAYVSSRLRSAE
                     YSEAAVRAVMSVEVQDMSSSRDIEDFVKALGFRHSHTFTLTGHLLHLPIPIPTSPPLT
                     LHLSITRLTPSASTTDEQSAPDEPYLVQLQPSRPVYAIAPPGDIGLQDMIGVMQSTAG
                     RLDGLEWSTGQ"
     gene            241617..244171
                     /locus_tag="CNF00770"
                     /db_xref="GeneID:3258068"
     mRNA            join(241617..241739,241808..241848,241903..242128,
                     242198..242298,242362..242560,242625..242982,
                     243022..243176,243230..243746,243812..244171)
                     /locus_tag="CNF00770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571488.2"
                     /db_xref="GeneID:3258068"
     CDS             join(241631..241739,241808..241848,241903..242128,
                     242198..242298,242362..242560,242625..242982,
                     243022..243176,243230..243746,243812..244094)
                     /locus_tag="CNF00770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571488.1"
                     /db_xref="GeneID:3258068"
                     /translation="MPRSTYTEALLGPEVYKKVRETKVLVVGAGGIGCELLKNLVLVG
                     FANIEIIDLDTIDLSNLNRQFLFRKPDISKSKALVAAATAHHFNPNSGININARHGNV
                     KDSVNDLEWIKGFGLVMNALDNMDARRHVNRLCQAAGVPLIESGTAGYLGQVTPMIKD
                     VTECFDCVPKPAPKAFPVCTIRSTPSEPIHCIVWAKTYLFGKLFGEDDEDMDTEELDK
                     AKSSGENAEEIENLKKEAAAFRQVRKSLSEEDGPRRVFHKIFNEDIRRLLAMEDMWKK
                     EGRVKPVPLDCDAILDETFVTPPLRTVPVTNQQADSDRAAERDKGKSAALLKDQKELN
                     LKENLELFLDSCKRLSARALAFPDTPLSFDKDDDDTLDFVLATANLRATAYGIPNKTR
                     FQVKEMAGNIIPAIATTNAIIAGLIVMQSLNILSRIHSTSNGGPSTDSSSIPVRNVFL
                     RTDPTKPLGSFLPQHPDPTCSVCRDVYIPFKADVGKCTLGEFVEDAVKDWLGSAEFEG
                     QGEGEDVEWTVFEGGRLLADPDFDDNLGRTLDDLGVGRGKILTVRDEDTKYRPVHFCV
                     CQPDPEASKAYTLPDEKPTIPLAPAKPGAAARESSEEPEIVEHVPANTAPKDLPSVTA
                     GVKRPAPEDEGQTAAGRDDAKKRRVTTVVDDDDDFEIL"
     gene            244324..249742
                     /locus_tag="CNF00780"
                     /db_xref="GeneID:3258187"
     mRNA            join(244324..244685,244746..244898,244954..245180,
                     245231..245952,246009..246160,246219..246287,
                     246355..246516,246582..246717,246765..246934,
                     246993..247508,247570..247929,247978..248170,
                     248223..248449,248509..248673,248729..249023,
                     249072..249209,249263..249392,249448..249742)
                     /locus_tag="CNF00780"
                     /product="cleavage and polyadenylation specific protein,
                     putative"
                     /transcript_id="XM_571490.2"
                     /db_xref="GeneID:3258187"
     CDS             join(244380..244685,244746..244898,244954..245180,
                     245231..245952,246009..246160,246219..246287,
                     246355..246516,246582..246717,246765..246934,
                     246993..247508,247570..247929,247978..248170,
                     248223..248449,248509..248673,248729..249023,
                     249072..249209,249263..249392,249448..249622)
                     /locus_tag="CNF00780"
                     /codon_start=1
                     /product="cleavage and polyadenylation specific protein,
                     putative"
                     /protein_id="XP_571490.1"
                     /db_xref="GeneID:3258187"
                     /translation="MHALHQTLLPSSSIHHSLFLPHFTPSTIYPLPKPPAALDTLDVK
                     VIGNLVVAGAEVLRVFEIREESVPIIENVKLEEDVAEGEKDVQMEEVGDGFFDDGHAE
                     RAPLKYQTTRRLHLLTQHELNGTITGLAATRTLESTIDGLDRLIVSFKDAKMALLEWS
                     RGDIATVSLHTYERCSQMNTGDLQSYVPLLRTDPLSRLAVLTLPEDSLAVLPLIQEQS
                     ELDPLSEGFSRDAPYSPSFVLSLSDMSITIKNIQDLLFLPGFHSPTIALLFSPMHTWS
                     GRLQTVKDTFCLEIRTFDLSSGTSYPLLTSVSGLPSDSLYLVACPSELGGIVLVTSTG
                     IVHVDQGGRVTAACVNAWWSRITSLKCSMASVSQKLTLEGSRCVFVTPHDMLLVLQNG
                     AVHQVRFSMEGRAVGVIEVLDKGCVVPPPSDLTVAGDGAVFVGSAEGDSWLAKVNVVR
                     QVVERSEKKKDEMEVDWDEDLYGDINDAALDEKAQELFGPAAITLSPYDILTGVGKIM
                     DIEFGIAASDQGLRTYPQLVAVSGGSRNSTINVFRRGIPITKRRRFNELLNAEGVWFL
                     PIDRQTGQKFKDIPEAERATILLSSEGNATRVFALFSKPTPQQIGRLDGKTLSAAPFF
                     QRSCILRVSPLEVVLLDNNGKIIQTVCPRGDGPKIVNASISDPFVIIRRADDSVTFFV
                     GDTVARTVAEAPIVSEGESPVCQAVEVFTDTTGVYRTFEPSKSESSEPISHQIDSENK
                     PNITNGINGTTARSARQTQLTPQQIKRLQEQEPAITTEAPSMETAINSPHGTQWLALV
                     TRGGELQIRSLPDLQIVLQSEGLASSAPSFTDDLGENPGYVLGEKREEGEEEDEIIQM
                     VFCPIGKGTVRQHLLALHHSGRLNAYEAQPRFTVDASSHSRRSLAVRFRKVHTQLLPI
                     SGGVGTTNGNARLPYTIVPFNNIEGLTGAFITGEKPHWIISSEAHPLRAFALKQAAMA
                     FGKTTHLGGKGEYFIRIEDGSFICYLPPTLNTDFAIPCDRYQMERAYTNITFDPTSAH
                     YVGAASIEVPFQAYDEEGEIQLGPDGPDLIPPTNQRSTLELFSQGSDPWKVIDGYEFD
                     QNEEVMSMESVNLESPGAPGGYRDFIAVGTGFNFGEDRATRGNTYIFEILQTVGPQGG
                     GGPGSVPGWKLVKRTKDPARHPVNAVNHINGYLLNTNGPKLYVKGLDYDSQLMGLAFL
                     DIQLYATTVKVFKNFMLIGDLCKSFWFVSLQEDPYKFTTISKDLQHVSVVTADFLVHD
                     GQVTFISSDRNGDMRMLDFDPTDPDSLNGERLMLRTEYHAGSAATVSKVIARRKTAEE
                     EFAPQTQIIYATADGALTTVVSVKDARFKRLQLVSDQLVRNAQHVAGLNPRAFRTVRN
                     DLLPRPLSKGILDGQLLNQFALQPIGRQKEMMRQIGTDAVTVASDLQALGGFW"
     gene            complement(249818..265172)
                     /locus_tag="CNF00790"
                     /db_xref="GeneID:3258400"
     mRNA            complement(join(249818..250227,250285..250759,
                     250813..250964,251018..252073,252127..252229,
                     252280..254560,254615..255321,255375..257253,
                     257305..257760,257820..259775,259833..260012,
                     260061..260281,260335..261312,261363..261460,
                     261515..262078,262134..262973,263032..263277,
                     263335..263534,263589..263715,263774..264107,
                     264165..264688,264748..264891,264954..265172))
                     /locus_tag="CNF00790"
                     /product="motor, putative"
                     /transcript_id="XM_571532.2"
                     /db_xref="GeneID:3258400"
     CDS             complement(join(249971..250227,250285..250759,
                     250813..250964,251018..252073,252127..252229,
                     252280..254560,254615..255321,255375..257253,
                     257305..257760,257820..259775,259833..260012,
                     260061..260281,260335..261312,261363..261460,
                     261515..262078,262134..262973,263032..263277,
                     263335..263534,263589..263715,263774..264107,
                     264165..264688,264748..264891,264954..265065))
                     /locus_tag="CNF00790"
                     /codon_start=1
                     /product="motor, putative"
                     /protein_id="XP_571532.1"
                     /db_xref="GeneID:3258400"
                     /translation="MASSQLEDGALIPPSTSGGLVFDVGVFRTYLQSLLSLVMSATPQ
                     ELGDSLFEDPNFDEKTVRFATDASCQVVYITRERYLDVDEDGTPIARITYRLHLPPTP
                     PHSPNTLSTLALIKTSPTIDSLNPLGTQLHFLQLSSAFTAPSLVEDDGTPSGTTTVVA
                     TPTVNASAQSTPYDGLHSLVHWGVAPWFDSYVSSKQSLIPGHGGAHDGLGKKGNEAQM
                     GIPVTKKKFAELELSLLHLKQNVEIPEVHLSVHPAIRKAVAHCHATNQRVSPDAVEPQ
                     SLLSDPLFLNKLQADVNSWIKEIQAVTKLNRDVASGTASQEINFWTSMEHALEGIEQQ
                     LGGEEVTLVLDVLKHAKRFHATVSFIADTGLKEAADLVHKHNILMKDFPLDELLAATD
                     LEKIQDAIYLIFAHINKKLKLSPYPIRRTLPLVEAISSDFNDQLLKVLSSQRLMYMDY
                     TKFEEVMATAAEVFATWDENMKDFTNVAREVSRKRAEKFISIKINPIHAKLQERITYL
                     RAFRRSHEQLRVMTSSTRSFSGLGNDVPFDIDMEEEVRLSYENVKNVNVLDVSPEGSE
                     IWYTAETAYNDRVARIENQIISRLRDKLATARNAQEMFRVFSKFNTLFVRPKIRGAIQ
                     EYQTRLIESVKEDIHRLRQKFTENYRNSQAYHMSQMRDFPSVSSAIIWARQIERQLLT
                     YMKRVEDVLGKGWESYAEGHKLQMESASFRTKLDTRPLYDAWISDITKRGNLTITGRL
                     FDVIRTRATATNAQGQLQLVVQFDPQVIALFKEVRSLIWLGFPVPLTISHKAKDAKRV
                     YPHAVSLMESVKTYTQTLELIESNPDVAILLASYRSHALQMIERGIKMQWDHLVNAYE
                     GHRFLPGSANDSRESRHFLFVREFASVVSLLQDKANALIEIYTDINRIVEELAVCEYT
                     PDTFSSLLGQIQKTIDHLNLENYSNLDAWVATLNEKIDKVLCERLVNAIEIWCAEFGK
                     DEEAAGWDATVPGGNGPKGDMKIEPLVHEIRIRNQVIYLDPPIELARQEWLGQFQDAL
                     GVICNLGRIRSSRYEISLQVEEASLEETTYVGLLTSFADGTLEKPLALIEDKVQTVSS
                     YVNKWLQFQSLWDLEAEYVYSRLGDSLADWGQLLSDIRQTRSTFDTADTKKDFGACVI
                     DYANAQSKVNAKYDSWQRELLARYGAKLGVCMKDTYNAILKARTDLEGLAIEGSSTAR
                     AVSFITFVQDLKRKVQKWGPEIEEFDRGQKTLERQRYSFPTDWLYIDQIQGEWGAFSE
                     ILKRKDDSIKEQVAGLQLKIVAEDKVIDQRIRDFIAEWEENKPLQGSIKAETAINTLN
                     VFEGRLARLLEEYNLVCRAKEALDLEHAKDDRLQPVNEELRDLKAVWTALSGIWGRLA
                     QLRETLWTAVQPRKLRQELDAILSSTRDMPSRMRQYAAFEYVQDTIKTLLKSNALIGE
                     LKSEALRERHWSKLYKALRMPTHQAPSMTLGQVYDLDLRRNEALIKEVVVQAQGEMAL
                     EEFIKQVKETWTSYSLDLINYQNKCRLIRGWDDLFNKCGEHLNSLTAMRMSPYYRIFE
                     EDAASWEDKLNRIHVLFDVWIDVQRQWVYLEGIFSGSADIKHLLPVESARFQNINSEF
                     LTVMKRVNKSPFVLDVLNIQGIQKNLERLADLLTKIQKALGEYLEKERSSFPRFYFVG
                     DEDLLEIIGNSKDTRRIMKHLKKMFAGISTLRMDEEETQLLGFSSREGEEVYFRTPVV
                     LKDFPKINDWLAKVESEMRLSLAYLLSQAVTELNGFFKVDTSLSLDDLLAWTDSYPAQ
                     LVVLAVQVAWTNLIESSIATAGLTSVLALVSQTLDLLADTVLQDIAVLQRRKCEHLIT
                     ELVHQRDVIRSLITSGTKSTTSFDWLYHMRFYLNENVSDPLLKLEIRMADAVFPYGYE
                     YLGIPDRLVQTPLTDRCYLTLTQALDKQLGGSPFGPAGTGKTESVKSLGVQLGRFVLV
                     FCCDETFDFQAMGRIFIGLCQVGAWGCFDEFNRLEERILSAVSQQVQSIQQGLAQAAS
                     NPDAEIELVGKKLKINSRTGIFITMNPGYAGRSNLPDNLKKLFRSMAMTRPDQELIAQ
                     VLLFSKGFRTAEVLASKVVPFFNLCAEQLSDQPHYDFGLRALKSVLASAGILKRDRHL
                     ALGQGDGTDSGTDGFVEQQIMIQSVTETIVPKLVADDVPLLKALLEDVFPGVEYVPVN
                     LDALKVKLDEVCKERHLIAKESWLEKVIQLYQIQNISHGLMMVGLSGSGKTQAWQVLL
                     AALERLDGIEGTSYVIDPKAIDKEALYGTLDSTTREWNDGLFTHILRKIVDNVRGETA
                     KRHWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLNLPPNVRIMFEVEHLRYATLA
                     TVSRCGMIWFSDDVIDTSMIYSHHLDMIAVLPIGTDEDETLDYATGVDSDTVASRHLD
                     VQRQIVGMLKPHFQQEGLVNKALEYAAKSEHIMEFTSARALNTLFSLLKATIRHVLEY
                     NTRHSDFPLSTEKVEVYVLRRLLLNIIWAFVGDAKLEIRAEMGKYLVQESGIETPPLG
                     PGASLIDYDVDVSSAAWVAWQSRVPTIEVETHAITSADVVIPTIDTVRHEEVLYSWLA
                     EHKPLILCGPPGSGKTMTLFSALRKLPDLEVVGLNFSSATTPELILKTFEQYCEYRKT
                     PNGVVLAPTQIGRWLVVFCDEINLPAIDKYGTQRVISFLRQLMECNGFWRTSDLSWVK
                     MERIQFVGACNPPTDPGRVPLSHRFMRHAPVVMVDYPGEISLKQIYGTFNRALLKVIP
                     ILRGHSGALTDAMVSFYLASQKRFTADIQAHYIYSPRELTRWSRGIYEAIKPLETLSV
                     EGLVRVWAHEALRLFQDRLVAEEEKQWTDDLIDAIVSEYFPSVDVSDALARPILFSNW
                     TSRNYIPVNRDQLREYTKARLRVFYEEELDVQLVLFNDVLDHVLRIDRVFRQIQGHLL
                     LIGVSGGGKTTLSRFVAWMNGLSIYQIKVSNKYTGADFDEDLRTVLRRAGCKGEKICF
                     IMDESNVLDSGFLERMNTLLANAEVPGLFEGDEYAALMTACKEGSQRDGLMLDSHEEL
                     YRWFTQQVARNLHVVFTMNPPANGLASRAATSPALFNRCVLDWFGDWSDQALYQVGLE
                     FTQTLDLDVASYVPSASFPIVYRDIPVPPSHRQAVVNAMVYVHQSMQSLTTKLAKRQG
                     KYNHVTPRHFLDFINHYVRLFNEKKEDLEEQQRHLNVGLDKLRETVSQVEELRHSLAA
                     KSSQLEAKNDEANQKLKQMVTDQQEAEAKKAASIDIQAALERQDEFIRQRQEVVKEDL
                     ALAEPAVLEALAAVGNIKKQHLSEVRSMANPPEAVKMAMESACTVLGHQIDSWRAVQG
                     IIRREDFISSIQNFDTKKMSKVVRDRMNRDYISKPAFNFETVNRASRACGPLVQWVIA
                     QVRYSEILEKVAPLRQEVASLEKQADATKQQVQVAMDTIAELESSIARYKDEYALLIS
                     ETQSIKSEMDRVQTKVDRSMTLLQSLSSEQERWDIGSKTFETEMGTIVGDVMVSAAFL
                     AYSGFFDQHYRDLMKREWTDHLSEAGISYKHDLALSEFLSTADERLGWQANALPADNL
                     CIENAVMLKRYNRYPLIVDPTGQATAFLQNEYRDRKITVTSFLDESFLKKLESALRFG
                     NPLLIQDVENLDPILNSVLNRELRRTGGRVLIRIGNQDIDFSPAFTMFLSTRDPSVEF
                     SPDICSRVTFVNFTMTRSSLQTQALDKVLKAERPKVDQKRTDLMKLQGEFRLRLNHLE
                     RSLLQALNESTGSILDDDKVIETLEVLKKEAAEITRKVEDTEVVMREVEAVTGEYQPL
                     AQACSGIFFTLEQLASINHFYQFSLDYFLEIFDYVLLHNPRLKDVSDMEIRKSILLQD
                     IFLTAFQRTSRSLLHTDYLVLSVTLAKLRLRGEEGPKVLQELDAVLEVPSGGIAKDLK
                     LTMEQKKSLDGILGGEMSKVFEQDLINNEERWRSFMAAAQPEKDVPWPWSEGDALFTA
                     ARRMLVIKIFRPDRLLQSMTIFADLAFDVDLAAQADYDVQAIVTEQVGPTHPVAFASV
                     PGYDASYRVENLCRSMGVSCTSVALGSAEGFTLADQAIAEAARTGSWVLLKNVHLAPG
                     WLAQLEKRLHSLSPNHDFRLFLTMETNPVIPVNILRQSRIIMNEPAPGVRANLLDTLR
                     GIPQSLSSSGPAEQPRLFFLLAWFHSVVQERLRYLPLGWSKGYEFNDSDFDAALTTIN
                     SWITALAKGKANVDPAQIPWVAIRTLIKQAAYGGRIDSDYDQRVVDAFVDRIFTLRAY
                     DPDFKLVELGDGQPSLSVPEGTQMSHFIEWAQGLPEREPPSWLSLPPSAEGVVAAAEG
                     DAIMVKLRKMRTTEDDEDVSDPVSGVSFGRPAWMTSLKSHADEWLSTLPEALSSTPHE
                     LSHAHSPLSRFFAREVSTGSKLLKRIRHDLFDLIQVCLGDLKQTNELRALMSDLNKGT
                     VPAHWCKFKMPRGTAVNQYINNLAARLAQLERLADGAVEAQQDVWLGGLFQPEAYITA
                     TRQAVAHERGWSLEQLVLSMDISQTGGQGAFAIQGLTLQGASWTSGRLQLNEGQAILL
                     PPSQLTWKRHDEAPRTSGATLVNLPVYLNGDRNDVLFSVDLETDEEDGDVIVQRGVCL
                     TAA"
     gene            complement(265283..266896)
                     /locus_tag="CNF00800"
                     /db_xref="GeneID:3258180"
     mRNA            complement(join(265283..266678,266729..266896))
                     /locus_tag="CNF00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_571530.2"
                     /db_xref="GeneID:3258180"
     CDS             complement(join(265620..266678,266729..266779))
                     /locus_tag="CNF00800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571530.1"
                     /db_xref="GeneID:3258180"
                     /translation="MKYALFALALAGAVSAQSNSTANSTESILIPANITSSCSSFLSE
                     LNSDSTLSSCVTPLINATASFSPTAVASANLTEDTINYTLASICKGTGGCDDSTIRKW
                     LGKFYSECYAELTSSTGYNSEVRELYDILYVVNPLKAAVCAVDSSNQEYCVNEIVQSE
                     SISTSNSTASNSTAADDASASTNATALFASFAAADSALSPVEVAVSNLYIEVSSAASS
                     LKKRFLDTVLSRRAAQSVNMATIITPNVTTYKNTNLPFLFLQSSMDSSALCTPCTREV
                     MVAYIKWETQMPYALGLRQSPILGGQSALWSAINSTCGTAYVNAITSEVGSTLSSSNG
                     SSSGAESLFVGQGGLSGLTAIVGATVVAGVMGLLI"
     gene            267133..268555
                     /locus_tag="CNF00810"
                     /db_xref="GeneID:3258493"
     mRNA            join(267133..267254,267305..267336,267388..267469,
                     267553..267626,267730..267869,267932..268172,
                     268248..268290,268347..268555)
                     /locus_tag="CNF00810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571493.2"
                     /db_xref="GeneID:3258493"
     CDS             join(267212..267254,267305..267336,267388..267469,
                     267553..267626,267730..267869,267932..268172,
                     268248..268290,268347..268396)
                     /locus_tag="CNF00810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571493.1"
                     /db_xref="GeneID:3258493"
                     /translation="MPAKRMPRVYLVRHGETEWSLNGRHTGVTDIPLTANGEKMVLEM
                     SPRMIGPGKLINPAHLRHILISPRRRAQRTAQLLFGENAPPECNIITDPEVAEWDYGA
                     YEGMLSKDIKKEAPNWSIWDDGCPPGETPGESPAQMSARVDRVIAKVRALHAEAENAA
                     ENADEVDYSDVMIFSHGHFSRCFIARWCDLPIKAGYHFAAEAGGLAVLGYQHKSLKEP
                     SLLGLNWYTEDALERR"
     gene            268755..271114
                     /locus_tag="CNF00820"
                     /db_xref="GeneID:3258426"
     mRNA            join(268755..269430,269504..269509,269563..269618,
                     269701..269719,269783..269850,269911..269940,
                     270024..270569,270629..270976,271031..271114)
                     /locus_tag="CNF00820"
                     /product="expressed protein"
                     /transcript_id="XM_024657340.1"
                     /db_xref="GeneID:3258426"
     CDS             join(269568..269618,269701..269719,269783..269850,
                     269911..269940,270024..270569,270629..270790)
                     /locus_tag="CNF00820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513000.1"
                     /db_xref="GeneID:3258426"
                     /translation="MSSTLGHHFAHPTNKFWKALYQSGLTSRLMSPTEDYKVVDEYNY
                     GLTNLVGRPTSEQSELSTLEMKLNTINLLQKFIKYQPSVVCFVGKKIWDVFESVVGKT
                     AEFDETVKQKVKLEGEVENGEGSGDGGKGRSVMTLAPTPERGTVKIEPAELGDQPSLL
                     PLSASPSKTPQLTPAQTASLSPAKARAKKGAIKPPKTPFSFSQPRALRIPHPPEDNGG
                     EIKYTYFFVVPSTSGLERTPFPEQVANFAALKALVDELKKGRSLQGDFLNISVEGVEG
                     TVEDMRRAAILKNAL"
     gene            271613..272521
                     /locus_tag="CNF00825"
                     /db_xref="GeneID:36392891"
     mRNA            join(271613..271919,271979..272305,272370..272521)
                     /locus_tag="CNF00825"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658557.1"
                     /db_xref="GeneID:36392891"
     CDS             join(271664..271919,271979..271986)
                     /locus_tag="CNF00825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514485.1"
                     /db_xref="GeneID:36392891"
                     /translation="MSHLAPTSLVRPHKTSMAELKLRRLNEHNARLREDLARPRVRVS
                     EASISLIKYCSNTKDPLLPSVWGPPGKGEDPYAPPDTGCCIIM"
     gene            complement(272370..275052)
                     /locus_tag="CNF00830"
                     /db_xref="GeneID:3258252"
     mRNA            complement(join(272370..274039,274096..274158,
                     274209..274236,274283..274346,274395..274518,
                     274590..274630,274724..274762,274816..275052))
                     /locus_tag="CNF00830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571248.2"
                     /db_xref="GeneID:3258252"
     CDS             complement(join(272432..274039,274096..274158,
                     274209..274236,274283..274346,274395..274518,
                     274590..274630,274724..274762,274816..274840))
                     /locus_tag="CNF00830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571248.1"
                     /db_xref="GeneID:3258252"
                     /translation="MGFNSPIPVRLQEESRKAAKILRSFVDANNNGLDKVIPRTVLER
                     AEGFAIFTVFKAGFLFSARAGSGVVVARLPDGSWSPPSAIGLGGLGFGGQAGAEVTDF
                     LIVLNSRSAVTSFMSAGSLTIGGNLSVAVGPLGRNAEGSGALNSKGKVAAMYSYSKTK
                     GLFGGVSVEGSVILERQDANRLAYGGSPSSKQILSGMFDPPEWADVLIDQLEKSTGLP
                     GGQRWTSRDEAGEGGGMGWSTPEAGKGGGGYVFGEGVGAGGSVGSGRKRAGSLFGKDP
                     DRSNSPSRPGMPRRSSILNPFSSGTSSPRKGSTGPQHTSEAYNAGLTWDSQGPTGVGT
                     GNGTSAGRARSGSLRKDGEVPQPFSYMTAAKLKEDSKGKDLLGEWDSASFNSAKPRSR
                     NNSDGGDRDLLGHWDSNGHGLSAHFDRLSTNDTRSRSNSRSNRPPFDDILEYPKKPST
                     STSYAHASGEPDYTPRESISNFAKTDWSSFEDQQRYDSPSKKTRPFSSYISPARKSSP
                     SKDFPPFDDDAVGRLRSSSAGRPFEDYRHQSDRYGSPSYDFSPRKLSASSPIPEIRLK
                     PGLDTTDDGYARAVAMFDFKPGAAGDLGFKTGDVVIVLDYAGDSSEWWEGRLASEGSA
                     GRKGIFPCTYVEVLALPKDLRGGVSRSDLRRRIARNEFD"
     gene            complement(275540..275639)
                     /locus_tag="CNF00840"
                     /db_xref="GeneID:3258317"
     tRNA            complement(275540..275639)
                     /locus_tag="CNF00840"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3258317"
     gene            275835..276735
                     /locus_tag="CNF00850"
                     /db_xref="GeneID:3258368"
     mRNA            join(275835..275932,276055..276194,276258..276349,
                     276426..276735)
                     /locus_tag="CNF00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_571249.2"
                     /db_xref="GeneID:3258368"
     CDS             join(275909..275932,276055..276194,276258..276349,
                     276426..276475)
                     /locus_tag="CNF00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571249.1"
                     /db_xref="GeneID:3258368"
                     /translation="MNKPNYPTMQQDGQQMYQASDGQWYPMSAMPQDWHGSQQPPQPG
                     YGGYQQQQGYHGQQPMYATQPVYVENNRGAGVGAGAATGICAGLCAGLLCFDLCLFC"
     gene            complement(276683..278111)
                     /locus_tag="CNF00860"
                     /db_xref="GeneID:3258439"
     mRNA            complement(join(276683..276814,276863..277242,
                     277292..277807,277859..278111))
                     /locus_tag="CNF00860"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_571511.2"
                     /db_xref="GeneID:3258439"
     CDS             complement(join(276754..276814,276863..277242,
                     277292..277807,277859..278056))
                     /locus_tag="CNF00860"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_571511.1"
                     /db_xref="GeneID:3258439"
                     /translation="MDALLAEISAKRKALEVPEGDAGAKKYMRRADIERMREEEERRK
                     KEEERKEKEAKKAQEAKEKTVKAEARHAALARVQAASPSSLRSTPDPTIPSEERFNIS
                     PEECIRRLRQKGQPIRLFGESDKDRRLRLRALELLEERGPSGGQGRNDFKKALEEMES
                     GLDKKDVERKARELHRLAEERGKKEGSAASGEGDSKEVDGKEGKDDKKKKGVDMGILD
                     LKLIKTDPNKLYPIIYYALKGVLKEWEEWMDNRPEEIRRSTQGKLAAANQVQSAQSLK
                     PLFRSLRSRDLAPDVLRLLAEIVHHMQSRSYQKANDAYLRLSIGNAAWPIGVTSVGIH
                     ERSAREKIGQDNIAHVLNDEVTRKYIQAVKRLLTFSQTIRPPEDASQLMG"
     gene            278246..279317
                     /locus_tag="CNF00870"
                     /db_xref="GeneID:3258341"
     mRNA            join(278246..278320,278441..278638,278728..278792,
                     278898..278977,279050..279317)
                     /locus_tag="CNF00870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571495.2"
                     /db_xref="GeneID:3258341"
     CDS             join(278311..278320,278441..278638,278728..278792,
                     278898..278977,279050..279152)
                     /locus_tag="CNF00870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571495.1"
                     /db_xref="GeneID:3258341"
                     /translation="MAKVPRSFRLLSELEHGEKGIGDGSCSYGLKDGDDIAMYEWNGT
                     ILGPPHSAFENRIFSLSIYCGDNYPDVPPLVKFESRISLPCVNQQGLVDFSRINSISK
                     WNRNFTLETVLVELRRDMASPANRKSSQPPEGVDFPPLDLRALAQQRGL"
     gene            279526..282083
                     /locus_tag="CNF00880"
                     /db_xref="GeneID:3258027"
     mRNA            join(279526..281140,281196..282083)
                     /locus_tag="CNF00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_571497.2"
                     /db_xref="GeneID:3258027"
     CDS             join(279933..281140,281196..282027)
                     /locus_tag="CNF00880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571497.1"
                     /db_xref="GeneID:3258027"
                     /translation="MPSFMSPSSGVSILPDMRPPKSPRRFFTFSISSSSLPPLPPLTP
                     SVSHSSRGNDHSSNGVTVVRTPQDAAGGMRQAAGLISPPSNQTPLPPVPPLPSLSSLP
                     NLASQARYPQPSTDTHTHGYRHQPSKSVDNSNIYASGKLERMGVHRSTSARDDLRGGL
                     NKSTRGLVKSPSAAPVLGERNESEESDRLGPMPTTPGRPLRGSSFLSPGHSKSQSTSA
                     SYVSSSSASFHSRSKSVARSPRTSTTTTSSTSPSISTAPLSSPAKRPSLISNRSTVKP
                     PPRSSSLPRIDTPFSAALLLCTRKSLPKLSSGEQDSITLINIEFAYSFADPPRNESVT
                     LPLETLKKGGGKLYDWVVDCLKTQEYEEEKKAEEKEAIREEKKLPEMTDGESAEESDW
                     DSDGDLSALLRDEYFKSLIVSSSSPASHTTPLPSISSPPTKILDLPPFANDSKSPALP
                     KPPKTTPGYKRAQTRNQYTQLVSKPRVPGNAIEPAVPPLAYAAASPTGLTLPLNVKRK
                     GSRRLSISHISQEAEASTPTKSKKEGVFTEMRVFLTREAGVYHQISHRLISGQWNVWA
                     NIGGREARERVEAELEWLGMADLLQEMRRPTLGLNPSRSQSKDLNLGLGLGLGGQETG
                     RVNEMLIDDFGTPERPVKSERRTEGIKTLCGERKLEGKWRERAREKSLVLRGGYI"
     gene            283167..287310
                     /locus_tag="CNF00890"
                     /db_xref="GeneID:3258174"
     mRNA            join(283167..283245,283301..283372,283425..283514,
                     283569..283702,283767..284339,284387..285740,
                     285788..285873,286055..286128,286179..287310)
                     /locus_tag="CNF00890"
                     /product="importin beta-4 subunit, putative"
                     /transcript_id="XM_571503.2"
                     /db_xref="GeneID:3258174"
     CDS             join(283240..283245,283301..283372,283425..283514,
                     283569..283702,283767..284339,284387..285740,
                     285788..285873,286055..286128,286179..287032)
                     /locus_tag="CNF00890"
                     /codon_start=1
                     /product="importin beta-4 subunit, putative"
                     /protein_id="XP_571503.1"
                     /db_xref="GeneID:3258174"
                     /translation="MDPNYISTLRQLLEASIAPDTSLIKAATTQLNTQFYKDPNCIPS
                     LYEVSCTSENPAIRQLAAVELRKRISAGDGKMWKKNPQQLRDQIKESLLQRLTSETSS
                     IVRHAQAQAVAAIADIELTVTPPQWPTLMPGLYQAAGSADKAHRETAIYVLFSILDTV
                     AESFESHLQSLFKVFSVSLVDPESAEVRVTTLRALAKVAEYIEPSDKHDIKAFQDLIV
                     PMLKVLEQAIKDGDDEGVKHGYDAFETFLILEAPLVSKHVAELVQFFLGAASNKEVED
                     EMRCGALNVLSWVIRYKKSKVQALGLAKPIIEGLLPIGCEDDPEDVDEDSPSRLAFRT
                     LDNLAQVLPPQQVFPVLTQQLQVYMSSGDARMRKSALMAFGVSVEGCSEYIRPHVDQL
                     WPVIEGGLQDGEVIVRKAACIALGCLCEWLAEECATRHSVIVPILFNLIVDPATQKNA
                     CTCLDSYLEILGDDIVNYLTLLMERLLVLLENGTVAVKITVTGAIGSAAHAAKEKFIP
                     YFGQTIQRLVPFLELNENDEQNDLRGVATDTIGTIADAVGADVFRPYFQPLMKAAFEA
                     LTMDNSRLRESSFIFFGIMAQVFTGEFAQYLPQCVPALVASCQQSEVSEELDEEGNSN
                     PAQLAEAFSMAAGSSKNAGELLDDEEDDTDLAALDDMFSKVNSAVAIEKEVAADTIGE
                     LFAATKSAFMPYVEETVKVLIDLLDHYYEGIRKSAVGALFQYIKTMYELSEAPEWQPG
                     AKIAIPLHEHVKSIVNLVLPPIFETWKTEDDQSVVIFMCSELADTMNKCGPAVIEGYL
                     DEVATFAIEILEKKSLCQQDPDGDDEGAAEADSSEYEAALVSNAADVFGAMATVLGPD
                     FQQAFGQVLPLIAKYTESKRTNTERSMAIGSLGEIIVGLKSGVTQFTEPLFQVISRGI
                     VDEDPDVRSNAAFASGVLIENSDADLSSHYPALLHALHPLFTPPEHAPPALYNARDNA
                     AGSVARMITKNAAALPLADVVAVIVSVLPLRFDPLENRAVYKALFQLFRTQPDLVMAH
                     IDHLLQAFAYVLLDPSHADDTTDETKAELKALVEHLKSQVPDKVAAAGFA"
     gene            287527..289093
                     /locus_tag="CNF00900"
                     /db_xref="GeneID:3258221"
     mRNA            join(287527..287664,287763..287856,287929..288204,
                     288258..288494,288546..288798,288851..289093)
                     /locus_tag="CNF00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_571250.2"
                     /db_xref="GeneID:3258221"
     CDS             join(287545..287664,287763..287856,287929..288204,
                     288258..288494,288546..288798,288851..289022)
                     /locus_tag="CNF00900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571250.2"
                     /db_xref="GeneID:3258221"
                     /translation="MPPRRQSQASQTKGKQPAQETQDDSDEETQGGRSGPLTDADIES
                     RAGMLVRLALFQEYKRIPIRRTEVAKQILPDNTRAFPLVFARAQTILRDTFGCELYEI
                     RARGKGESTEDPSQTQAMTQTQKKGKGKGRQPNRGLDAIDEEEEEEDEEEEDATITQK
                     VKRETGTKVYILQNILPGKIIEAMAEPAPLPHGIEVEGDDDDSGALLQWDKGDGGIIG
                     HVGLLGIRTLILSLVLCHNRIINDDHLHALLRRLNLHRETVLPYASKDTTDPHLTLDK
                     YLELLAKYQYLEKIKNPGPMGQAEGGTVEWKWGSREAEFSSKAAAKFMEEIMLGKEGE
                     SDSEEEDEDQPRRRGRGAPRERASRPQKRQKLRDDIIKAAGGVPLSGRD"
     gene            289213..290333
                     /locus_tag="CNF00905"
                     /db_xref="GeneID:36392892"
     mRNA            join(289213..289614,289691..289706,289766..289795,
                     289865..290333)
                     /locus_tag="CNF00905"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658558.1"
                     /db_xref="GeneID:36392892"
     CDS             join(289225..289614,289691..289706,289766..289795,
                     289865..290208)
                     /locus_tag="CNF00905"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514486.1"
                     /db_xref="GeneID:36392892"
                     /translation="MNPSYFLPSGPSHYNSSSSSASVSNSNSISPEPRHSAHYGQRQH
                     PHQHLHPQQNYNHQHASMSEHGQEEYPPVPLQTGPMIAPHQDLHSFLESFWTRQMDTV
                     EGETPDWKSYNLPLARIKKVMKSDEEVKMISAEAPIMFSKACEIFISELTCRAWLVAE
                     SHKRRTLQKSDVAAAIAYSDMFDFLIDIVPRDDGGVGGGGSGGGVGGSGTVTGAGSVV
                     ADEGMERDEDDPEGDEGEGEGEGFDGQEEEGDLYSEYVQGD"
     gene            complement(290324..293177)
                     /locus_tag="CNF00910"
                     /db_xref="GeneID:3258098"
     mRNA            complement(join(290324..291193,291258..291347,
                     291452..291607,291684..291780,291837..292277,
                     292337..292377,292424..292550,292619..292717,
                     292808..292883,292951..293038,293095..293177))
                     /locus_tag="CNF00910"
                     /product="glycosyl transferase, putative"
                     /transcript_id="XM_571251.2"
                     /db_xref="GeneID:3258098"
     CDS             complement(join(290466..291193,291258..291347,
                     291452..291607,291684..291780,291837..292277,
                     292337..292377,292424..292550,292619..292717,
                     292808..292883,292951..293038,293095..293134))
                     /locus_tag="CNF00910"
                     /codon_start=1
                     /product="glycosyl transferase, putative"
                     /protein_id="XP_571251.1"
                     /db_xref="GeneID:3258098"
                     /translation="MFSTAASPYDDLVIKATDENLASEDWALNMDVCDKVSSDGQNGA
                     RQAVTALQKRLSHRNPNVQIYALELANSLAQNCGKDLLGELSSRNWTSALDRLINDRA
                     TSTPVKKKALSFVKSWAKQIEETGDPNLGLMGELYDQLRAKNHVFDEPEPTPESAEEV
                     RRRQEEEELQRVLELSKQDKGGRSLFTYQPSGSAGASSSSAANNNTSPSIPQSQAQPL
                     AQDQAQSQAAPQVTGYAPQPQKIYSPQPLEPEPPRVDLNTATRVRAIYPFTGQEVGEL
                     DFERGDVIKVLDRGFKEWWRGACNGKIGIFPVTYVEALPEPTPKELQEKAQEEARVFA
                     SLGLVDQLLQTLKGIDPARGDKLDDHPEIEEMYQASVALQGQINTLIKKYSDQKAELE
                     HMNANFIRAMGQYEELRNGPPLVQAQPFGYVPPQPQPLLQQQNSYSYQQYPQQPQQQP
                     QPYAQAPYAQQAQPQLQPEQYAQQTPSPAAQSQASYTAQQQPYPAQVQQDPAAASPPP
                     NQPFYHHGGSTTSVNRIPSAQTAVQPQPHGAPSFPPSSPPTRQVTEPGVAGLGAGDQQ
                     AWDQYYQQHGQQAPHSSQHPSQPQSQPQSQPQSQPQSQQGSYYPAHAQAQGYQAAYAT
                     VPDGRAYASPPLPGTQQGQGVEGVTAGMDRMSVHAP"
     gene            complement(293258..295896)
                     /locus_tag="CNF00920"
                     /db_xref="GeneID:3258111"
     mRNA            complement(join(293258..293563,293627..294115,
                     294173..294927,295013..295172,295246..295400,
                     295465..295571,295651..295896))
                     /locus_tag="CNF00920"
                     /product="mannosyltransferase, putative"
                     /transcript_id="XM_571671.2"
                     /db_xref="GeneID:3258111"
     CDS             complement(join(293318..293563,293627..294115,
                     294173..294927,295013..295172,295246..295400,
                     295465..295571,295651..295814))
                     /locus_tag="CNF00920"
                     /codon_start=1
                     /product="mannosyltransferase, putative"
                     /protein_id="XP_571671.1"
                     /db_xref="GeneID:3258111"
                     /translation="MALPGTETIRFRRPTAGPNAVEQKKEEPKKDEFGSLAPVGWKRR
                     HQGLLQDQLKRNQQGPFIPSLSLALRLLLLVRTAAAMYSIISDCDEVFNFFEPLHYFQ
                     YNHGFQTWELSPQFAVRSWAYILLHWPLAHLGPKLLGLGKRPAFFALRICLGTICSFC
                     EAKFFRTVVETVNERVGRYLLFAMILSAGMWSASVAFLPSSFTMYTTMLASSYWFQPA
                     TSTPQGTIRTYRATFFYALGAIVGWPFSAALGIPFVFEQLFLGGGEIVPTELKHIWRS
                     KRWDTMWKAVTMSASIIVPVYLIDSWVYGRLTFPTLNIITYNLFSGNGPELYGTSPPT
                     FYFANLFLNFNFFVPLALLSLPALAVTYKYDFRRLGRTQMAPREGETSPYVLLATRLA
                     PFYVWFAILTAQAHKEERFFFPAYPLLCFNAAVTIYLIRGWMEKVYVHFTRSPYNASR
                     SSIFSNFTLLAVLLPCLLSVGRIAATYYFYHAPFDIVHHFQYSTLPGILSNLGYEPIP
                     VAEDYQPYGKEESEIQWDLSPLQDLDEPISICYGAEWYRFPGSYLIPEGVQVNFVKTE
                     FDGMMPRKWEESERKGRWPRSETRVIRPGRFNGENKASLEPGTFVDPSECTYMVSLSL
                     VSQTPTELEPDWTRSPEWEKEFCTPFLDGASSKWWSRLIYLPWDLLDSGRVYGEYCLM
                     HRKGAVHGA"
     gene            295981..296808
                     /locus_tag="CNF00930"
                     /db_xref="GeneID:3258078"
     mRNA            join(295981..296198,296256..296278,296336..296537,
                     296633..296808)
                     /locus_tag="CNF00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_571252.2"
                     /db_xref="GeneID:3258078"
     CDS             join(295996..296198,296256..296278,296336..296537,
                     296633..296696)
                     /locus_tag="CNF00930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571252.1"
                     /db_xref="GeneID:3258078"
                     /translation="MPIPFFGKQQQDGQQSAQERQQQQQPMETPTHHVPQVDRFENTL
                     KDELKLQELQYPTADDVPGCMRLLDEFLMCYALVPQLRNIYRHGELHNCSWKFQDFKY
                     CMSLKSEDPEGKRELWVKRRAEWWARRRVGVSSEDVWDVRTEKLENFPPLGEEVTSET
                     STT"
     gene            complement(297732..299366)
                     /locus_tag="CNF00940"
                     /db_xref="GeneID:3258118"
     mRNA            complement(join(297732..298411,298462..298589,
                     298640..299025,299089..299174,299229..299366))
                     /locus_tag="CNF00940"
                     /product="structural constituent of cytoskeleton,
                     putative"
                     /transcript_id="XM_571575.2"
                     /db_xref="GeneID:3258118"
     CDS             complement(join(297843..298411,298462..298589,
                     298640..299025,299089..299174,299229..299301))
                     /locus_tag="CNF00940"
                     /codon_start=1
                     /product="structural constituent of cytoskeleton,
                     putative"
                     /protein_id="XP_571575.1"
                     /db_xref="GeneID:3258118"
                     /translation="MSAPEVFQLSFGPLTGVAFSPDRTHVAVSPNNNEVHIYQRQGAE
                     WIHKDTLAEHDKLITAISWAPNSNRIVTCSQDRNAYVWTPTESGWKPALVLLRINRAA
                     TCVKWSPNEDKFAVGSGARTIAVCYFDEENNWWVSKHVKKPLRSTVLSIDWHPNNVLL
                     AAGTAEAKAYVFSAYIKGVDSKPEPTVWGERLPFGTICGEFISPDGGWVHSVAFSPSG
                     NILAYVSHDSSLSIVYPSGPGAPPAAHFALRLPSLPFVDLTFTSESALIAAGHDCQPI
                     VFTGSESGWVLSHSLDDPSSGGSRPLTPTATGSRSGGVGRLGNNEAFNMFKAADSRGQ
                     RGVPAPGATPTSAGLTPVGADGLLTTVHQNTITWVEPYEWGQGGEVTKVGTAGKDGRL
                     VVWPVTAAKSGLAGRMAGLSV"
     gene            299573..301021
                     /locus_tag="CNF00950"
                     /db_xref="GeneID:3258102"
     mRNA            join(299573..299792,299846..299934,299984..300136,
                     300185..300258,300320..301021)
                     /locus_tag="CNF00950"
                     /product="transcription/repair factor TFIIH subunit Tfb3,
                     putative"
                     /transcript_id="XM_571505.2"
                     /db_xref="GeneID:3258102"
     CDS             join(299613..299792,299846..299934,299984..300136,
                     300185..300258,300320..300942)
                     /locus_tag="CNF00950"
                     /codon_start=1
                     /product="transcription/repair factor TFIIH subunit Tfb3,
                     putative"
                     /protein_id="XP_571505.1"
                     /db_xref="GeneID:3258102"
                     /translation="MSRIPPKKLAPSSSTIRRPAQPTHRAPQLKQTGPRGKGHEEGYL
                     YVAGVKDPSKRVTEYRTEQDVCPICHTDRQFNKNLRLLVSPCYHKMCESCIDRLFTLG
                     PEPCPQCGRILRKVNFAHQTFEDLKVEKEVSVRRRMADIFNKRRDDFESDRQYDDYLE
                     LVEDLTFNLLNEISIPETEARIAEWQRQNESIIQANKHKTEEESMSQSKREEIERRAR
                     EERMRMIEEAERVERMEDERIKTEVTQALAKGETKRAREIEIEAREAKRLRAEALFKF
                     VPPSLLSAQPQGDVSHSPLSPSYNGPFIPIPYSNPDTASWAGWYEAKGEYVDRRSGVM
                     FVREDREGKVRGGGYDLQLFWEMEVRSAVEALGVEPLV"
     gene            complement(301222..301813)
                     /locus_tag="CNF00960"
                     /db_xref="GeneID:3258450"
     mRNA            complement(join(301222..301332,301389..301553,
                     301625..301813))
                     /locus_tag="CNF00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657341.1"
                     /db_xref="GeneID:3258450"
     CDS             complement(join(301439..301553,301625..301779))
                     /locus_tag="CNF00960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513132.1"
                     /db_xref="GeneID:3258450"
                     /translation="MSSSTVKQRHYSALASRIRSLHANLAETEGLLDMMTHQLDATAK
                     IGVHCGSQFMAVSRLLDKELKGLMDAATDADQQSTSTAPSPERSS"
     gene            301968..303075
                     /locus_tag="CNF00970"
                     /db_xref="GeneID:3258353"
     mRNA            join(301968..302624,302687..303075)
                     /locus_tag="CNF00970"
                     /product="cytochrome c heme lyase (cchl), putative"
                     /transcript_id="XM_571507.2"
                     /db_xref="GeneID:3258353"
     CDS             join(302011..302624,302687..302918)
                     /locus_tag="CNF00970"
                     /codon_start=1
                     /product="cytochrome c heme lyase (cchl), putative"
                     /protein_id="XP_571507.1"
                     /db_xref="GeneID:3258353"
                     /translation="MKWNIGSSSASLQVPVDHTSATSIPSDHPPIPSSSSSRPPAQCP
                     MHQADVSPPPAAANAPAKCPIQHDALDPTTHMPVNLSLSRQPDQKLDLPTERTASTIP
                     RPSSAPGGEAYGTGNTWDYPSPQQFYNALVRKGWETPEDSVEVMVAIHNFLNERAWDE
                     VMKWEKRLPGGDQSQLSRFQGRPGELSPKARFHLWAGKLFPSKFNTEPPFDRHDWVVT
                     RRSPSSPQETVTARYVIDYYSAPPDEDGNPVFSLDVRPALDSLEAIKQRISVGVEEWL
                     RGDVD"
     gene            complement(303100..305558)
                     /locus_tag="CNF00980"
                     /db_xref="GeneID:3258408"
     mRNA            complement(join(303100..303365,303425..303842,
                     303948..304149,304206..304746,304803..304982,
                     305064..305162,305280..305558))
                     /locus_tag="CNF00980"
                     /product="expressed protein"
                     /transcript_id="XM_571573.1"
                     /db_xref="GeneID:3258408"
     CDS             complement(join(303300..303365,303425..303842,
                     303948..304149,304206..304746,304803..304982,
                     305064..305162,305280..305510))
                     /locus_tag="CNF00980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571573.1"
                     /db_xref="GeneID:3258408"
                     /translation="MVYIAAHTPPYTPPHSPLPQCHRSTYYHLRSPEDSGESEPEDGK
                     DTDFCNFTERMEIDEDAYVHPQAQSPFLSLCPELIQRILSTFGGRNVVCLANLAATCR
                     KLRAHIYKCPDQAIWRDIYLEIYDDPRQASAFIKSRTTAEIDWRKRLQDREFIIRVLR
                     EWHVDRWELAAQHLDRICDTLLDMYMDLPAASTGLGNDTSCLEADIFHRFYSSKPALN
                     PSVLSYLLSSPCFSHLYHHYRILPSSPPPTKRLRPRGSSSSNINDDAATNPTLSFHSV
                     RFKVQVCTHPKLAKLHTLLPPRYDENDEQDREWRGFMRELVYSQKNFTEMNDWGPFTP
                     DGKVDWVLVDALGSVMMSNAQEIVHNPDISDHWHDSIMPQSFGVEPTRGWGFSHIEHP
                     LGVADGDVWDWAGVQGSWCGSYAFLDYTDWIALNEPRLILMRGRVAQLDLTHYHEAVG
                     DLMRLNLELDYPSPASPSTTLPPLTTHLPTTRNSRLPPIHFIGTSLQSKSVTPDAAPL
                     SSVRGVVQLTADDPPEVRWTLVIRYAGEDRWRLEGVQVGGRGSRRGFFGIWTDANKEE
                     HSPNGPVWYWQS"
     STS             306875..307695
                     /standard_name="Eco25"
                     /db_xref="UniSTS:470832"
     gene            307301..309251
                     /locus_tag="CNF00990"
                     /db_xref="GeneID:3258182"
     mRNA            join(307301..308054,308167..308251,308309..308396,
                     308466..309251)
                     /locus_tag="CNF00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_571540.2"
                     /db_xref="GeneID:3258182"
     CDS             join(307628..308054,308167..308251,308309..308396,
                     308466..309215)
                     /locus_tag="CNF00990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571540.1"
                     /db_xref="GeneID:3258182"
                     /translation="MPTMASPAKQATPKFAITPIKTAVQPCVSVINPIANLSPRGKGE
                     DEPGPSRLLRYTNKHNDTGGEGDRRLSEADADVGVENTIGGGKEQYKEEKTRRSPVKM
                     LSAHTPLKGPETVLCTIVGIPEIGRANGHELRGLEKGLDRMYASHDRAAAERKKPLTQ
                     TPKRRNAQRERTGMRPISSSTFDTVERRTGGDDWDDVFTEIVTPSTTMGHTSTCTSRL
                     FQYSNFDALSECDFSSSLSNALSTSSTSPRNHLVVRKNLSFPFDAFTDEDKVDEEVEV
                     EEVEERVTARIEDQESKGEEESSEMCSKIDDLSARIQAMIIQGLSALHAPLPGIDPDP
                     DVGLARRAAHSHPHAHEQAQVPEDEREEDVSQKWIRNLSEEEDLSWEELNLRLRDNNS
                     SHSRRQRSGRKNKKRDRQHRKPTFTGERGDGGSELQTHVVRCRSGSVLVHGMDVLVL"
     gene            309403..311913
                     /locus_tag="CNF01000"
                     /db_xref="GeneID:3258019"
     mRNA            join(309403..309716,309928..309978,310032..310082,
                     310177..310367,310426..310648,310711..311121,
                     311189..311913)
                     /locus_tag="CNF01000"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_571542.2"
                     /db_xref="GeneID:3258019"
     CDS             join(309439..309716,309928..309978,310032..310082,
                     310177..310367,310426..310648,310711..311121,
                     311189..311459)
                     /locus_tag="CNF01000"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_571542.1"
                     /db_xref="GeneID:3258019"
                     /translation="MHYLAAALPLLTLALAAPSNRPSVPLTPLNSRQYSDDLVERQSW
                     LLDQAKGLRSKYAPHLGERGQELRRRDIIDEGIMRRKRANQKRATGTVSLTDVGLDAS
                     YAGQVSIGTPAQDFLVIMDSGSSDLWVAGSTCTDSFCSQITTFDTSASSSFTTSNEAF
                     NITYGSGDADGTLGTDTVSMAGFTVSDQTFGVVTSTSADLISYPLSGLMGLAWKSIAS
                     SGATPFWQALAASGDWDSPEMGVYLKRYRGDSTASQIETDGGEILFGGLNTSLYNGSV
                     NYISIDESDEDYWRIPLEAMVIQGNSVSIASSSGGSNPSCAIDTGTTLIGVPSQTAYN
                     IYSQIEGAEALSESTGYEGYYQYPCDTDVTVSLQFGGMSYSISNADMNLGSFTRDTSM
                     CTGAFFAMDMSSRSPVQWIVGASFMKNVYTSFRYNPAAIGFAELVGGSSVSTGNSSSS
                     TTSGGTSGSNGGGSSSSGTMEKSVQLGLLVGAAVVGLAAMI"
     gene            312242..315300
                     /locus_tag="CNF01010"
                     /pseudo
                     /db_xref="GeneID:3258115"
     gene            315365..316325
                     /locus_tag="CNF01020"
                     /db_xref="GeneID:3258463"
     mRNA            join(315365..315553,315635..315845,315958..316325)
                     /locus_tag="CNF01020"
                     /product="expressed protein"
                     /transcript_id="XM_571544.2"
                     /db_xref="GeneID:3258463"
     CDS             join(315439..315553,315635..315845,315958..316159)
                     /locus_tag="CNF01020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571544.1"
                     /db_xref="GeneID:3258463"
                     /translation="MSNKPTYAAVVSSPPKDTHFAPQNEGEGPSGSSDAPPPYDGHQP
                     KSQPTITPQNQSLIHQHPNNANAAEQGGLTAGEWVPPPPHVAKSRALRRFWGAFFWGW
                     VIWIVIGAVIGGGVADAESNRPSKHQDRIGVHQEWVDEATIPGYDLWNVLADSSSPVE
                     ITIEEETIVFVQDLD"
     gene            complement(316294..317294)
                     /locus_tag="CNF01030"
                     /db_xref="GeneID:3258273"
     mRNA            complement(join(316294..316496,316572..317294))
                     /locus_tag="CNF01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657342.1"
                     /db_xref="GeneID:3258273"
     CDS             complement(316725..317039)
                     /locus_tag="CNF01030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513133.1"
                     /db_xref="GeneID:3258273"
                     /translation="MLPTTVLFRLILILLLPFTLGAVIPPTNDHSPNRRLALNKPRVY
                     HYPNDFSETEAWLAWQAKILRGKYAEYVDGRAKALLDKDRAEAKKEREGVGEAEDPKP
                     QI"
     gene            complement(317499..319689)
                     /locus_tag="CNF01040"
                     /db_xref="GeneID:3258208"
     mRNA            complement(join(317499..317915,317983..318281,
                     318332..318452,318507..318729,318781..318971,
                     319042..319092,319248..319689))
                     /locus_tag="CNF01040"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_024657343.1"
                     /db_xref="GeneID:3258208"
     CDS             complement(join(317624..317915,317983..318281,
                     318332..318452,318507..318729,318781..318971,
                     319042..319092,319248..319510))
                     /locus_tag="CNF01040"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_024513001.1"
                     /db_xref="GeneID:3258208"
                     /translation="MLVSLALLPLTLAATLPTVPSSFHLPLKVLESRQHSDDISQRHA
                     WLISQAKSMRAKYEPYLNEEGKELLKRDRMEKEGQMKRAQQSIDTPPQQFIVIMDTGS
                     SDLWVAEKGCTADFCSKTYTFDASNSFTFETERKQFSIAYGSGNAGGYLANDTVSTGG
                     FTVREQAFAVVTQAIDGLIDYPTSGLLGLAWNTIASAYSTPFWQALASSGAWDSPEMG
                     VYLARFKGNSSAQKIEFDGGHFIFGGVDSTKFEGDLNYIPIGPGERDFWKLPLEGMTV
                     GGNPVDVSKGLLIGRKAPACAIDTGTTLIGVPTDMAAAIYAQIPGSSKVPSSVMGQGG
                     YYQYPCDTNVDVKLKFGGVEYGISNTDMNFGTFTDDGKTCIGAFFGQDVSPRSPVQWI
                     VGAAFLKNVYTSFRYEPTAIGFAPLTTNVTLLHNKRMPVTSEEATINGTTSSSSRGAQ
                     LTGRVDVQQRGVLWGVLGLGAMLGLALAL"
     gene            320216..322252
                     /locus_tag="CNF01050"
                     /db_xref="GeneID:3258411"
     mRNA            join(320216..320730,320787..320874,320927..321166,
                     321219..321332,321406..321620,321698..321890,
                     321951..322252)
                     /locus_tag="CNF01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657344.1"
                     /db_xref="GeneID:3258411"
     CDS             join(320522..320730,320787..320874,320927..321166,
                     321219..321332,321406..321620,321698..321890,
                     321951..322169)
                     /locus_tag="CNF01050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513091.1"
                     /db_xref="GeneID:3258411"
                     /translation="MTSLTQALKRAQQTYANRNRKSYEAHQAASRHLPGGSTRSSIFI
                     HPFPLCIQKGQGVKITDLDGHEYVDFVSDFTSGIYGKSHPVLIDAIKEALDNGLQLGA
                     HTLAETTLASHFTSRFPSIELVRFANSGTEANILAISTAIKHTGRKKVLVFEGGYHGS
                     VMSHFHMKGGDGDDLKVPFDFVVCSYNDRKATDALISQHPSEIGAILVEPMLGAGGCI
                     PGDPAFLQFLREKASSIGAVLIFDEVQTARLSTGGRQKILGITPDLTTVGKFFGGGFA
                     FGAFGGKKEIMEKFDARKGGAISHGGTFNNSPLTMVAGATAMEKILTEDALKNLNKLG
                     DWMREEINRMFTSDGSPFLMTGLGSINQFHCTLSSNQNQVLDLLFFYLLERGFWIAQR
                     GLVSLSFAMTKEDVQRFIEAAIEATQKVKATLK"
     gene            complement(322191..324207)
                     /locus_tag="CNF01060"
                     /db_xref="GeneID:3258161"
     mRNA            complement(join(322191..322456,322516..322777,
                     322834..323134,323188..323638,323686..323795,
                     323846..323909,323961..324207))
                     /locus_tag="CNF01060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571571.2"
                     /db_xref="GeneID:3258161"
     CDS             complement(join(322337..322456,322516..322777,
                     322834..323134,323188..323638,323686..323795,
                     323846..323909,323961..324059))
                     /locus_tag="CNF01060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571571.1"
                     /db_xref="GeneID:3258161"
                     /translation="MFFKKKAANLTAVDYTDLSKSELYFAFSLVSSLFFLWGLSYGLL
                     DVLNKHFLTIFGLTKTQSTLLQFAYFISYLLVAPPMGIFMRKYGYKKGIHIGLGLFSI
                     GAVLFWPSAKYEKYGMFIAFTFVAASGLATLETAANSYITVLGPPAQSAMRLTFAQGF
                     NGIATVVGPIIASHTFFNGANQYSLDTVQYVYLALACFAFLLNILVGFTTLPEVKQTV
                     TTEQQDKIAGQSFWKQYHTLFGALSQFFYTGAQVAVASFTIFYITEQPGISPAYSSAT
                     ASNLFSGCQALFTFGRFLGVVYLRWIDPSFALFINGIGLCLFSILTATIPGHGGIACL
                     FMIFFFESICYPVIFSVATADLGSYAKIGSGVVALGVSGGAAYPSIQGAVSDHVNTWR
                     SFFIPLTGFVPLMVYGFVMWIINSRKYGGKLTIWGNKTAPNVEAILQAQAEASVENVE
                     TASVSSKEKTAQELKEYA"
     gene            complement(325048..329012)
                     /locus_tag="CNF01070"
                     /db_xref="GeneID:3258038"
     mRNA            complement(join(325048..326832,326887..327219,
                     327267..327891,327942..328046,328093..328751,
                     328817..329012))
                     /locus_tag="CNF01070"
                     /product="plasma membrane fusion-related protein,
                     putative"
                     /transcript_id="XM_024657345.1"
                     /db_xref="GeneID:3258038"
     mRNA            complement(join(325048..326832,326887..327239))
                     /locus_tag="CNF01070"
                     /product="plasma membrane fusion-related protein,
                     putative"
                     /transcript_id="XM_571569.2"
                     /db_xref="GeneID:3258038"
     CDS             complement(join(325238..326832,326887..327219,
                     327267..327891,327942..328046,328093..328665))
                     /locus_tag="CNF01070"
                     /codon_start=1
                     /product="plasma membrane fusion-related protein,
                     putative"
                     /protein_id="XP_024513100.1"
                     /db_xref="GeneID:3258038"
                     /translation="MSYPQAPSKFVNPDEIIPLSPPTKPPFAQYAASPLPATPHTPYS
                     PPSPSRLSETIPLRPYLSLLPRILLTFFSPCLLPMILTIAHLIQNRSSTASLATSLKS
                     SVLSACSGLAKAAASIKTLPRYLAMQTNQEAIRATQASILAIGTMLMDAITIIEAVVN
                     FIVDTYRSLLLCTIELAVRGTLEILISAVQTISDAVTDTLNSVRSNIQDDIGDANDII
                     QTAVSAINRVTTLVNLNISVPEFSIPALSFLQNVTIPTTFEDGLITLNSSLPTLTDLK
                     KKMDEIIDTPFEALISEINSTRLEMAASFNSSILSVPSLSSLSANSANDLSNDLCSDL
                     DTSLIDDTAKALHKLSSIAIGLMFLLLFLIWAALAVWEWRKWKLMKDTVDAVNEEWDR
                     DGKSDAWRMVAIVEHPVLERYSGTFLGKIAKMPRTRTNLRWFLSYLAHPTCLALLFIS
                     LFGFLSIQFQLVALNALKAHAQSSANSTVTASTNSLVTKLNAAALNSSQEYADSYNEA
                     IAGYQDRINNELFGSWVNTTAVTLNSTLVEFYDEVEKALNASFGGTILYNPINTFMYC
                     ILGSKITNLEKGLTWISEHAFVDLPTFPSDILLLSNDSMNEIATPIAAAAVGSGDGGD
                     DDDGVVGTLISHFESALKVERTFYGIMLGVWLALFLIGLAVVIWNSGGREKFMALRGV
                     PSSSSPPGYGPPESKHPRWKAWLTNNHPIYDSYAEKQFRGTTPTNCLESYTHADVPNV
                     NNGNDDHEKSFFKMRDSHAAGPFGSHATSAVRSTIASLAAPGQSFLKLSGRKLTDTTT
                     PYDDKVPLAPVQTSEKYSRDHANSPFPRPSSESSESSAAQPFWVDKFYGAFEGVKSFF
                     PTRSQRLGAALARKASQRTEGSFGASQVPTARTPGHDWIGGHQCLPEKKAEPEWSMVD
                     PRMLGRALEDDKGRYPRVLPPSEMAAANYNPHPVYPRPMSRASTLGEGMVIPSTTSHP
                     DPFQDMPPLPPKHKRASMDYVEEYESSHSRSSREDSRHGGVTSPASSSVSYFAAEPQL
                     VSASKVQVGVAQKGGQATRALAEIVKELQEKRERKDPFGDDYERGL"
     CDS             complement(325238..326779)
                     /locus_tag="CNF01070"
                     /codon_start=1
                     /product="plasma membrane fusion-related protein,
                     putative"
                     /protein_id="XP_571569.2"
                     /db_xref="GeneID:3258038"
                     /translation="MYCILGSKITNLEKGLTWISEHAFVDLPTFPSDILLLSNDSMNE
                     IATPIAAAAVGSGDGGDDDDGVVGTLISHFESALKVERTFYGIMLGVWLALFLIGLAV
                     VIWNSGGREKFMALRGVPSSSSPPGYGPPESKHPRWKAWLTNNHPIYDSYAEKQFRGT
                     TPTNCLESYTHADVPNVNNGNDDHEKSFFKMRDSHAAGPFGSHATSAVRSTIASLAAP
                     GQSFLKLSGRKLTDTTTPYDDKVPLAPVQTSEKYSRDHANSPFPRPSSESSESSAAQP
                     FWVDKFYGAFEGVKSFFPTRSQRLGAALARKASQRTEGSFGASQVPTARTPGHDWIGG
                     HQCLPEKKAEPEWSMVDPRMLGRALEDDKGRYPRVLPPSEMAAANYNPHPVYPRPMSR
                     ASTLGEGMVIPSTTSHPDPFQDMPPLPPKHKRASMDYVEEYESSHSRSSREDSRHGGV
                     TSPASSSVSYFAAEPQLVSASKVQVGVAQKGGQATRALAEIVKELQEKRERKDPFGDD
                     YERGL"
     gene            329233..331545
                     /locus_tag="CNF01080"
                     /db_xref="GeneID:3258342"
     mRNA            join(329233..329330,329384..329524,329586..329667,
                     329729..329858,329909..331545)
                     /locus_tag="CNF01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_571254.2"
                     /db_xref="GeneID:3258342"
     CDS             join(329248..329330,329384..329524,329586..329667,
                     329729..329858,329909..330312)
                     /locus_tag="CNF01080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571254.2"
                     /db_xref="GeneID:3258342"
                     /translation="MIQNYPTMALYAPPPPSYQDHAAGPVQHHGFNPYSDNGGSILAI
                     AGKDFSIIAGDTRQSEGYSIQTRYARKVWQLTDKVVLATNGFAADGNNFVKRVKQRLE
                     WYEHAHNKAMGLKSIARMIQTMLYGKRFFPYYVYNILGGIEEDGSGAVYSFDPVGSYE
                     REACRAAGAAQSLIQPFLDNQVYFKNQQPEPGAAPFVPGNLPLSTVLSLVVDSFTSAT
                     ERHIEVGDGMEIYVVMAKGRSTDDLLGEGNLVPGMEVEELPSLGESGSERAFLVRMPL
                     KRD"
     gene            332437..335642
                     /locus_tag="CNF01090"
                     /db_xref="GeneID:3258062"
     mRNA            join(332437..332628,332930..333526,333579..335642)
                     /locus_tag="CNF01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_571255.1"
                     /db_xref="GeneID:3258062"
     mRNA            join(332813..333526,333579..335642)
                     /locus_tag="CNF01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658559.1"
                     /db_xref="GeneID:3258062"
     CDS             join(333034..333526,333579..335287)
                     /locus_tag="CNF01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514487.1"
                     /db_xref="GeneID:3258062"
                     /translation="MSLPARSSRSSTHSPLADSFLDAKAQSARRISSYETTRTRAGSS
                     TPASLTIVPENKQNAQTAPQSTPPSSYKLADRRKLPRSASGLSADCGRVSGGSDSDDG
                     VLTINRAKTYDKGKEKDTLAGGMWGIPEEQTIKQARWVLDPTEMQLGSETWSNSLRIV
                     LVLGHVTVEALEPMLYNPAFANTLLLIGSYEPIPEIDALLSPSHLLSSSPDREICPSI
                     QPFQPSGRANGTESHDLTVLLNQATILAKQYRERTPLATRSRQGSFTSASNSPPSSPG
                     GRKKVFSVLGLGRTPSRRGSLDSTGDDRPSSSVFNGEREGISSSMSSSSLRAPSVASN
                     RNPHSRILSMSRDSFLGGMFKLDGDARSSGEGRHLFDAVINFVPPMSMFKSERAMQHM
                     LHQAVVITTGCVPTLVRSVGRSSNGEAPTLPITLLHVLPSQTPPALAPVLESFVLSLL
                     PNFQARCSRELFGCIVTPPVWFSPLVSMSSNAITEDGVSGAEVLLVGGVRCPHQVMKG
                     QGRTEDFKSRAFLFSWEACMSVCGIIAESRRPSGSRASTSASRSVSRQDIPGDPPSVN
                     FNDVQARTPPQTFEHILSTASASNSSQLPTPPTSLSAQPSSSPKPALFSPTLLPIQTQ
                     NLHQRKSKLSAVAAASDLLNSPPTPDLDPSISSCSSSFALGETNSQGSGSGGSASAAA
                     TGNGGDNAVRVVKQGEFGREKWEDGKEPKRKGGRGIVSGWFKRAIAKNIKA"
     CDS             join(333034..333526,333579..335287)
                     /locus_tag="CNF01090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571255.1"
                     /db_xref="GeneID:3258062"
                     /translation="MSLPARSSRSSTHSPLADSFLDAKAQSARRISSYETTRTRAGSS
                     TPASLTIVPENKQNAQTAPQSTPPSSYKLADRRKLPRSASGLSADCGRVSGGSDSDDG
                     VLTINRAKTYDKGKEKDTLAGGMWGIPEEQTIKQARWVLDPTEMQLGSETWSNSLRIV
                     LVLGHVTVEALEPMLYNPAFANTLLLIGSYEPIPEIDALLSPSHLLSSSPDREICPSI
                     QPFQPSGRANGTESHDLTVLLNQATILAKQYRERTPLATRSRQGSFTSASNSPPSSPG
                     GRKKVFSVLGLGRTPSRRGSLDSTGDDRPSSSVFNGEREGISSSMSSSSLRAPSVASN
                     RNPHSRILSMSRDSFLGGMFKLDGDARSSGEGRHLFDAVINFVPPMSMFKSERAMQHM
                     LHQAVVITTGCVPTLVRSVGRSSNGEAPTLPITLLHVLPSQTPPALAPVLESFVLSLL
                     PNFQARCSRELFGCIVTPPVWFSPLVSMSSNAITEDGVSGAEVLLVGGVRCPHQVMKG
                     QGRTEDFKSRAFLFSWEACMSVCGIIAESRRPSGSRASTSASRSVSRQDIPGDPPSVN
                     FNDVQARTPPQTFEHILSTASASNSSQLPTPPTSLSAQPSSSPKPALFSPTLLPIQTQ
                     NLHQRKSKLSAVAAASDLLNSPPTPDLDPSISSCSSSFALGETNSQGSGSGGSASAAA
                     TGNGGDNAVRVVKQGEFGREKWEDGKEPKRKGGRGIVSGWFKRAIAKNIKA"
     gene            complement(335653..337200)
                     /locus_tag="CNF01100"
                     /db_xref="GeneID:3258085"
     mRNA            complement(join(335653..335979,336034..336285,
                     336344..336547,336595..336733,336784..336905,
                     336966..337047,337104..337200))
                     /locus_tag="CNF01100"
                     /product="expressed protein"
                     /transcript_id="XM_571257.2"
                     /db_xref="GeneID:3258085"
     CDS             complement(join(335747..335979,336034..336285,
                     336344..336547,336595..336733,336784..336905,
                     336966..337047,337104..337142))
                     /locus_tag="CNF01100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571257.1"
                     /db_xref="GeneID:3258085"
                     /translation="MAPSTASRTTSKKSGKENMVPSRAKGKAVAEEDVRDGSFTEMSD
                     DEEPKKSATKSKGKRPLLQESESNEEGVKELKKRLANMTSERDRIQSQSDKFSKQFEE
                     LSKLRSTDAEALLKKYKEKTEIQAKAQNDIIASQTALTEKLQAKVQSLEKSLAAAREA
                     AIPVESNAKPDPKEIRALKEEMAKMKSEINAKDERIVNLEREYKAEVEHSRSLQASSK
                     NPSSAPASSSVNQTAEEAEKDHASLALYEQLSLMNIVNVKIKDSRFGKERTFNCVMCV
                     NGKSLNFKLRCYTEVDKKQDRSNPDYPYIKVAHYTPELLQNESEEFVEKLEYFAREFT
                     VPRRELGGFFAELRSKMADDEE"
     gene            337374..338970
                     /locus_tag="CNF01110"
                     /db_xref="GeneID:3258456"
     mRNA            join(337374..337774,337826..337929,337991..338090,
                     338142..338390,338438..338970)
                     /locus_tag="CNF01110"
                     /product="mating-type switching protein swi10, putative"
                     /transcript_id="XM_024657346.1"
                     /db_xref="GeneID:3258456"
     CDS             join(337442..337774,337826..337929,337991..338090,
                     338142..338390,338438..338830)
                     /locus_tag="CNF01110"
                     /codon_start=1
                     /product="mating-type switching protein swi10, putative"
                     /protein_id="XP_024513002.1"
                     /db_xref="GeneID:3258456"
                     /translation="MTEQNRSSSSNGGSIGPSMGPPVFQTASSVLKSVAAQASPGAST
                     STMSLRNASGGQPSLSTSTSAPSPSTVGSSSNTAAGTGGPSTNSSQTSRPINRPAASK
                     NSIIYNAVQRRNPVLSAIRNVGIEVGDIVADYQVGAHNGVLFLSLKYHRLHPEYIHQR
                     IEKMKNMYNFRVILVLCDVNEHHQSLRELTKIAIINEFTVFVAWSNEEVAQYLVTFKQ
                     FEHKSADTLKERVQQTYHDQLAHVLTSGKKVNKTDADNLAAEFGSFESISRKSAKSLS
                     NVKGLGATKVTSLIDAFTKPFLVGGLRRPEREKTAQEKQADSEAVTFAGDDMTDPTRS
                     LELAVGNNDGNKRQMTDEVKGEDMVGGQVWHDPLDDEDDDKVAEEEPIAKRARIDTPI
                     "
     gene            340678..344991
                     /locus_tag="CNF01120"
                     /db_xref="GeneID:3258390"
     mRNA            join(340678..340770,340837..342249,342315..342938,
                     343063..343823,343931..344991)
                     /locus_tag="CNF01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657347.1"
                     /db_xref="GeneID:3258390"
     STS             342092..342296
                     /locus_tag="CNF01120"
                     /standard_name="GT7"
                     /db_xref="UniSTS:470833"
     CDS             join(342574..342938,343063..343823,343931..344664)
                     /locus_tag="CNF01120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513003.1"
                     /db_xref="GeneID:3258390"
                     /translation="MFAMPSTPTHNRGSTWSRYITPDLTPSFPTSSSFVERALSTQSL
                     SHQPFSSPSPTSSHSLALASPVQTPFSHPSVQRQSTPAILEDDFHPNPMLAAYPNTPS
                     PQPFGVTGGLLVSEPASMLQHPSSDCGTVLHSDIFLSQSVSKTSRPALRPSLSHNAVL
                     NTPSPSTWPRRTMTTSALSTSAVPTLGSNQRVRPDGPPLESAIAGENNNKVTTLQHEA
                     NTPSLSQSVTSTTSTTAIATQQPVPSSSSLPAHPYGYSTYAAPFSNASSYSEYPYNPS
                     SYSAPAYASAPYPQPNWQMTSVSHAIAHRQPQPQYSWGDVHAATMPGKQDEPILAPGE
                     LPAPRPPMSYAALIGEALLLAPPPHQLYVSEISDSIKKRYPYYRQNPTKIYNGVRHQT
                     SMCKAFVKLPRPFGDQTGGARKWGIRAGCEGWFAGGGYHPPSNAVTTNKLSKNRKAKS
                     TARSKQLALGMNGAKKLQPGIPSPTSSDGPSSGPAYDGSSGAVAPCQQPYSTAAFSSP
                     ATNSHLPPGYHYIPVNSSQNHPQPQPIYVPVWGPYAAPNPPPQYHGHFDHGSQSPETW
                     RRQVAGTQSSDGASLGSSFDEIRVLPMMGSPAASVHSFRESLHSSHGNSPKIM"
     STS             344215..344385
                     /locus_tag="CNF01120"
                     /standard_name="ha2604"
                     /db_xref="UniSTS:515572"
     gene            complement(345140..347932)
                     /locus_tag="CNF01130"
                     /db_xref="GeneID:3258377"
     mRNA            complement(join(345140..345604,345675..345759,
                     345816..345869,345929..346102,346161..346846,
                     346900..346922,346975..347280,347336..347580,
                     347648..347932))
                     /locus_tag="CNF01130"
                     /product="sterol O-acyltransferase, putative"
                     /transcript_id="XM_024657348.1"
                     /db_xref="GeneID:3258377"
     CDS             complement(join(345332..345604,345675..345759,
                     345816..345869,345929..346102,346161..346846,
                     346900..346922,346975..347280,347336..347580,
                     347648..347661))
                     /locus_tag="CNF01130"
                     /codon_start=1
                     /product="sterol O-acyltransferase, putative"
                     /protein_id="XP_024513004.1"
                     /db_xref="GeneID:3258377"
                     /translation="MARKDPLPTIPARAYDVERMTTTLSNSADSVVPTAEGVIRVRPY
                     RSSSNAQLKAVLTFTPRVSALDRHNTSSQTDQFRGFFVLFWIGLGLMFVRTSILSWEE
                     NRTLLSWSFGRLITGDALVLAISDLIMVLTMFLCVPFVKGLQYRWFNYYWTGLIIQHI
                     FQSAYLGMAVWWGYHRQWYWVQSGFLVLHSMSSMMKMHSYMAHNGMLATVYHRLQSEK
                     KHLEEAIAQYPGGREALLAEAASRQAGLEAAEANQSTEASTPLGTPGINTPNFTSTTG
                     YEEPVAAIRHKMIISEGTEPESTGHSSAREETSIEGHRRRQHLHIDAPHRRPYATDAL
                     PSPRADLPLGTSLEPSHTTSPHTPSPPGALAWSSNEEIALLATNIDAMQEELKSNGAK
                     GLVWPQNVTYRHFLDFMFFPTLVYQLEYPRTDTMRPLVVVEKIIATFGTFSLIYTITE
                     HYIMPLLPTEGDTKSLVKSYISLAGPMLLNYLLIFYIIFECVCTGFAELSYFADREFY
                     QDWWNSTSWDEFARKWNKPVHTFLLRHVYASTMTTLQLTRTSAAFVTFLLSALCHELV
                     MAVVTKKIRPYLFLMQMAQLPMIALGRLPIVRRNKTIGNIVFWMGLMAGFPLL"
     gene            348019..348582
                     /locus_tag="CNF01140"
                     /db_xref="GeneID:3258432"
     mRNA            join(348019..348346,348443..348582)
                     /locus_tag="CNF01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657349.1"
                     /db_xref="GeneID:3258432"
     CDS             348061..348318
                     /locus_tag="CNF01140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513005.1"
                     /db_xref="GeneID:3258432"
                     /translation="MTKVYLLSRTLDPLLAVFTGLFAFHLNQNNPRTAPPPGHTLQEL
                     LKWKWAESKKIREARDKEASEEWENVTRELVGETSVEEAKR"
     gene            complement(348549..349467)
                     /locus_tag="CNF01150"
                     /db_xref="GeneID:3258392"
     mRNA            complement(join(348549..348621,348762..348844,
                     348904..348910,349007..349160,349231..349467))
                     /locus_tag="CNF01150"
                     /product="expressed protein"
                     /transcript_id="XM_024657350.1"
                     /db_xref="GeneID:3258392"
     CDS             complement(join(348579..348621,348762..348844,
                     348904..348910,349007..349160,349231..349336))
                     /locus_tag="CNF01150"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513098.1"
                     /db_xref="GeneID:3258392"
                     /translation="MMFLPSLRASSSRLAQPRLFSTTSRVLQKAPLAASPEAATPEEL
                     LGKIGRNADKKLTPFAESWDKLNEVWLKTKKMNDLGLATKEKRYILWAFSRYSQGSPP
                     SAFIRPPKPPKKFRGWGPKIQHGVRVRD"
     gene            349574..351493
                     /locus_tag="CNF01160"
                     /db_xref="GeneID:3258414"
     mRNA            join(349574..349669,349759..349821,349891..350092,
                     350153..350407,350509..350598,350652..350761,
                     350821..351000,351053..351138,351200..351493)
                     /locus_tag="CNF01160"
                     /product="positive transcription elongation factor,
                     putative"
                     /transcript_id="XM_024657351.1"
                     /db_xref="GeneID:3258414"
     mRNA            join(349574..349669,349759..349821,349891..350092,
                     350153..350407,350509..350598,350652..350761,
                     350821..351046)
                     /locus_tag="CNF01160"
                     /product="positive transcription elongation factor,
                     putative"
                     /transcript_id="XM_024658560.1"
                     /db_xref="GeneID:3258414"
     CDS             join(349601..349669,349759..349821,349891..350092,
                     350153..350407,350509..350598,350652..350761,
                     350821..351000,351053..351138,351200..351395)
                     /locus_tag="CNF01160"
                     /codon_start=1
                     /product="positive transcription elongation factor,
                     putative"
                     /protein_id="XP_024513092.1"
                     /db_xref="GeneID:3258414"
                     /translation="MDATTLTGHVKELNAANQAGKSDEVISLLKKLQAEVVPTEDLLR
                     SSKAGVAVGKLRTHATPSVSSLAKEIVKKWRDAVEETKKKRKRAEGDEGKDVKKEKEE
                     GNGKRVKAETGSLAATPSASTPASASTPDVKATSPPVRQPLSTIDSSRTTPRTAKSDG
                     VADSLRADSSEGGSVDSVRDKCVIMIYDALALDSTAEIKILKERAIGIERAANKAMNF
                     STGNDYRAKMRSLFLNLKDKGNPALRNEIVLGYVSTEKVASMSKDEMASESVRMLKEK
                     IASDNLFKAKAVGVTQAETDAFKCGRCHQRKCTYYQMQTRSADEPMTTFVTYVSDLTP
                     KESLLTTCTTCSFYSDVLIVTTGGNSASFGFCLWGALYLSGFLSRRLCSQYIYEAYRC
                     DLRVNVTKPLSAVNMPFCSVLKFK"
     CDS             join(349601..349669,349759..349821,349891..350092,
                     350153..350407,350509..350598,350652..350761,
                     350821..351039)
                     /locus_tag="CNF01160"
                     /codon_start=1
                     /product="positive transcription elongation factor,
                     putative"
                     /protein_id="XP_024514488.1"
                     /db_xref="GeneID:3258414"
                     /translation="MDATTLTGHVKELNAANQAGKSDEVISLLKKLQAEVVPTEDLLR
                     SSKAGVAVGKLRTHATPSVSSLAKEIVKKWRDAVEETKKKRKRAEGDEGKDVKKEKEE
                     GNGKRVKAETGSLAATPSASTPASASTPDVKATSPPVRQPLSTIDSSRTTPRTAKSDG
                     VADSLRADSSEGGSVDSVRDKCVIMIYDALALDSTAEIKILKERAIGIERAANKAMNF
                     STGNDYRAKMRSLFLNLKDKGNPALRNEIVLGYVSTEKVASMSKDEMASESVRMLKEK
                     IASDNLFKAKAVGVTQAETDAFKCGRCHQRKCTYYQMQTRSADEPMTVSRYLAHMIRW
                     Y"
     gene            351558..353618
                     /locus_tag="CNF01165"
                     /db_xref="GeneID:36392893"
     mRNA            join(351558..351794,351845..352905,352976..353618)
                     /locus_tag="CNF01165"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658561.1"
                     /db_xref="GeneID:36392893"
     CDS             join(351615..351794,351845..352905,352976..353015)
                     /locus_tag="CNF01165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514489.1"
                     /db_xref="GeneID:36392893"
                     /translation="MNAFERVLSTPELVDGILNILEPRDLCKILTLDRAFFQHAMPVL
                     WRSVPYRATEYFDETTSRGIAYMNAIKHLDIGDMPGDPNNLKDQKEILDAILQYFPNI
                     VTARNYCSPRPWSYNWKLRVERSFAQKTDEEEECGKRVKMVEQRKLLLDFNVNWKAQG
                     VLNTQSLDKSFAGWKGYTIDLSITMRVPLRKSQHRFLLEPFSTTQPDGYYYVAYLLSP
                     ARRDPRIWALDFEGLSIKLAELEGILAFHHVKLRPILELRATRVVDASLEGFESFCDS
                     ARDLQELHLSFNYGCHALHLRHIERIVLAVAEMPKLKAIELSILFSEGEEFTPATALT
                     VPPGVASPRLRELQKVTINIHSTAPSYVTRYAFPVDTLAQCLAYLGAEEDCKYVLKNG
                     TGVFVGTDVSNGLNKEVHNFQRSSPNGLPPRQPT"
     gene            354173..357585
                     /locus_tag="CNF01170"
                     /db_xref="GeneID:3258357"
     mRNA            join(354173..354346,354419..355945,355997..356094,
                     356139..356282,356335..356482,356541..356661,
                     356713..356778,356831..357033,357091..357214,
                     357268..357585)
                     /locus_tag="CNF01170"
                     /product="expressed protein"
                     /transcript_id="XM_571550.2"
                     /db_xref="GeneID:3258357"
     CDS             join(354323..354346,354419..355945,355997..356094,
                     356139..356282,356335..356482,356541..356661,
                     356713..356778,356831..357033,357091..357214,
                     357268..357473)
                     /locus_tag="CNF01170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571550.1"
                     /db_xref="GeneID:3258357"
                     /translation="MQPHRSSENEQQRIIDTQIDQFTNYVTTAFPIAGARRTGSQTQA
                     ATPISQISEEELERQRTVNGPAPDQPYHNAGGGVFSVPGSRSGHALVSNASFNGYDIS
                     SASAGPSQIQQTTSQQSRTATQSPSQPLAHRSDQDPIASFLAEMPTEAEDPTRHVLWT
                     ELIRLKTRSLELQIAEARRKEKEAELELARLQSGAVSKNDNENGKALAGPSGAAGVAI
                     PSGTSYVLPQQQMALQQQQQQQQQQQQRQQQQQQQQQQQQQQQQQQQHVQPVPQEPTF
                     NPTQQLYGGVAQNQNQHAVSPFDLDAMLQTDLTNFLSWLPDLGNNEDTQADRLQNTND
                     SNMPLGTLQPPPIFDNSTVPQQSPSRRASHSPSNSPPPAKRSKRTTEKKTVVEKSSAC
                     IVCSKPLARVMIRAPKSRVPDPITVSLKCTQCAPVKQPSTLPDSNQASSATGSSIGTV
                     ETRKRMRTSMEIDDEEAKVSERRTWCDVCQRIVGSGQVYGGKDRENILHQAEIICTGC
                     DSKYQRCTDCGGGGGPRVGIGKWRMKQVFHPGRKTCSLSHTRLGDRTRELGVHVTPTD
                     FTPEQMKEVLSRCKTLWNEKTLSRLAIPEMLEVDLPPSLANPLRDFADVDDIVTRNWP
                     SREAMIRADGLNPSRFKRLLSLIWAHSKPRRSVRTVDLEEEWSKQADENDEDDMSTVL
                     ANVKRTNVVIPAGSELIGMWGGEWDMQNGSLLISTFIPFEGTDGEDSTALSVGEMITK
                     VQGLQQEINAERIAQAEKDGTEPELLPPCQHLWTVSGGYIPLVRERFADILIRKRAFV
                     HVEEYLTRHPEFIECIKARPVGLHPDIHRPVPQPGASESSEDDQSAPRPLILVRWLGK
                     DFDAEKILEIKQMEFGGGKAKVKKRLRSKT"
     gene            complement(357461..358707)
                     /locus_tag="CNF01180"
                     /db_xref="GeneID:3258141"
     mRNA            complement(join(357461..357754,357804..358269,
                     358335..358466,358527..358707))
                     /locus_tag="CNF01180"
                     /product="expressed protein"
                     /transcript_id="XM_571565.2"
                     /db_xref="GeneID:3258141"
     CDS             complement(join(357607..357754,357804..358269,
                     358335..358466,358527..358611))
                     /locus_tag="CNF01180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571565.1"
                     /db_xref="GeneID:3258141"
                     /translation="MKYAVRLLNEASESIPRIKPRTYSVSQFHRMHEHVRPRYLLLNN
                     IPRTALPSDILRALRDGGAVDSSFPVTAITSPAPSLPRTPSLTRTWHLTTPSQAHAEA
                     IYSHLQTHPLFSTSTGLPSGRQSNQNPNVNPNLTPVSHVQFTSTTPKEWINGMIEVAK
                     HDSDVRAVERGKAVDPGFTTDWVLKPGFSGRRVIVKGLPGGASYDDVKRLAKDCNLVE
                     GPDSCKRLPPSKFSLVSSFCLTVDSVADAYRLVRKIHMKWYKSKNFGEKYLMRAEVAY
                     "
     gene            358856..360916
                     /locus_tag="CNF01190"
                     /db_xref="GeneID:3258363"
     mRNA            join(358856..359159,359211..359710,359779..359977,
                     360069..360087,360146..360155,360219..360304,
                     360367..360394,360449..360454,360510..360916)
                     /locus_tag="CNF01190"
                     /product="expressed protein"
                     /transcript_id="XM_571262.2"
                     /db_xref="GeneID:3258363"
     CDS             join(359878..359977,360069..360087,360146..360155,
                     360219..360304,360367..360394,360449..360454,
                     360510..360635)
                     /locus_tag="CNF01190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571262.1"
                     /db_xref="GeneID:3258363"
                     /translation="MSKKYHQKAYTAEEKRKAIQMYEEKIHYSARYSNDEWEFRHVII
                     PKPLVRFIPPGVCAEEVWRGIGIRQSPGWEMYMRHEPEPHVLLFRRPKNYDQIHRPFS
                     QTLAARKLNISREVTAHPAPAK"
     gene            complement(360890..362611)
                     /locus_tag="CNF01200"
                     /db_xref="GeneID:3258136"
     mRNA            complement(join(360890..361246,361299..361849,
                     361932..362212,362414..362611))
                     /locus_tag="CNF01200"
                     /product="heme oxygenase 2, putative"
                     /transcript_id="XM_571263.2"
                     /db_xref="GeneID:3258136"
     CDS             complement(join(361011..361246,361299..361849,
                     361932..362212,362414..362440))
                     /locus_tag="CNF01200"
                     /codon_start=1
                     /product="heme oxygenase 2, putative"
                     /protein_id="XP_571263.1"
                     /db_xref="GeneID:3258136"
                     /translation="MQTAVSDKQLHIGVSSPLDTPSFRPNTPPLEHPAQSSAKITEPG
                     IDGLPELDLRNPISSLLKLGTKRAHVKAEHSAGAAALVQGDLGLEEYIRWLAALWRIY
                     DVLELGLQENSSNPVLAPTYDPALLARAAPLAADINYLLTLLPKDKTAVETNVSLNEP
                     ATPLPPFPLPSFIAPIFNDPPRPLTNYLSHVRTLSASPVTAPGLLAHAYVRYLGDLSG
                     GQFIGARVKKSFDLPGDDGTKFYQFDFQKGGNAQGDESRAETKKRLAEVKDWYRRGMD
                     EGVGEDQRLKADLIEEANLAFSLNTDLFSIIQVPAKDSKKAESGAVATENRPQTRAEL
                     LTQSAWFLAAALFGVFLNIYVGPLLSKLFA"
     gene            362739..365689
                     /locus_tag="CNF01210"
                     /db_xref="GeneID:3258464"
     mRNA            join(362739..363120,363173..363431,363485..363552,
                     363607..363966,364017..364130,364181..364321,
                     364377..364574,364630..364778,364830..365004,
                     365058..365205,365261..365689)
                     /locus_tag="CNF01210"
                     /product="glycerol transporter, putative"
                     /transcript_id="XM_024657352.1"
                     /db_xref="GeneID:3258464"
     CDS             join(363082..363120,363173..363431,363485..363552,
                     363607..363966,364017..364130,364181..364321,
                     364377..364574,364630..364778,364830..365004,
                     365058..365205,365261..365367)
                     /locus_tag="CNF01210"
                     /codon_start=1
                     /product="glycerol transporter, putative"
                     /protein_id="XP_024513006.1"
                     /db_xref="GeneID:3258464"
                     /translation="MNNGNAPFTNRARNRQARITKMPPLEDPIPPPITPQHGIKKGKL
                     FVTDFTITIPGSNARNPAGHEPGPSKWHTLEFRLYTLVFIMVVPMMIWVPMRVSLPSH
                     PNYYKFAHKLSPGWLFGRPVDNSDTQYRSFRDNLLALVVLSSAYLVTSSLQARLAPSP
                     SSRAKFIALFSTFMIILLHGTSAIKIIALLAINYHVSKFPATPLIRKFWPWLIICGNM
                     AILLFNEIWEGYKFGSLHAKLGVLDTYKGLLPRWHVGFNITMMRLVSFGLDYIWKEPS
                     NNTSPPAEYRKRVQTSGAEQDYSFINYMAYCLYPPLYIAGPIMTFNDFLWQLRAPASI
                     SVRAKLTYAVRFLFCILTMESILHTIYVVAIKDTAAWEGDSPAELSMIGFWNLVIVWL
                     KLLIPWRFFRLWALLDGVDPPENMIRCVANNYSALGFWRSWHRSFNLWVVRYIYVPVG
                     GSKNIIPATLLVFTFVALWHDLSFKLLAWGWLVSLFLVPEILVRKLFAADKYGAHPLY
                     RHACAVGAVANILLMMTANLVGFVLGLDGTKHLLHELTSTISGWSFMLFASSCLFVAA
                     QVMFEYREEEKRRGLDRRC"
     gene            366843..369745
                     /locus_tag="CNF01220"
                     /db_xref="GeneID:3258227"
     mRNA            join(366843..366952,367011..367210,367266..367385,
                     367446..367458,367506..367575,367630..367683,
                     367735..367762,367810..368329,368384..368436,
                     368491..368635,368701..368777,368836..368937,
                     369011..369077,369178..369365,369433..369745)
                     /locus_tag="CNF01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657353.1"
                     /db_xref="GeneID:3258227"
     mRNA            join(366974..367210,367266..367385,367446..367458,
                     367506..367575,367630..367683,367735..367762,
                     367810..368329,368384..368436,368491..368635,
                     368701..368777,368836..368937,369011..369077,
                     369178..369365,369433..369745)
                     /locus_tag="CNF01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_571265.1"
                     /db_xref="GeneID:3258227"
     CDS             join(367071..367210,367266..367385,367446..367458,
                     367506..367575,367630..367683,367735..367762,
                     367810..368329,368384..368436,368491..368635,
                     368701..368777,368836..368937,369011..369077,
                     369178..369365,369433..369445)
                     /locus_tag="CNF01220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513007.1"
                     /db_xref="GeneID:3258227"
                     /translation="MSAEIKGEHLTHHYLTNAQLDDYPDEKQVVGNGDLVTVEEVKVA
                     EDAILAGDEYTEEQYKKLKRKVDWVLLPLMWWCYGIQQTDKTGLGTMNLYGVQADTGM
                     HGNQYSLLTVVFYTAYAVCEFPSNFLLQRFNMGKCLTIYMFCWGIIVLAQGFVKSFAP
                     FLVLRLLQGAFECTISPGFNLIIANWYTSQEHNSRSLIFQSANAGWGIVVSLTMYGIA
                     QAANKNPGGFAAWRGIAVFLGGQTLLAAGVAFFLLGTPNEVRWLKAEEKKIAYARVMK
                     NNAGTDTTGRKTWKWGQVREAFLDPALYFQFINAFLVSVCNGALTTFGAVITLSFGFS
                     ESQVILYGIPQNVVSVLWFAFVGFMTLKFKGLRMYFMMISVIFPFIGLLFMALLPEDT
                     SYRWTKWGMYFMTVTFILPLFSGWALISSNTAGRTKRTVMSSTTFIAYCAGNIAGSEV
                     MKSKDAPHYIPGTIAIACCMGVEFATLIIWRIYLQYCNRKKTRAIAEMGLSEEEITKK
                     GQALGAEDATDMKNPFFLYST"
     CDS             join(367071..367210,367266..367385,367446..367458,
                     367506..367575,367630..367683,367735..367762,
                     367810..368329,368384..368436,368491..368635,
                     368701..368777,368836..368937,369011..369077,
                     369178..369365,369433..369445)
                     /locus_tag="CNF01220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571265.1"
                     /db_xref="GeneID:3258227"
                     /translation="MSAEIKGEHLTHHYLTNAQLDDYPDEKQVVGNGDLVTVEEVKVA
                     EDAILAGDEYTEEQYKKLKRKVDWVLLPLMWWCYGIQQTDKTGLGTMNLYGVQADTGM
                     HGNQYSLLTVVFYTAYAVCEFPSNFLLQRFNMGKCLTIYMFCWGIIVLAQGFVKSFAP
                     FLVLRLLQGAFECTISPGFNLIIANWYTSQEHNSRSLIFQSANAGWGIVVSLTMYGIA
                     QAANKNPGGFAAWRGIAVFLGGQTLLAAGVAFFLLGTPNEVRWLKAEEKKIAYARVMK
                     NNAGTDTTGRKTWKWGQVREAFLDPALYFQFINAFLVSVCNGALTTFGAVITLSFGFS
                     ESQVILYGIPQNVVSVLWFAFVGFMTLKFKGLRMYFMMISVIFPFIGLLFMALLPEDT
                     SYRWTKWGMYFMTVTFILPLFSGWALISSNTAGRTKRTVMSSTTFIAYCAGNIAGSEV
                     MKSKDAPHYIPGTIAIACCMGVEFATLIIWRIYLQYCNRKKTRAIAEMGLSEEEITKK
                     GQALGAEDATDMKNPFFLYST"
     gene            complement(369722..371484)
                     /locus_tag="CNF01230"
                     /db_xref="GeneID:3258077"
     mRNA            complement(369722..371484)
                     /locus_tag="CNF01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657354.1"
                     /db_xref="GeneID:3258077"
     CDS             complement(369871..371181)
                     /locus_tag="CNF01230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513008.1"
                     /db_xref="GeneID:3258077"
                     /translation="MNPQSAPFVPTADPPAMSVDQLRSLVQQMGNPRNYPNLPLPCAP
                     RPDPRPAPLPALLASSSPPPRLPLSRSPPPKPPRPSPSHQPVPAPEPATNLPPALPVT
                     FTGERTRALAFINLLEHSIQYHYDAFFANPSLAVSWASAHLSGPAATWFQKLRATSPE
                     ALSSWKAFRSAFADAYIPPSGRLLLLEQLLELRQTTTVQEYNRSFSRLMGQLDMMEDS
                     GIVKDIYLRGLKHDIYVKLEAELEERGRPVSVGELAKLAYALDRAHGHLPSIDMRNPS
                     SSSSQPVAAPTPSFPNTRSSNPYPTPTLSPSSLNTSASDPKPRTHSQVPPKPIIQPIL
                     QDLPPPPADIGQPRQQYRLQIRDYRRKHNLCAYCGMGDHYLEECPDRADRTSEQGGKK
                     GKDWRRANGGKGDGEFRGNDKGWAEDNEGKVDAPSSVEQGQGRI"
     gene            371679..374432
                     /locus_tag="CNF01240"
                     /db_xref="GeneID:3258234"
     mRNA            join(371679..371763,371821..371914,371968..372006,
                     372061..372142,372215..372293,372345..373216,
                     373272..373363,373753..373783,373837..373989,
                     374040..374432)
                     /locus_tag="CNF01240"
                     /product="p68-like protein, putative"
                     /transcript_id="XM_571269.1"
                     /db_xref="GeneID:3258234"
     mRNA            join(371679..371763,371821..371914,372061..372142,
                     372215..372293,372345..373216,373272..373363,
                     373753..373783,373837..373989,374040..374432)
                     /locus_tag="CNF01240"
                     /product="p68-like protein, putative"
                     /transcript_id="XM_571268.1"
                     /db_xref="GeneID:3258234"
     CDS             join(371761..371763,371821..371914,371968..372006,
                     372061..372142,372215..372293,372345..373216,
                     373272..373363,373753..373783,373837..373989,
                     374040..374217)
                     /locus_tag="CNF01240"
                     /codon_start=1
                     /product="p68-like protein, putative"
                     /protein_id="XP_571269.1"
                     /db_xref="GeneID:3258234"
                     /translation="MSYGGGYGGGGYGGGYGGGGGGGGYGGGGGGYGGGYGGGGYGGG
                     FGGDRMGNLGQGLHNIDWQNQSLAKFEKNFYVQDPRVTARSDAEVEAFRAEKEMKIQG
                     KNVPRPITTFEEAGFPDYIMSEIRRMGFTAPSSIQCQAWPMALSGRDLVAIAETGSGK
                     TISFCLPAMVHINAQPLLAPGDGPIVLILAPTRELAVQIQTEATKFGQSSRIRNTAIY
                     GGAPKGPQIRDLQRGVEICVATPGRLIDMLETGKTNLKRVTYLVMDEADRMLDMGFEP
                     QIRKIVSQIRPDRQTLLFSATWPKEVQRLAMDFLHDFIQVNIGSLDLTANHNVAQHVE
                     VCTDFDKRSKLLSHLEKISQENGKVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQ
                     AERDWVLAEFKSGRSPIMLATDVASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRA
                     GRKGTSYTYFTMDNSKAARELVQILRESKADIPPELEEMAMYGGRGGGGGRGRGGRGG
                     GRGGYGGGGGRGGYSSGANSYGGGGGGYSSRW"
     CDS             join(371761..371763,371821..371914,372061..372142,
                     372215..372293,372345..373216,373272..373363,
                     373753..373783,373837..373989,374040..374217)
                     /locus_tag="CNF01240"
                     /codon_start=1
                     /product="p68-like protein, putative"
                     /protein_id="XP_571268.1"
                     /db_xref="GeneID:3258234"
                     /translation="MSYGGGYGGGGYGGGYGGGGGGGGYGGGGGGYGGDRMGNLGQGL
                     HNIDWQNQSLAKFEKNFYVQDPRVTARSDAEVEAFRAEKEMKIQGKNVPRPITTFEEA
                     GFPDYIMSEIRRMGFTAPSSIQCQAWPMALSGRDLVAIAETGSGKTISFCLPAMVHIN
                     AQPLLAPGDGPIVLILAPTRELAVQIQTEATKFGQSSRIRNTAIYGGAPKGPQIRDLQ
                     RGVEICVATPGRLIDMLETGKTNLKRVTYLVMDEADRMLDMGFEPQIRKIVSQIRPDR
                     QTLLFSATWPKEVQRLAMDFLHDFIQVNIGSLDLTANHNVAQHVEVCTDFDKRSKLLS
                     HLEKISQENGKVLIFVATKRVADDLTKFLRMDGWPALAIHGDKQQAERDWVLAEFKSG
                     RSPIMLATDVASRGLDVRDIGYVINYDFPNNCEDYIHRIGRTGRAGRKGTSYTYFTMD
                     NSKAARELVQILRESKADIPPELEEMAMYGGRGGGGGRGRGGRGGGRGGYGGGGGRGG
                     YSSGANSYGGGGGGYSSRW"
     gene            374580..377065
                     /locus_tag="CNF01250"
                     /db_xref="GeneID:3258217"
     mRNA            join(374580..374642,374713..374769,374829..375470,
                     375526..375791,375843..376124,376174..376345,
                     376405..376778,376839..377065)
                     /locus_tag="CNF01250"
                     /product="rRNA primary transcript binding protein,
                     putative"
                     /transcript_id="XM_571552.2"
                     /db_xref="GeneID:3258217"
     CDS             join(374627..374642,374713..374769,374829..375470,
                     375526..375791,375843..376124,376174..376345,
                     376405..376778,376839..376985)
                     /locus_tag="CNF01250"
                     /codon_start=1
                     /product="rRNA primary transcript binding protein,
                     putative"
                     /protein_id="XP_571552.1"
                     /db_xref="GeneID:3258217"
                     /translation="MDAGYDALEEAASSYAKNRDRADDTRSHRSHKDRDYEREDRDPE
                     RRHRRDDKDDRYRERDRDAYRGERDLGRERDYRPRDRERERERGYEARDRYDRYERGD
                     GRGAGGFEERPPRRRRRDEEELTLAAEPMHGHRDRRPRYDEPPEFAEPMRGNWSPPRR
                     RRDDGFRGGRGDRDGGRRGGGGGGGGGGGGGRFYEDRRSPTPDGTMSLEERKEKLSRS
                     LWDTAPVQFQGISALEAKTTGLFTYGPGRVPPPAHLGIPATFVAGAFPPSNPVRQNNR
                     LYIGGIKEDMQEQQIQDFFNNLMKEKGMADGKEDPVKQCQINNDRNFAFIELHTPEQA
                     TAALELDGVVLDGASLRVRRPKDYAGIDPLLQTFNGVVAPSVADSPNKLFIGGIPTYL
                     NDEQVMELLKSFGELKSFNLVKESAGVSKGFAFAEYLDPEVTDMAIQGLHNFSLGDRN
                     LVVQRAAVGRNTGVNAPIPGSAAYLSQAIPHLMQNNADAPSSRVMLLLNMVTPEELYN
                     DDDYNDIIEDINEECSKYGEIEGVRIPRPVPKSKKWESTEAAAATAERNKRTDDEAGV
                     GRVYVMYKDVESTKKAMNAIGGRQFAGRTILVANVPEEEFLGPAPPPPPPEDAPAPAE
                     SDAPPPPPPADLDAAADAALKDIMSGI"
     gene            complement(376875..378923)
                     /locus_tag="CNF01260"
                     /db_xref="GeneID:3258268"
     mRNA            complement(join(376875..377520,377580..377695,
                     377751..377923,377987..378106,378178..378285,
                     378342..378358,378409..378923))
                     /locus_tag="CNF01260"
                     /product="thioredoxin-disulfide reductase, putative"
                     /transcript_id="XM_571270.1"
                     /db_xref="GeneID:3258268"
     CDS             complement(join(377119..377520,377580..377695,
                     377751..377923,377987..378106,378178..378285,
                     378342..378358,378409..378588))
                     /locus_tag="CNF01260"
                     /codon_start=1
                     /product="thioredoxin-disulfide reductase, putative"
                     /protein_id="XP_571270.1"
                     /db_xref="GeneID:3258268"
                     /translation="MSPIANGNPHGSSFSVREPERTGEVSKKMHSKVVIIGSGPGGHT
                     AAIYLARANLEPVLYEGMLANGFAPGGQLTTTTDVENFPGFPEGVTGTEMMDKFRAQS
                     ERFGTKIITETVARVDLSVRPFKYWTEGEEEEHEFMTADTIIMATGASAKRLFLPGED
                     TYWQSGISACAVCDGAVPLFRQKPLAVIGGGDSAAEEATYLTKYGSHVYVLVRRDELR
                     ASKIMAKRLTSHPKVTVLWNTVATEAKGDGEVLTSLTIKNTKTGEIGDLPVNGLFYAI
                     GHEPATSLVKSQVELDSDGYIKTVPGTSQTSVHGVFAAGDVQDKKYRQAITSAGSGCI
                     AALEAEKLISEEEADDESLQTQDVHVPAEHYLGTDKE"
     gene            complement(379623..383385)
                     /locus_tag="CNF01270"
                     /db_xref="GeneID:3258240"
     mRNA            complement(join(379623..379697,379762..380023,
                     380080..380205,380266..380341,380397..380509,
                     380576..380651,380703..381841,381896..382052,
                     382100..382250,382312..382452,382509..382601,
                     382657..382927,382988..383091,383148..383210,
                     383282..383385))
                     /locus_tag="CNF01270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657355.1"
                     /db_xref="GeneID:3258240"
     CDS             complement(join(379650..379697,379762..380023,
                     380080..380205,380266..380341,380397..380509,
                     380576..380651,380703..381841,381896..382052,
                     382100..382250,382312..382452,382509..382601,
                     382657..382927,382988..383091,383148..383210,
                     383282..383332))
                     /locus_tag="CNF01270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513009.1"
                     /db_xref="GeneID:3258240"
                     /translation="MPLPPSLPGLPDDYTPQYFGNDIVVGLDSEGQYKAKVLRCWSDE
                     DGSIIPPPPPGQEAHPLDRPLKRGEVGISHLSTGQLAIVPESALRLFQREFLKGDIVK
                     RSLTSQESALVVNVKTEIKLQHALTGEELDQWVKYEDVSNALEIDARDRVVYGNWVGT
                     VEEVFENGFVETKLGRYYRIAEMGGLLEVGRRVEEVLPKNLFEQLAAMPKPLPDFAEP
                     QTDRVLKIDPVVVYVIWNAINQKLPPSEQEKFKEPEPFWYGENLKKLAFFDTTHSQPP
                     SIGSTVDFVSEDARRKYGAEPSRHAEGTVLVDTMRILASRSTLVLRWQTGRETEEPST
                     DFVPYHNVDDYETWPGEHVMWRGDNGERRHAVVQKFDPYQRVAELLFMDDQTKELVPV
                     MELDPGGRSGSNAYGVSIGQMVLLCGDNGSVPPEVPSFGQHETPVKNMWARHEFVKLG
                     EEYVSGDLKFGWYPPEGDKQSVDWWGEVVQLHLNGEVTVKLANGDLKTVGIKNLAILN
                     DPGSDMIDELGPEMNEGEAMDEDEFDEFDEWQNGLRGAHGGFVFDGAQVHDLQAMLSR
                     LKESHQPEESENSWETMSEDDIHDVDTEGEVMEVDEMEEEEEERAIAQAEAAGRRQEQ
                     SGVPLVEQQSFPPVKPLASQPLQKAEPRAGPSTAIPSTSRAPLPKESLDEDDEQWERF
                     EMLEQAPRDHHFYNELSSGAAAKSYHSRIQKEHRALQSSLPENILVRTYEDRLDLMRV
                     LIIGPEGTPYTDAPFVFDVYLNPTKFPNEPPIVHFHSHTNGHGRCNPNLYEEGKVCLS
                     ILGTWSGDESESWNPSKSSLLQVFVSISGLVLVRCPYHCEPAFAKLEGTREGKINSRL
                     YSEKAYVLSRTFVRTALERPPTGLESEIRYFYLTRGRLRSVIDHAQRLIEKGEVGQSI
                     EQEEENAEMWNADAMGRLTMGAIITLKRTIGSLQKIWDTQSS"
     gene            complement(383789..384678)
                     /locus_tag="CNF01280"
                     /db_xref="GeneID:3258369"
     mRNA            complement(join(383789..384027,384087..384108,
                     384165..384247,384306..384513,384569..384678))
                     /locus_tag="CNF01280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571563.2"
                     /db_xref="GeneID:3258369"
     CDS             complement(join(384013..384027,384087..384108,
                     384165..384247,384306..384513,384569..384627))
                     /locus_tag="CNF01280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571563.1"
                     /db_xref="GeneID:3258369"
                     /translation="MSDYAFVPGGSLKFKGGGDKKKKKKSHSSSDRAKVDNEIKQKDK
                     EMKDKSREREVSAEVGSTSPAPERREDGPKMTEAERRFLETQKRRREERAKHTAKKTH
                     KERVQEFNAKLDSLSEHHDMPRIGPG"
     gene            384816..385568
                     /locus_tag="CNF01290"
                     /db_xref="GeneID:3258298"
     mRNA            join(384816..384939,385004..385032,385096..385145,
                     385201..385210,385277..385312,385368..385568)
                     /locus_tag="CNF01290"
                     /product="itochondrial import inner membrane translocase
                     subunit tim8, putative"
                     /transcript_id="XM_571274.2"
                     /db_xref="GeneID:3258298"
     CDS             join(384895..384939,385004..385032,385096..385145,
                     385201..385210,385277..385312,385368..385464)
                     /locus_tag="CNF01290"
                     /codon_start=1
                     /product="itochondrial import inner membrane translocase
                     subunit tim8, putative"
                     /protein_id="XP_571274.2"
                     /db_xref="GeneID:3258298"
                     /translation="MSAPTSIPALDEASKKELESFLEQEQAKAKLQASIHELTNTCWN
                     TCITGGISSKFSKSEAQCLENCVDRFLDSSLYIVRQIEAQKQQI"
     gene            complement(385683..388258)
                     /locus_tag="CNF01300"
                     /db_xref="GeneID:3258079"
     mRNA            complement(join(385683..386159,386211..386603,
                     386654..386774,386825..387523,387642..387906,
                     387964..388036,388134..388258))
                     /locus_tag="CNF01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657356.1"
                     /db_xref="GeneID:3258079"
     CDS             complement(join(385812..386159,386211..386603,
                     386654..386774,386825..387523,387642..387820))
                     /locus_tag="CNF01300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513096.1"
                     /db_xref="GeneID:3258079"
                     /translation="MGDQTPTQLIMGSSSRPTSPRPLSANSHSSSGDEKEKKGLMLPP
                     PVPVKTNKGQEDKPVPPRMTRLPSLKQLSEHLHYTPPTPPSQQPNLHEQSPGSSSSNP
                     LRISTNPVPLQSSSAASHTSIVMTPTSTGRLKLPASAMMRSLSAGSSGSATGGLAPVT
                     SSPAIAPNLGSVQGQGHSPTSAHSPTPAQQLAKFVPGGLGDFRPESGPEASTSMSRSA
                     SHEVHAEHHREIPSLDEIKKKVNVSKGEDQHRLDLPNERVTEKEKSKTSVESTGERIS
                     ISSAKGGKKEHPLQHSWTLYYDSKTYKPDPSLIASKQGDKILADYEMTLLTIGKFDTV
                     EGFARHFNNVRLPSQLTPSSNYHLFKSGIRPMWEDPANANGGKWVILFRSSPGTLDIA
                     WANLTMALVGEILDPENQVCGIVGSTRPKVDRLQVWTRGKDDVEGLNQLGKRIVEVMA
                     LEGRDADSMSMEYQYNTNDSRPPPNKFIHISYANRAPSTPSRSMSSAFQGPPGSLGGM
                     GQARTHSSSGVNLTHPLPLPPHSPAVIKGDHGSGNNATGMKRGLSHGNPLTGPLDLVR
                     QENYGSQEGVTGV"
     gene            complement(388904..391284)
                     /locus_tag="CNF01310"
                     /db_xref="GeneID:3258171"
     mRNA            complement(join(388904..389092,389149..389425,
                     389480..389670,389725..389932,389983..390079,
                     390126..390185,390238..390884,390942..391284))
                     /locus_tag="CNF01310"
                     /product="Cytochrome P450, putative"
                     /transcript_id="XM_571276.1"
                     /db_xref="GeneID:3258171"
     CDS             complement(join(389011..389092,389149..389425,
                     389480..389670,389725..389932,389983..390079,
                     390126..390185,390238..390884,390942..391128))
                     /locus_tag="CNF01310"
                     /codon_start=1
                     /product="Cytochrome P450, putative"
                     /protein_id="XP_571276.1"
                     /db_xref="GeneID:3258171"
                     /translation="MTMELLKVLHHEASQLFPNCIRSSPVACIVLYSFGGIAILLFSV
                     YLWLWPFQYAKLYFRNLPGPPSDSWFWGVVPTLIKSPPSVPHSMWTDEYGPTVRYRVA
                     LGAQRFLTIDPTALNYILSHADLFPKPSRVRKALSDLLGNGLLTAEGHTHKKQRKALN
                     PSFSPAAVRGMIPVFYDKAYELKAKLLGIIEGDETEQASPTPCKEEDEVEGGKKIDVM
                     KYLGKTTLDVIGIVGFSYDFKALSEPRNELSEAYSKMFQAGMDANFWDFLRGAIPLVN
                     KLPNKRATEIAARKAVTLRISKKIVEDKKREVMSAHSEGLEKREDIGDDLLSILIKAN
                     MASDVKPEQKLSDEEVLDQITTFMLAGNETSSTALTWILYSLTQHPECQTRLREEVLA
                     VPDDRPSLETLNNLPYMDAVIREALRLHAPAPGTMREAKEDTVIPLSMPVIGRDGKQI
                     DSVKINKGTMVFIPIITVNTSPAIWGPDARVFNPDRHLKTSSDSFGGANMHVPGVWGN
                     MLSFLGGARNCIGYKLALAEISTILFVLIRSFEFQELKSKPEVEKKASVVMRPRIKGE
                     ESAGLQMPLMVKPLLM"
     gene            391821..393983
                     /locus_tag="CNF01320"
                     /db_xref="GeneID:3258466"
     mRNA            join(391821..392996,393052..393157,393213..393413,
                     393473..393983)
                     /locus_tag="CNF01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_571278.2"
                     /db_xref="GeneID:3258466"
     CDS             join(391853..392996,393052..393157,393213..393413,
                     393473..393827)
                     /locus_tag="CNF01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571278.1"
                     /db_xref="GeneID:3258466"
                     /translation="MDSQPLQPLRNPKYRHVSRSAAKRESVQMLGSIQNLRLQFSQVG
                     VSHKAGAGAGVRCDDGPGVMGLGMVGEDDEENRPLPKGEQRERRERKPWKEVDLPRVE
                     PEAARKEAQEIVASIRQIWGLSMPASPTSPHGLSTSKSLYFSSLAAVAGGEEEARTSE
                     DIRSALVTTARSMRRIRFLALSVCQGRSSTSAIVPAYNSKLRTSFSTPSRPGVPLPRA
                     VSSPLERRVLSGQKQGDDVLASLRKSALDVLTALRALEERLRIQAGVPEDDRILAPIN
                     SQSSSVEPEYYESEYDSDDYNLNALAQEGDSGSLASLPWEERLVQESRSYRVLEGPGW
                     EKEARMTREDVGKWVAVAEKLFLVGAKGEDGEKEMPEWAKDWQGDAFSRLHALLSSHL
                     PTELASTLPSPQSENFRSTFLSSLSDGYVLIQAYNAVLLQSSKPWGFIPEEDIHPTLT
                     ATGGHGDFTPAGEEGKKDKEWTFRRVGNLTCFAAALRHRYQLPILMPSSTSAPSFLPK
                     PVALPQPSKDRVERSTSAPPSTPKSASSLPNTPTSTTSKGRDVPKIEFDPMTVAKKLE
                     GWEEMLEEVVNNWVAGVVREINAVREARKKRGGMI"
     gene            complement(393862..394787)
                     /locus_tag="CNF01330"
                     /db_xref="GeneID:3258279"
     mRNA            complement(join(393862..394247,394300..394449,
                     394547..394787))
                     /locus_tag="CNF01330"
                     /product="transcription-related protein, putative"
                     /transcript_id="XM_571559.2"
                     /db_xref="GeneID:3258279"
     CDS             complement(join(394042..394247,394300..394449,
                     394547..394766))
                     /locus_tag="CNF01330"
                     /codon_start=1
                     /product="transcription-related protein, putative"
                     /protein_id="XP_571559.1"
                     /db_xref="GeneID:3258279"
                     /translation="MSRQLDNVNPTIFAPSAPSFVRRSTGKSAKSSLWAPEALSDDGE
                     DYYSPGARSSGSVSDEEEGREDIDAQEVYDLLRSITDPEHPVSLEQLRVVNPEDIHVA
                     GNRVLVYLTPTIPHCSMSTLIGLSLRVRLLRALPPRYRVDIRIKSGTHQSEHAVNKQL
                     NDKERVQAALENKHLLSVVEGCLATAGKRGE"
     gene            394969..395939
                     /locus_tag="CNF01340"
                     /db_xref="GeneID:3258064"
     mRNA            join(394969..395047,395094..395103,395246..395265,
                     395327..395362,395429..395432,395493..395589,
                     395740..395747,395803..395939)
                     /locus_tag="CNF01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_571555.2"
                     /db_xref="GeneID:3258064"
     CDS             join(395034..395047,395094..395103,395246..395265,
                     395327..395362,395429..395432,395493..395589,
                     395740..395747,395803..395862)
                     /locus_tag="CNF01340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571555.1"
                     /db_xref="GeneID:3258064"
                     /translation="MAEDKTFVLQTTGFDARFPNQNQTKHCWQNFVDYHKCVNAKGEE
                     FAPCQQFKKAFRSLCPNDWVGQWNEQIEAGTFPASLKP"
     gene            complement(396020..399264)
                     /locus_tag="CNF01350"
                     /db_xref="GeneID:3258056"
     mRNA            complement(join(396020..396232,396291..396420,
                     396478..396583,396639..396779,396831..397365,
                     397419..397549,397597..397726,397774..398199,
                     398251..398392,398447..398562,398618..398671,
                     398723..399078,399147..399264))
                     /locus_tag="CNF01350"
                     /product="GTPase activating protein, putative"
                     /transcript_id="XM_571557.1"
                     /db_xref="GeneID:3258056"
     CDS             complement(join(396158..396232,396291..396420,
                     396478..396583,396639..396779,396831..397365,
                     397419..397549,397597..397726,397774..398199,
                     398251..398392,398447..398562,398618..398671,
                     398723..399078,399147..399225))
                     /locus_tag="CNF01350"
                     /codon_start=1
                     /product="GTPase activating protein, putative"
                     /protein_id="XP_571557.1"
                     /db_xref="GeneID:3258056"
                     /translation="MEQYKEDYVDVKHPEDDSYSFRSRQYSLDVPQSSQPQKPPSPVK
                     PPLTHNSSSTSTNPATSSQYDHYSAESTSALSAQSVQSTQSAQSSAPTAAVRSSTANE
                     RRTSVGLGAPGGLAAMAGARQRTEEAVPVGFDEGILRGLCEMDCALPLLADRIKQSVA
                     SCKQVATFFRSRAEIEEKYARSLVELTRTTGDTYSRADCKAGTFVAAYNSSLKVQDSI
                     SQNRLRFAQRLYEMSEELQSLAREGEKARKTHKETGVRYQLIIQDAESVVEKSKSRLD
                     SIIDDLDRVLAAKEGEALKDVRSGGAYNMIGGPAYGGAPSSNINLHNGGGKSKLGKAM
                     KTGGLLFKGKGAGSLQKQEDDSRAKMDQANETFTKAVAESKQLRKEYFNYQLPKILRM
                     LKDAADELDMGTQYHLTRYAFLYETMTVGDGTVLNPLGSPEEGPGLKAIFENIDNRTD
                     FKSYMQNYAVAKGTPRGPRREGPYDQGYQKALPAHVQRSNDALAASIISPQHASPQPQ
                     PSPQAPQSYNYTASPQSSIQPQLHASPQPSSQNFHYPNSSITSTGTANTNNTLPSIPQ
                     QSNTGAGMTDQSSLTSISHEGWVPPGIPASTGATFGVDLGEQLLRDGAVVPKIVEKCT
                     QAIEMYGLESVGVYRLSGTTSRVQALKAALDKDVDAVDILSDEWSADINVVCGALKLW
                     FRELPEPLLTYGLYNAFIEAARYDNDRLRHIRLHEQVNELPDPNYATLKFFMGHLDRI
                     RRKESINQMSVSNLSIVFGPTLLGAPPEEGGLNLEHMSFQCKAIETILDKYHEIFVEE
                     EDDGEQQS"
     gene            complement(399492..401086)
                     /locus_tag="CNF01360"
                     /db_xref="GeneID:3258291"
     mRNA            complement(join(399492..399792,399842..399943,
                     399983..400102,400141..400338,400392..401086))
                     /locus_tag="CNF01360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657357.1"
                     /db_xref="GeneID:3258291"
     CDS             complement(join(399602..399792,399842..399943,
                     399983..400102,400141..400338,400392..400719))
                     /locus_tag="CNF01360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513011.1"
                     /db_xref="GeneID:3258291"
                     /translation="MSFQIGYVGLGNMGTPIFLNLARHAKANGWPVPCAWNIDQSRYD
                     EIRAQSDHLHLCEQLSEVVERSNVVFTCLLNDPVAEEVYERLFAAVGAKAKVIFVDQS
                     SLKPKTSIKLEAAAHKVGASYLSAPVFGRPDAAKSAALVQLLGGDAKAKQIVKPIFVP
                     AVAKRVVDAGDEVAKGSALKLLGNSMILGVVEMLAETYALADVIGFDPEVYQSFIRDF
                     FPLYPYIAYGDNISRGEFNGVGGFRLEAGLKDARNALSLGADFGRPVSMPTIELAKRH
                     LERAEELCGNDVDWSALAIVLREQAGLEPFRAGHKP"
     gene            complement(401635..403826)
                     /locus_tag="CNF01370"
                     /db_xref="GeneID:3258126"
     mRNA            complement(join(401635..401845,401905..401965,
                     402022..402079,402133..402313,402367..402435,
                     402485..402522,402578..402779,402834..402845,
                     402898..403290,403348..403826))
                     /locus_tag="CNF01370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571513.2"
                     /db_xref="GeneID:3258126"
     CDS             complement(join(401719..401845,401905..401965,
                     402022..402079,402133..402313,402367..402435,
                     402485..402522,402578..402779,402834..402845,
                     402898..403142))
                     /locus_tag="CNF01370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571513.1"
                     /db_xref="GeneID:3258126"
                     /translation="MTVTINPAASLPIISLAEHNSVDSLARALYDSCTQEGFIYVCDH
                     EIQQDLIDQAFAISANYFTHARPEDKVDLKTNLGYTAVRQESLDSTRPSSGDLKEFFH
                     VADNHWRVRNGESPQELPEALESSRKALDDFIEQINGLADRILRGLSVALKLKPEFLT
                     NQHRGELNRLRMLHYPPVEVEQNGINSDSNEIRAGAHTDYGSITILFQHIVSGLQVHR
                     NGSWIDVAPRKGCVVINIGDALEFWSGGLFKSTLHRVVMPRSQAEMASRYSIAYFVHA
                     DNASILEPFTDGIDEDALDEIIARKGLPRGTRRITGGDYVQARLAATYGMKVAA"
     gene            403951..405967
                     /locus_tag="CNF01380"
                     /db_xref="GeneID:3258229"
     mRNA            join(403951..404029,404114..404191,404239..404339,
                     404398..404440,404500..404645,404708..404803,
                     404855..404949,405000..405053,405102..405241,
                     405288..405400,405459..405523,405594..405658,
                     405704..405967)
                     /locus_tag="CNF01380"
                     /product="dihydropyrimidinase, putative"
                     /transcript_id="XM_024657358.1"
                     /db_xref="GeneID:3258229"
     CDS             join(404259..404339,404398..404440,404500..404645,
                     404708..404803,404855..404949,405000..405053,
                     405102..405241,405288..405400,405459..405523,
                     405594..405658,405704..405918)
                     /locus_tag="CNF01380"
                     /codon_start=1
                     /product="dihydropyrimidinase, putative"
                     /protein_id="XP_024513012.1"
                     /db_xref="GeneID:3258229"
                     /translation="MTYAALQLRDNELLDVMYEARKLAITTMIHAENGDLISWLTDKL
                     EERGMVEPGYHAESRPPIVEMEATSRAIVLAEMIQNPVLFVHVGSASAAEVIRNAQTR
                     GFPVFAETCPQYLHLTWEDLKKFHSPQCFENSKMICSPPPGPDDSDQEALWTGLRNGT
                     FTIYSSDHCPFRYGDIDGKALGVVQHEESMQSVTCPVDQDHVHEVMHGKSGHFKYIPN
                     GCPGIETRLPLLFNYGLSEGRITPERFVDLVSAAPAKLYGLYPRKGALLPGLSDADLV
                     IWYPENKMVPFSLTNDHLHHGADYSPYEGMMFNNWPRYTIIRGKIVWAEGKLCGSPKD
                     GEYLKRQASQLTMSAVKSIANDKRRVATWLYDNNGK"
     gene            complement(406166..408019)
                     /locus_tag="CNF01390"
                     /db_xref="GeneID:3258434"
     mRNA            complement(join(406166..406444,406496..406642,
                     406701..406717,406767..406845,406906..406929,
                     406988..407051,407111..407338,407388..407499,
                     407550..407705,407764..408019))
                     /locus_tag="CNF01390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657359.1"
                     /db_xref="GeneID:3258434"
     CDS             complement(join(406248..406444,406496..406642,
                     406701..406717,406767..406845,406906..406929,
                     406988..407051,407111..407338,407388..407499,
                     407550..407705,407764..407837))
                     /locus_tag="CNF01390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513121.1"
                     /db_xref="GeneID:3258434"
                     /translation="MAESQPNHLYGVGHIDGILWNTLLSHPKLSTMARKITVAAAQVG
                     AVHKDSQRPETLSRLISLLEQASQNGVEVLVYPETTFTTFFPRWKGLDDDREELDRWF
                     EHGDITTNPNIAPLISRAKDLGIDIVIGYGEKTDDSHYYNTCSYIHAGKEISKYRKVH
                     LPGNKEPYPDPEFIDQLEKRYFEPGDYGFKAFRVPDLAVTPEDGEAIAGMMICNDRRW
                     AESWRCLGLQGVELVCLGYNTSTWAPGLFGHSKDADPEVIKAQSEFQHLLVMQAHSYT
                     NATFSIAAARAGFDDGKFGLIGCSCIVHPEGHIIAQSKTMDDELVIATIDLDDAKIGK
                     QKVFNFGLHRQPHQYSIITQQAGVTAPPRLN"
     gene            408405..410499
                     /locus_tag="CNF01400"
                     /db_xref="GeneID:3258388"
     mRNA            join(408405..408646,408697..408877,408933..409006,
                     409046..409203,409252..409456,409509..409621,
                     409676..409782,409841..410035,410082..410287,
                     410339..410499)
                     /locus_tag="CNF01400"
                     /product="expressed protein"
                     /transcript_id="XM_571577.2"
                     /db_xref="GeneID:3258388"
     CDS             join(408507..408646,408697..408877,408933..409006,
                     409046..409203,409252..409456,409509..409621,
                     409676..409782,409841..410035,410082..410287,
                     410339..410345)
                     /locus_tag="CNF01400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571577.1"
                     /db_xref="GeneID:3258388"
                     /translation="MFFHDPEKEPVTGDSIDPVTLIDNQVDEENEVFRVTSSGEQYRT
                     VSWYKSFALMFKILFSVGVLSIPSVFSYVGALPGALLLIGWGAFNAYSAFLLGAFRLR
                     HSGIHGMQDMAYIVGGVWYRELVGVLFIIGYDLVAGSGYIGVATALNTLSDHGACTVW
                     FSFVAFVLSTAIAMFPKLAQVGVAAWAGVITLFISIFILVVAVAVNDRPALAPPTGDF
                     DLGYHVIGSPNFTEGMTAALTIFISSGGISAFVPIIAEMKNPKEYKKPIAVSMGFLNA
                     CYLAFALVIYRYCGTWISSPALGSAGPLIKKLTYGIALPGLIMSSTVNQHLAAKYIFV
                     RLLRGTKHLQSKTMVHWATWFGVSLLCGVAAFVIGEAVPFFGTLISLLAAIAYAPMAI
                     VIPMHLWLYDFADYRKQGLVKKLQWLFHLVMLVVGLFMTVAGAYTSIKSIADQYAAGT
                     VSSAFSCADNS"
     gene            410988..414672
                     /locus_tag="CNF01410"
                     /db_xref="GeneID:3258306"
     mRNA            join(410988..411077,411148..411165,411229..411240,
                     411298..411327,411376..411435,411484..411676,
                     411728..411813,411871..411952,412006..412259,
                     412312..412334,412384..412475,412523..412574,
                     412626..412710,412762..412854,412902..413029,
                     413082..413114,413171..413305,413344..413362,
                     413411..413582,413634..413651,413700..413771,
                     413819..413892,413945..414672)
                     /locus_tag="CNF01410"
                     /product="expressed protein"
                     /transcript_id="XM_024657360.1"
                     /db_xref="GeneID:3258306"
     CDS             join(411001..411077,411148..411165,411229..411240,
                     411298..411327,411376..411435,411484..411676,
                     411728..411813,411871..411952,412006..412259,
                     412312..412334,412384..412475,412523..412574,
                     412626..412710,412762..412854,412902..413029,
                     413082..413114,413171..413305,413344..413362,
                     413411..413582,413634..413651,413700..413771,
                     413819..413892,413945..414548)
                     /locus_tag="CNF01410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513104.1"
                     /db_xref="GeneID:3258306"
                     /translation="MDEDSSSVPRKSATGPVRVSQRQPQSCTECTRRKTRCDKRVPCV
                     NCCKRGVPEKCQIEQVIPSKNLSTAAQIKTLRDEMLAADHELRQRVEALEKLVKSLTA
                     SREASEKATKATTTVLSPSISPSAMNDQGNNTDENLDESVGGGYDDDEAEAAATLEFL
                     AIGRLRPKPPGGSDVIYNGDANQVDGQACSEDGEMNESPPIILSLSDPTHASTHPQTY
                     LHLPPVKLSRLNDRRLALYHEVVRKDILSQLPPATVGRALVQFDMDNVAWMHCCYHGP
                     TFQREADLVWAELGSDDVEINWSFMALLFGVLMSGAYHLPESTFQYLFPSQTRLDLIN
                     QWFTACIMCLQEADWMRSHSLYAIQCVAIITSAANHIGKADLYFTLLGAAVRIAQALN
                     LHRLGPDSELLYKSKNSKLIIAREVRKRTWYQLLYQDAFHVAFNGACSINRAQFNTAP
                     PIHCIDSMLGLGMEEAKVSYDIPTTDSHVCQLYKLALQVNRAYSSTEAMAPLPYDVIL
                     QIDRDIHTIMNEAPLWMRDENYVLDPNAPAWADWQRKAYILSASHKVIVLHRPYLGRA
                     FRGDQRYIRSRENCLQHAHKILRIFKGCSLVQFRTTWTVLVHAVAASLILLLDASQQT
                     NHCALNSIQIVRETVDILRQLSDLSIIAKKGFLVISPLIEDSAQLTEAGPDVNVRNRK
                     AFLGKAETELKQALDVFRRGHSTAPPSVSPFSASGHVELSAICNQDASMASDSEAMVA
                     TSSLIGASQVRGLEATDVWNPFLWNSQGDMGSSTNPNMMMDWGNPESLSLSGDTSGMD
                     WMSYT"
     gene            414884..416451
                     /locus_tag="CNF01420"
                     /db_xref="GeneID:3258420"
     mRNA            join(414884..415123,415183..415368,415424..415771,
                     415824..415945,416000..416127,416173..416451)
                     /locus_tag="CNF01420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657361.1"
                     /db_xref="GeneID:3258420"
     CDS             join(415218..415368,415424..415771,415824..415945,
                     416000..416127,416173..416344)
                     /locus_tag="CNF01420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513106.1"
                     /db_xref="GeneID:3258420"
                     /translation="MGVFKTITFAQHDGVDIDLDYMLPQSPSSDSKLPILLWFHGGGL
                     LQGTRTCAWAHLVSAVEKYKLCLVSADYRLAPQTRMPGIMADIKAAMDYLRSPEFLSE
                     TGNAVDQNKIIVSGGSAGGWLALLIGSGVGFEACGLTPPAKPLGVVPLYPITDIEDSF
                     FTTKQHPVSYIKEMIPKSAVAAYLDPKTPQSSGCPLTSPRMKCYPYMVQEALEQELLL
                     DGTEIPPSAFSIAPAIASGKFTLPPTYIIHGTIDDKVPIRQSEDVFKACKQQNIDVTF
                     EVLEGVDHLFDMDPKYTLDEAYAFITKLVQ"
     gene            complement(416417..418411)
                     /locus_tag="CNF01430"
                     /db_xref="GeneID:3258444"
     mRNA            complement(join(416417..416624,416683..416852,
                     416903..417336,417392..417803,417856..418411))
                     /locus_tag="CNF01430"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /transcript_id="XM_024657362.1"
                     /db_xref="GeneID:3258444"
     CDS             complement(join(416593..416624,416683..416852,
                     416903..417336,417392..417803,417856..418310))
                     /locus_tag="CNF01430"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /protein_id="XP_024513013.1"
                     /db_xref="GeneID:3258444"
                     /translation="MSVLKWLNPRSNKYSSLPTSNPSSGHLNPELFHSSPAKRKRLLQ
                     IGLGTVFSILLLGAVIRQSVLPRSLVTGQKDNDWQDGVPGIIGDVSANPNQENPIEAS
                     GEIELEREKPGWTEAMGWKSSSNKGLADLGEIAEQRYILNVDAGESGTREYFRRLYDF
                     AVTLPVRLHSPFLSSLHDHLPPAYIDALPNYPNSQPYLPSMVSYKNIHMTDKTFNPQN
                     KFIQSWEETNSKDGWQINFLDDQQAQDWVEKNFRRSDVEWAWNFMHRGVLKADFLRYL
                     LPLVHGGVYSDVDTRPIRPIEQWGLLDTEYLDLTATDGPSWKTALSTHPAVIVAVDVD
                     VHAKQGWERYWPRPLGICQWTLSSAPNHPIFLDAVRRVVNSSRVVQAWEEQRDEEVTR
                     LEREQPRGWSREVDRLRKLGRSEAMSVMEWTGPGLFTDSVLAFLLSRYNVTWHRLRGL
                     EHPLRIGDVLILPITAFSPGGEKDFRAKGPDSPQANVLHNFRGSWKPDGA"
     gene            420252..422958
                     /locus_tag="CNF01440"
                     /db_xref="GeneID:3258287"
     mRNA            join(420252..420934,420994..421106,421162..421246,
                     421297..421474,421536..421641,421738..421935,
                     421993..422958)
                     /locus_tag="CNF01440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571287.2"
                     /db_xref="GeneID:3258287"
     CDS             join(420864..420934,420994..421106,421162..421246,
                     421297..421474,421536..421641,421738..421935,
                     421993..422792)
                     /locus_tag="CNF01440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571287.1"
                     /db_xref="GeneID:3258287"
                     /translation="MDMYETASTQQPAAICILKSPIDAIHILEAARLGLVPRVTRRLT
                     GHERSMIRPGTVWVWEEAETNMRRWTDGRRWGASRVGGGGFLVYTESSESLSPPRQLE
                     TPYGHNMYHPGSTHRSDSLIKQTYSTTMTHPVTGKVKKFHVVAYSSKRNPQGDPLNPL
                     PLPHQLPALRHLKVTPGIWPEWETPTSSPATLSYPLHPQQPPTAYPPSYPQSRPEAYP
                     RASASTPAYFHNPSYMSPGISPAAERGMYQPAEPSHQPPSHLNPMSNGCSQHTNGSSN
                     KRYHPYEQPSRNIEQRPPSFFPGPPPMLPAISNDFGREMGAYGPPAWIGASRGSPAPQ
                     YAYSYPTRPSDYLKNGHYYDTPLPYPPYRDPMPSDGRYAVATPGDTRRYTPVDDHMRN
                     QLPHLYRDAPSTYNNANQGNEASRPATPGELNAQYPGDRTSGSPNLPTGGVTLPPLRA
                     TFKEEASPEGGGSMLPPASKLSPSGRYSVVDRHSSQSPSGVPKTKVQNTWAEDARQLG
                     ELGRRVVL"
     gene            423142..427564
                     /locus_tag="CNF01450"
                     /db_xref="GeneID:3258113"
     mRNA            join(423142..423621,423692..423746,423800..423857,
                     423910..423953,424010..424126,424183..424328,
                     424381..424441,424490..424551,424612..424676,
                     424735..424874,424924..424971,425019..425156,
                     425221..425313,425370..425402,425452..425565,
                     425619..425752,425805..425850,425908..425992,
                     426042..426058,426105..426254,426317..427564)
                     /locus_tag="CNF01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657363.1"
                     /db_xref="GeneID:3258113"
     CDS             join(423547..423621,423692..423746,423800..423857,
                     423910..423953,424010..424126,424183..424328,
                     424381..424441,424490..424551,424612..424676,
                     424735..424874,424924..424971,425019..425156,
                     425221..425313,425370..425402,425452..425565,
                     425619..425752,425805..425850,425908..425992,
                     426042..426058,426105..426254,426317..427407)
                     /locus_tag="CNF01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513134.1"
                     /db_xref="GeneID:3258113"
                     /translation="MASTSGEATPLLTSTSGLSPKVLSETKVYPLIHLIRVDIMSHID
                     APLTHEQLLAPDSTYTIVRPLTEKYLALQNQAIVFCLLLNKVQFSRESTQLSIATLSL
                     TRATLCEILASRVLRGWSERSLPLATVLLTPWALFQGASQEVIDRAKEEGDDELLRQG
                     GTALEMAIISSSKRFIRSPSCQKVIEGIWGGRIIYTALNAHALIADNYKKKPIQMYNP
                     HKAPFLDHYRLKVPRYRSMLEYVNFLVLFILYVIAIEGLVESRINGREWAFIIYAMAF
                     SLDKLAAIREHGLKVFSSSLVNGFDLVFMIIYAVYLGARTYGARYHNEYALGLGADWL
                     AIGAVLIFPRLAFVTLANNLMILSIRSMLTEFFFLMGVGIFCFLGFVYALFTLGQGKF
                     ELSQIAWWLLEVYFGLDASGFEHAYLFHPFLGPLLMVFYALLSNTLLLTVLVAILGNT
                     FATINADAAAESMFRKAVSTLEGVKADAVFSYQLPFNLVAVIIMWPMRYVLNARWFHK
                     VNVFMIRVTSVHILLLIALYERQSYQDQGLMEQLGDFAERYVGSLPRRLKAAAGFDNF
                     ASRSDIAAVFEIEREVGAFYAGWDDEVDESEIILPPAFDGDPPSMNNDDERPGQDITA
                     FDSATAPSKKHSSPPSPASPLTASPSRLEHQLENPHARRNSMPSSHRSYIQNPYQVPI
                     RRRNSSIHGPSPLAQLFVRGSESDALRGRRASMAGAIGAGPALAAPPVFGPSSKPRRS
                     HFRSESFPEFSSKEQDPHQHPATNSVSRSNKSYLINPSIAPITEGKSVSFSSDLKDPE
                     DDPVCDPSSSIAGRKEGNLAVGHGGLPIGNREEVKTSPLSVKATRFQTAFPGAYSPLG
                     TVNDSRPHTPNSQASNVAKASQVEVLALARPEEEALKQNMKEKLEEMDRRQKHIEQLL
                     ERLLGHFER"
     gene            429099..431425
                     /locus_tag="CNF01460"
                     /db_xref="GeneID:3258168"
     mRNA            join(429099..429418,429488..429499,429556..429727,
                     429786..429932,429984..430168,430222..430485,
                     430539..430752,430802..430899,430952..431262,
                     431311..431425)
                     /locus_tag="CNF01460"
                     /product="allantoate transporter, putative"
                     /transcript_id="XM_571481.2"
                     /db_xref="GeneID:3258168"
     CDS             join(429203..429418,429488..429499,429556..429727,
                     429786..429932,429984..430168,430222..430485,
                     430539..430752,430802..430899,430952..431262,
                     431311..431338)
                     /locus_tag="CNF01460"
                     /codon_start=1
                     /product="allantoate transporter, putative"
                     /protein_id="XP_571481.1"
                     /db_xref="GeneID:3258168"
                     /translation="MSQDYKADEKEVISHFEHVDTQKEDLEDGHKRRKVNNQLDEAAK
                     ILEERGEIEYTIEDSKRVLRKIDIYVCIPMCMVYMLQQLDKMTISQAAVFNLQEETNL
                     QGSEYSWLTSCVYVAQLIFQPLSSYALVVFPVKYWVMFNFISWSIVTICTTAATNFTG
                     LLIARILLGAFEATILPSFVFITQMWWTRREQSYRTVAWQIANSCAAIFGPLLAFGVG
                     HVSSGIKPYQGIFLCMGAISLACSPIVWWLLPSSPTTARFLRKGDDRHIALDRLRENQ
                     MGTKSSKWKWNQVWETYRDPKTYMWAAMYFCTATPSGGIGAFNGLILKGFNFSSFQTT
                     LMSIPTGAIGIVTLLIGIWLTNRYKTRWAVLVIITLFPIGGIAALCNVPRDNTGGLMA
                     SFYIAYPLAGIQPLLYSWAGLNAAGTTKRVVVFATMFVFQCAGNIVGPQLYLKEEEPY
                     YHTGLYSNLGFYAALVVLMVSMSFYLRYLNKRQAKRRAALGLPEELEDMSIMTTEEAQ
                     RYKVKLAQRMKEHGLDEAKLYENAFDDMTDMENPAFIYVL"
     gene            432250..435282
                     /locus_tag="CNF01470"
                     /db_xref="GeneID:3258265"
     mRNA            join(432250..433191,433260..433271,433322..433493,
                     433546..433692,433743..433927,433980..434243,
                     434299..434512,434570..434667,434730..434744,
                     434796..435091,435157..435282)
                     /locus_tag="CNF01470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571483.2"
                     /db_xref="GeneID:3258265"
     CDS             join(432775..433191,433260..433271,433322..433493,
                     433546..433692,433743..433927,433980..434243,
                     434299..434512,434570..434667,434730..434744,
                     434796..435091,435157..435184)
                     /locus_tag="CNF01470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571483.2"
                     /db_xref="GeneID:3258265"
                     /translation="MMDRQALKKYFGNLLSINGFFCQSTERYQGVYMSRSPSNIRSSD
                     GLIHGSYSPRPITPHSSDPTQNMSQYLKEDEKEVVVHLENAPQSDIQDLENGHNKRRA
                     NNQADEAAKILEDRGPIEYTFEDNKRVLRMVDIYVCIPMCMVYMIQQLDKGAVSQAAV
                     FDLREETNLQGSEYSWLSSCVYVSQLIFQPLSSYALVVFPVKYWVMFNFIAWSIVTIC
                     TTAAKSFAGLLVARILLGAFEATILPSFVFITQMWWTRREQSYRTVAWQVANSCAAIL
                     GPLLAFGVGHVNSGIKPYQGIFICMGALSLACVPIVWWLLPNSPTTARFLRHGEDRYI
                     ALERLRQNQMGTKSSTWKWNQVRETYRDPKTYMWAAMYLCTATPSGGIGAFSGLIIKG
                     FNFNSFETTLMSIPTGVIGIITLIIGIWLTNRIKTRWIVLVIITLFPIAGLAALCNVD
                     RSNTAGLMASFYIAYPLAGIQPLLYSWAGLNAAGTTKRVVVFATMFVFQCTGNIIGPQ
                     VYLEREAPYYYTGIYVNVGCYSALIILMVAMSFYLRFLNRRQARRRAALGLPEELEDM
                     SIMTIEEAKAYKTKLTQQMQEKGLDEAKLYENAFDDMTDMENPAFIYVL"
     gene            complement(435360..436187)
                     /locus_tag="CNF01480"
                     /db_xref="GeneID:3258283"
     mRNA            complement(join(435360..435561,435619..435723,
                     435792..435821,435894..435980,436066..436187))
                     /locus_tag="CNF01480"
                     /product="Brt1, putative"
                     /transcript_id="XM_571289.2"
                     /db_xref="GeneID:3258283"
     CDS             complement(join(435448..435561,435619..435723,
                     435792..435821,435894..435980,436066..436119))
                     /locus_tag="CNF01480"
                     /codon_start=1
                     /product="Brt1, putative"
                     /protein_id="XP_571289.1"
                     /db_xref="GeneID:3258283"
                     /translation="MPAEYVLTNDAPPPLPGIYTQAVRAGNYVYTSGSVGMTKEGNMV
                     KGTIQDRTRQVIQNLEAVLKGANMNLSNVVKANIYLSNLSRDFVAVNEVWKDIMPEPK
                     PARTCIGVAELPAGGTDVEIEFVAYDG"
     gene            436398..439424
                     /locus_tag="CNF01490"
                     /db_xref="GeneID:3258488"
     mRNA            join(436398..437437,437484..438004,438056..438494,
                     438545..438829,438881..439424)
                     /locus_tag="CNF01490"
                     /product="expressed protein"
                     /transcript_id="XM_024657364.1"
                     /db_xref="GeneID:3258488"
     CDS             join(437945..438004,438056..438494,438545..438829,
                     438881..439272)
                     /locus_tag="CNF01490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513015.1"
                     /db_xref="GeneID:3258488"
                     /translation="MNVDLRKRFTPISNDALCQQAIQRIRQAGTGKEGVIGCLAALQV
                     EENPIIVPRWRVRECLRIIDPAGASHRFQEMVNRRKYFVPHINSLWHIDGHHKLSAYR
                     IVIIGIIDGKSRMLVGMKAMNNNRAESVLCVFQEAVTKYGIPSRMRADYGTEMLRVKD
                     AMEELRGVNRGSFIQGNSTHNQRIERIWRDLQNWCTGRYPSLFEQLAEQGFLDLGNPI
                     HLWCLHFCFIPQINAALERFTRQWNKHRLRTESGRTPEMIWKREKLTLKMQGGIDIDQ
                     NPFAIQDDNDGTVLQARGYDYTAYGVDGHRWVAPNIRRGDMSTKDVMPPLEGFDPVIS
                     DQLSDASFQAWLNQKIGPVDLTRDDMGGNRFISCVNETMGYLSSYIPNFKERLFYYM"
     gene            439805..443651
                     /locus_tag="CNF01500"
                     /db_xref="GeneID:3258498"
     mRNA            join(439805..440512,440564..443511,443564..443651)
                     /locus_tag="CNF01500"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657365.1"
                     /db_xref="GeneID:3258498"
     CDS             join(439822..440512,440564..443481)
                     /locus_tag="CNF01500"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513018.1"
                     /db_xref="GeneID:3258498"
                     /translation="MLKDIVERTSSPAEAPKAPAPSSTGFPVAVHRSQRPSAFARARR
                     AQQALKEEGKQEIGYGKAVDTVPTVQAAGPASASSMTEWEEVKRQVQGDNSKRVQNMS
                     QQEREQEIEELRERLGDKTLDLLRKRAEARQSKRNLLDVPKSELSSIDLEQPFNANIT
                     QKILQDVSEENTRRVDLMSFEEREQETEELRERFGDKIMEALRRRAEVKLTEGKSNVV
                     ERSVKPDVPASSSILSNSQDDDTNLDILKAKYFPTLPSEPSKLEWLQPISAPSSDKSI
                     RFDLSGKVLSAKDTASLPTHLGLHHHGESPDLAGYTFQDILYLCRSTVPSQRITMMGV
                     LSRILGRLHNGELDQAVQTECDETQVVQKAIELGVEVLAGLTRGAGVIRASVELLFEA
                     LCGPSWVFPDDSINADNIYQPFIQPLMTAQSDPTGIASIPFEDVLPRLTELLSIPDAL
                     PIMTTNQLLLILRRATLLSSDLCETICPIVPAILKHHVTQRSWPPKGDNRPNVEGLAL
                     LRDITASSRACAEDLLSQRVYESTLKFVISATWSEGNDVNKQEVAHSLALEVLRIYAI
                     LGRYGLSASIVASSSEVWRLFGKWVQQRSASETIPPLESSLVKAYFDLLKIWVTCAID
                     PHRTTPEHDITWAQVVALEWIDEAVSSVKQLLGRLERLEEVASALNMLVSWATGAKVN
                     GIKSGEEEKKIMLAGLKTSGLEEAIESMRSGGENETRILWSAVRLHGQLHSVGELLSK
                     DTLAALQLAFLVTNGPTVRSATYLRYELLRLSVQSKSLSPSEWLPVALDLFLSFDVGD
                     EPLALDLVDDILKADWSSTIHVIAEQYSALSHPDKLQILRPLLHYTILPDVENVVGPS
                     QPSHIYLKATSTLRAPPTSLDLNNITGLPLQPDWLFSPLNELLRSGTSIALSQVPSDW
                     SASETEIVQSVLFLGQLQCASAMWTERLGGSRLLFNMMKVFMLEHGQQTQTSTSEGEV
                     FRDSQVAKGMNRLMEHLTNPIAIAEKYPFASLETVALPFLTAGVPFFQFYTDFLALYE
                     AISFSDMIFTQLLLPPLAMSYPSDYRKLLWNDHSTALRGMRVRLHQVPLEDGTGLDGY
                     FAPKETSNEVLSGYARALTRGWVIEDRNEFLFRVASHHLAELFWRGMEEAKESDRVGL
                     MVGILSTGTDGLVRRLLEWNLETRGEGVVGPEEKQKRKEAVGKLTGTKGSKRVESL"
     gene            complement(443599..448607)
                     /locus_tag="CNF01510"
                     /db_xref="GeneID:3258190"
     mRNA            complement(join(443599..443707,443765..444203,
                     444259..444400,444457..444774,444832..444893,
                     444956..445046,445107..445172,445237..445394,
                     445462..445753,445832..445981,446064..446140,
                     446207..446393,446471..446539,446602..446712,
                     446780..447829,447884..448147,448204..448403,
                     448462..448607))
                     /locus_tag="CNF01510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657366.1"
                     /db_xref="GeneID:3258190"
     CDS             complement(join(444160..444203,444259..444400,
                     444457..444774,444832..444893,444956..445046,
                     445107..445172,445237..445394,445462..445753,
                     445832..445981,446064..446140,446207..446393,
                     446471..446539,446602..446712,446780..447829,
                     447884..448147,448204..448403,448462..448552))
                     /locus_tag="CNF01510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513020.1"
                     /db_xref="GeneID:3258190"
                     /translation="MSSTADYVAKYPRRAALLHVAEKYWLDDARRPPGSLDSSLKKHT
                     TLINKLKSSLLVGPAEALIKDIDGLTLAKYLDEIVAAVVEGAAKKGDPEVAVDVIIHL
                     HSRLTPDFLPQLLQPLLTLLSANAAATGPIGKDGEKDKEKEDRERLSKQRPVLRIVAE
                     LAMVGAWSEGVVKGAAEVGKVLKGLMTGDPQYSNLPLITTFLKYFGRAYLGNNPVLNK
                     AANGVKEEEAAETLPESVTELVPPEIQKQMWQLFVNYFNTASKTLVKGQLKLLEQDKR
                     NHEAYIKSGEIFEDRQQAYEKMTRAVERLTTGVQTLADLLNLTPPTLPTAASLSKSGL
                     QIVESTSSFTVRDDGPIAGGIWDDEEEQKFYEDLIDLKEVVPASLLGIREKSKEEDQE
                     GGGSRDNKREEEEKEEEAHKAEEEALRKQLEQMELADSHAQPEPEPESELEPQLHTLE
                     RTASSSSLLSITHDEAQAAEGEDEQTAPVTMTTAIEEDGLQSGPAARLSALFAALPES
                     NNREVVDKLAVEFAFLNSKAARKRLIKFIGEVPKQRTDLLPHYSRLIATLNPYMPDVG
                     AGILDILDEELRYLQRKKLVRELDSTRLKNVRFYGELAKFKVAKPFNILHVLKVFLDD
                     FKFNIENISNLLETCGRFLLRYEGTAEVAKRMVELMRKKQANMHLDQRHQLMLENAFY
                     MCNPPERIVREVVQLTPMQSFIRHLLDEVLMKRTHDKVLKLLRKLHWEDPEVYGFILS
                     AFTNVWEVKFGNIPQLADLVFDLQRWHPEFGIAVVDQVLENIRIDMEENIFKFNQRRI
                     ATMKYVGELYMYRVISASVIFEILWSLLSFGHVEPMPFPGRESPIDAVDDFFRVRLAC
                     TLLDTCGVCFPKGSQGRKLEQYLIMLQLYITCKTELPMDVDFMLTDTLDLLRPKMPKL
                     RTFAQAAAAVDELMATVGDMGGEDSASEDEEERQSPEDKPDEPEPVVENVQSAEDDDE
                     DVVLIRDTSKNDELDAEERAAFDREFAKVLADTTDTRREQRKAAPPIFDTAVPIVKKK
                     IEEPKAKTGNGIGEEEGRMQFMLMSKKAGKQQLRTLAIPVDSTIALNTRTQQAQSKAE
                     QEQLKRLVLQNERRLERSEMEGIETRGVKLRFAHS"
     gene            complement(448984..451210)
                     /locus_tag="CNF01515"
                     /db_xref="GeneID:36392894"
     mRNA            complement(join(448984..449345,449401..449655,
                     449725..449813,449881..450097,450160..450297,
                     450356..450499,450560..451127,451192..451210))
                     /locus_tag="CNF01515"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658562.1"
                     /db_xref="GeneID:36392894"
     CDS             complement(join(449073..449345,449401..449655,
                     449725..449813,449881..450097,450160..450297,
                     450356..450499,450560..450697))
                     /locus_tag="CNF01515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514490.1"
                     /db_xref="GeneID:36392894"
                     /translation="MQQTAAPGRNEETEAESLPEREVPQEPSSTKDLPPLFDKIRKIS
                     VKISNSPNGKSFFFDCCRHEGVYPYAPVTYCKTRWGSWFKVLQWLLNVRPGYTRFCTL
                     ADNEPLVPKVSRNSKPYRWYLLSPEQWRMIEALCKILQPALTIQTQFGAETNPTLWMV
                     LPRLVELHKAWRQMKNEPDIPLMLHSSIDEGLQCIEEYYVEALEARTPIIAVYLNPLM
                     KNLWFQFFLGEDLASKASGIFRQIFDEYAAALKAARTEESIDYSFRQPSSTAEQQFYS
                     LLAKHRASIMNGNVSEEFDRYMAYSEEDPQLIKMTMTPHLIDAEFVLDWWKRMAASFP
                     IIAIIARDYLAIPASSVPCKRLFSRAKLADTDRRRSMKAETFSLVQTLGASLRAERAR
                     KTKLKAKGEKRKMIPDVGLDKGKGS"
     gene            451477..453345
                     /locus_tag="CNF01520"
                     /db_xref="GeneID:3258034"
     mRNA            join(451477..452284,452338..453345)
                     /locus_tag="CNF01520"
                     /product="UDP-N-acetylglucosamine diphosphorylase,
                     putative"
                     /transcript_id="XM_571302.1"
                     /db_xref="GeneID:3258034"
     CDS             join(451564..452284,452338..453221)
                     /locus_tag="CNF01520"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine diphosphorylase,
                     putative"
                     /protein_id="XP_571302.1"
                     /db_xref="GeneID:3258034"
                     /translation="MTVQPAPDPALLAHLRDLYAAANQAHVFAFYDSLSPSDQAALLG
                     QLASIDVHRVNRIYSTAIAAAEALTPSKENSNIFGGGQPNHIGEGANGNLVGNETVQG
                     SLPIKEEAMPLPEEACATVLNNASEEAQWRDAGLKAIADNQVAVLLMAGGQGTRLGSA
                     LPKGLYDIKLPSGQTLFEYQAKRICKLERLAEEKAGKEKGSVTIRWYVMTSGPTRVET
                     EKYFKAKGFFGLREENVIFFEQGVLPALDNDGKLLLSTPSSVSVAPDGNGGLYAALRR
                     PLSPSSSRTVLSDLREHNVQYVHAYCVDNCLVRVADPVFIGCCLSRNASAGAKVVRKT
                     IPTESVGVLAAKGNAFAVVEYSELSKEKAEQRTADGQLAFRAANIANHFYTTAFLESV
                     EEMEKHMAFHIARKKIPTVDLSTGELIKPSEPNGMKLELFVFDVFPFTKSLCVLEVDR
                     AEEFSPLKNAPGSKADCPETSRRDLLAQQKRWLIASGAEVADDVEIEVSPEVSYAGEG
                     LNWIEGKKFTKSGVLNGRNDLEKLTA"
     gene            complement(453316..455004)
                     /locus_tag="CNF01530"
                     /db_xref="GeneID:3258249"
     mRNA            complement(join(453316..453571,453626..453925,
                     454002..454470,454529..454624,454697..455004))
                     /locus_tag="CNF01530"
                     /product="tRNA binding protein, putative"
                     /transcript_id="XM_024657367.1"
                     /db_xref="GeneID:3258249"
     CDS             complement(join(453387..453571,453626..453925,
                     454002..454470,454529..454624,454697..454903))
                     /locus_tag="CNF01530"
                     /codon_start=1
                     /product="tRNA binding protein, putative"
                     /protein_id="XP_024513084.1"
                     /db_xref="GeneID:3258249"
                     /translation="MLTALTNRAYIHTRTISTISTVRKMSSQVQQFISAAVNADPSLA
                     GRNDKDKAAIEKLVGESEGLVKDLSALNEKLTPLTYLYSNYPSTADVGLYAHLHPSMI
                     NAPATQHPTLPALLRYFLHIQSLPSVSSARSELPNAYPTVEIDLSTLPIPERKAPAPK
                     VKKEKKAAAAESAPAAAEGAVASVAGVVSAAAGTIAEAATNAAETVKEAVVGKPEKDG
                     KKKEKKEKKEKPAKAPKPAAEATGPMPSMIDMRVGKILDVKRHPDADSLYVETIDVGE
                     PEPRTVCSGLVKYMSEDEIRGATVVVICNLKPVTMRGVKSFAMLLCASSRDGKEEGGV
                     QFVLPPEGSQPGERIYFEGEKYENATPEPQLNPKKKVFETIQPSFTTLENREAAWIDP
                     ETKSVHRIRTKDGVLKSKSFVGASLS"
     gene            455083..457805
                     /locus_tag="CNF01540"
                     /db_xref="GeneID:3258267"
     mRNA            join(455083..456401,456453..456754,456805..456979,
                     457039..457305,457363..457531,457587..457805)
                     /locus_tag="CNF01540"
                     /product="translation release factor, putative"
                     /transcript_id="XM_571485.2"
                     /db_xref="GeneID:3258267"
     CDS             join(455136..456401,456453..456754,456805..456979,
                     457039..457305,457363..457531,457587..457681)
                     /locus_tag="CNF01540"
                     /codon_start=1
                     /product="translation release factor, putative"
                     /protein_id="XP_571485.1"
                     /db_xref="GeneID:3258267"
                     /translation="MSGQQPPSFNPGAFEFRPGQAPFAPRQQQPFDPYGQQQGGYPQY
                     GQYGQQQGYPQYGQYGGYPQQQGYPVPGAPGAGPRAYQPPQARNVQGFQPPSFSSSPA
                     PPPDTKAPAGKPVSLSIGGGGAPKAAPSLSIGGGGAPKAAPSLSIGGAPKAAPSLSIG
                     GAPKAAPSLSIGGAKAAPSLSIGGKKEEKKEEKEASSKSSPKPAAPTPKPADAPAAKS
                     EAASAPVSAAEKKAEKAVPLTSDAQGKVVAAETSAASPAKSGASTPVATVSTSTTNFS
                     KVSAKNDAEAIYREQNLAGDAALRDLYGENVKDTNIKSHLNIIFTGHVDAGKSTMGGQ
                     LLYLTGAVDKRTMEKYEQEAKAAGRETWYLSWALDSGKEERAKGKTVEVGRAYFESEK
                     RRYTILDAPGHKTYVPSMISGAAQADVALLVLSARKGEFETGFEREGQTREHAMLIKN
                     NGINKLIVVVNKMDDTTVQWDKGRYDEITTKITPFLKAVGFNPKTDITFIPVSAQIGE
                     NMKDRVDKKIAPWWDGPSLLEHLDNMEIMDRNINAPFMLPISEKYNELGTMVMGKIES
                     GHVKKGDTLLMMPNKHTVEVTGIFSEQSEDMDMAFCGDNIRMRISGVSDRDITPGFVL
                     TSVQKPVKAVTAFKADISFIDTKNIICPGYSCVLHVHTLAEEVSVTSFLHYYEKKTRR
                     KSKKPPQFAKAGMLVSALIETSAPICIERFEDYKMLGRFTLRDEGKTVAIGKVTKLIE
                     RSEDMPDVAALSLKAAS"
     gene            457943..460945
                     /locus_tag="CNF01550"
                     /db_xref="GeneID:3258284"
     mRNA            join(457943..458127,458193..458214,458269..458519,
                     458587..458819,458867..459756,459802..460655,
                     460710..460945)
                     /locus_tag="CNF01550"
                     /product="ATP dependent DNA helicase, putative"
                     /transcript_id="XM_571487.2"
                     /db_xref="GeneID:3258284"
     CDS             join(458077..458127,458193..458214,458269..458519,
                     458587..458819,458867..459756,459802..460655,
                     460710..460775)
                     /locus_tag="CNF01550"
                     /codon_start=1
                     /product="ATP dependent DNA helicase, putative"
                     /protein_id="XP_571487.1"
                     /db_xref="GeneID:3258284"
                     /translation="MATNDAGASVMPVANVQINYEEESAKIEDFLARYVAGPRPRRDQ
                     SALPADDDSAAEDASEDEDDLADGMGGLNVRGAGRTKFKYLRMLREVANRRREDIVID
                     LKDLKRHSNDLSLLHNIQNNTRRYIQLFSDVIDKIMPPPDNEVDYTDDVLDLIMQQRR
                     EMNAQVEAGERNADAGMFPPELMRRYNVYFRPLRSDDVLAVRAVRGAHLGKLITVRGI
                     VTRVSEVKPLLIVNAYTCDSCGNEIFQEITQKHFAPLTVCPSDVCVRNQTNGQLHMQT
                     RASRFRPFQEVKIQEMADQVPVGHIPRSMTIHLYGALTRSVNPGDVVHIGGIFIPTPY
                     TGMRALRAGLLQDTFLEAMHVHQLKKQYHAMESTPEIQEAIADLKSDPALYARLANSI
                     APEIYGHEDVKKALLLLLVGGVTNSRKDGMKIRGDINVCLMGDPGVAKSQLLKYITKV
                     APRGVYTTGRGSSGVGLTAAVMRDPVTDEMVLEGGALVLADNGICCIDEFDKMEESDR
                     TAIHEVMEQQTISISKAGITTTLNARTSILAAANPLYGRYNPKISPVENINLPAALLS
                     RFDVLFLILDSPTREDDERLAQHVCFVHMHNTHPELDFEPVEPTLMRHYIAECRKIEP
                     RVPQALSEYIVSSYVQMRKQQQEDEAEEKSHSYVSARTLLAVLRLSQALARLRHDDIV
                     QQGDVDEALRLMDVSKASLYEHSQQRNGEDQTSTSKIFRIIKDMAQRAADEDDDEEMG
                     ELAMMDVRNRVIAKGFTEMQLMETILEYENMDVLMRTANGSRLQFVTV"
     gene            complement(460904..462682)
                     /locus_tag="CNF01560"
                     /db_xref="GeneID:3258238"
     mRNA            complement(join(460904..461301,461355..461536,
                     461589..461744,461794..461963,462027..462454,
                     462505..462682))
                     /locus_tag="CNF01560"
                     /product="transparent testa glabra 1 protein (ttg1
                     protein), putative"
                     /transcript_id="XM_571510.2"
                     /db_xref="GeneID:3258238"
     CDS             complement(join(461018..461301,461355..461536,
                     461589..461744,461794..461963,462027..462454,
                     462505..462541))
                     /locus_tag="CNF01560"
                     /codon_start=1
                     /product="transparent testa glabra 1 protein (ttg1
                     protein), putative"
                     /protein_id="XP_571510.1"
                     /db_xref="GeneID:3258238"
                     /translation="MSPYRLIEYDVGQPLYGVGFSNSVSHPHRVALTSLVTGPTNKLY
                     IADLSHPPDTQPSSPYYPQANNGSSGPSHPPPAYRQLTSTNINLPATKVGWEPEGSVR
                     VDQGGRGELVATTGESLHLWEVAKGWTEGSGHVGHNGWGNERYTLKSRSILSNTKGAH
                     GSLPPVTSFSWNNKSPNKIVTCSIDTTATLWDINTAQAMTQLIAHDRAVYDLCWLPDS
                     SDIFVSVGADGSLRAFDLRQLEHSTILYESSRDAPLARIAFSKKEQHMLACFGLDDSK
                     ILILDMRSPGKPVAELIGHQAPLGAIAWGSGGTRGRRESTGGGWLASCGDDSQLLLYD
                     LTAPLPTSRSSSRSNFRNSNATSPYVLSPSATPSSQRTPSPADAVEMMPAKGWTARGE
                     INNLAFTNDGDWVGCVTGTTLKVLHV"
     gene            complement(462857..464296)
                     /locus_tag="CNF01570"
                     /db_xref="GeneID:3258448"
     mRNA            complement(join(462857..463154,463211..463339,
                     463385..463556,463607..463863,463917..464296))
                     /locus_tag="CNF01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_571508.2"
                     /db_xref="GeneID:3258448"
     CDS             complement(join(462931..463154,463211..463339,
                     463385..463556,463607..463863,463917..464259))
                     /locus_tag="CNF01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571508.1"
                     /db_xref="GeneID:3258448"
                     /translation="MPRFPLWLLPLTIPILYLLKSRPLPSRETVIPPDEERVLLLGAS
                     SGVGKDLALAYARRGAKVCLVARRAKVLEEVKKQCEEEAAKAGKKAELLVFSGDMTKV
                     ADLVSAREMIVKAWSGVDTVHILAGLPSTSLLMDLAGVSLDRSSPSTASPSGAPLAFS
                     SKDESTSSGPTLEGLERVEKEARAVAEVNYLGTVLALSCFLPLLASSSRSPALHHLSS
                     VAATVPAPHRVIYAATKSAGLMAVESCRVECEGCGVRFFSLCPGTIDNEFRLKTAVSQ
                     TGGRDETKLPIKHAWEGLLLQQEAVTKTILHHLSLSPKPQPLIPYPPFNFFRALDAPP
                     KHLVHMPLMYRFAMFVRDTPLGWGYIEPAARRKYGLIGRA"
     gene            464399..466122
                     /locus_tag="CNF01580"
                     /db_xref="GeneID:3258327"
     mRNA            join(464399..464761,464811..464921,464975..465110,
                     465160..465167,465218..465282,465344..465486,
                     465537..465616,465667..465992,466041..466122)
                     /locus_tag="CNF01580"
                     /product="enzyme regulator, putative"
                     /transcript_id="XM_024657368.1"
                     /db_xref="GeneID:3258327"
     CDS             join(464451..464761,464811..464921,464975..465110,
                     465160..465167,465218..465282,465344..465486,
                     465537..465616,465667..465973)
                     /locus_tag="CNF01580"
                     /codon_start=1
                     /product="enzyme regulator, putative"
                     /protein_id="XP_024513077.1"
                     /db_xref="GeneID:3258327"
                     /translation="MPYSIPLLRPNPADPVPFYRLPHLIHTYSHLPTRAISHDDASMA
                     YYSPAPIGCNLTEGFERRIEREDEEEHLDGLVESLEWLITRGRKGERKGGIITWRGML
                     TRLITMPYETRDPWEMTAIALDGSVYLELWDPPEEKAKRKREQSAWEKQGYMGYAYES
                     FSTIPQEGRPGNGPEGWGGDVNTNVQWANVVRSAIGEIPLCIAGEVDCVKAEPGSPNP
                     GLSGCMELKTNKVIQHPGHEAMFHKKLLKHWAQSWLLGIPEVVVGFRDDDGILRSQTT
                     FDTAKIPYLVEVLNKPSWSPNRCLQSLHSVCSFLTKNVLPTDPLVTYPHIRGNRQAVK
                     EAGELPPAVVWRLAFDPKKGCELHAVGEVGVVDGRWGGMLKEEYVRWRMGLE"
     gene            467464..469492
                     /locus_tag="CNF01590"
                     /db_xref="GeneID:3258246"
     mRNA            join(467464..467724,467786..467829,467876..467877,
                     467924..468495,468550..468561,468609..468730,
                     468782..468896,468948..469182,469239..469492)
                     /locus_tag="CNF01590"
                     /product="aromatic-amino-acid transaminase, putative"
                     /transcript_id="XM_024657369.1"
                     /db_xref="GeneID:3258246"
     CDS             join(467589..467724,467786..467829,467876..467877,
                     467924..468495,468550..468561,468609..468730,
                     468782..468896,468948..469182,469239..469377)
                     /locus_tag="CNF01590"
                     /codon_start=1
                     /product="aromatic-amino-acid transaminase, putative"
                     /protein_id="XP_024513078.1"
                     /db_xref="GeneID:3258246"
                     /translation="MTAATISTETVTQVQAPGTKANGTSGKYNPRNYLSDRAKVTEID
                     GIRGLMACEGPGIVSFLAGRPNPDTFPFNSITLNLKPPLGLPESSNNMPVSITIEDPD
                     LAIALQYAPSSGIPKLREWLADLQAHVHERPRGDYDISIGSGSQDLMFKGFQAVLNPG
                     DPVLLETPMYPGVLPVLRVLKAESVEVDVDDQGLSAENLEKVLGEWPADKKRPRVLYT
                     SPIGSNPSGCSAPKERKLEVLKVCKKYGVLIFEDDPYYYLAEKLIPSYFALEKQVYPE
                     GGHVVRFDSFSKLLSAGMRLGFATGPKEILHAIDVSTAGANLHTSAVSQGVALRLMQY
                     WGIEGFLAHGRAVAKLYAERRAQFEATAHKYLDGLASWVSPVAGMFLWIDLRPAGIED
                     SYELIRHEALAKGVLGVPGMAFYPTGRKSSHVRVSFSIVDLGEESDLGFQRLAEAIKD
                     KRKALGLA"
     gene            469617..471600
                     /locus_tag="CNF01600"
                     /db_xref="GeneID:3258108"
     mRNA            join(469617..470051,470100..470263,470328..470410,
                     470465..471078,471132..471260,471323..471600)
                     /locus_tag="CNF01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_571304.2"
                     /db_xref="GeneID:3258108"
     CDS             join(469663..470051,470100..470263,470328..470410,
                     470465..471078,471132..471260,471323..471467)
                     /locus_tag="CNF01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571304.1"
                     /db_xref="GeneID:3258108"
                     /translation="MEINPKPTQSSSGEGIINGGGNITSDQGVGGQRRDVTGGVGPSG
                     AVIGVDNSRTSTPGAGPSTTPLPSKAGTPGATPQTPATAREVEDQAAADSSTGPSWEV
                     QLAGRKRKWGMMGFTKEEQDIMEQDSLSLQLALAMDQEATLYPPPPTAFSSYEDAVQR
                     LLPYHVWQVYDEELDTWEKADVAKETKEAEDILDKIKGLKERFAKARRREDDRLSPLP
                     STISFFQSSTTNEREELTSLQTKLRTARAELSAIEQEQKKIAEEKRKERMEEEGRKAV
                     AAMAMQQAARQQLVAQAQAQNSNQASSRAATPSSQLSGPSPVGTPTRIGSPPKRGRGR
                     PPAMSKISGPPPGSFPARAGPSGTPTTSGVNTPVVPGTPQSGAAGGIGAGRPPGQMVN
                     GSGTSTPVRPPNPPPQGPVSITVNLSLIPQLVAIGLIAVPPNTAPGAPKPPGIIIKSL
                     DDKKSVVVQINLAMCSKPQLLGLAKVLNVNTVKSATPSAPSTPGGSGSGSGAGPSVK"
     gene            471738..478420
                     /locus_tag="CNF01610"
                     /db_xref="GeneID:3258347"
     mRNA            join(471738..471918,471974..472285,472336..472459,
                     472507..474300,474350..476230,476278..476432,
                     476487..476571,476622..477095,477147..477288,
                     477340..477432,477487..477521,477583..477638,
                     477694..478420)
                     /locus_tag="CNF01610"
                     /product="chitin synthase-related"
                     /transcript_id="XM_024657370.1"
                     /db_xref="GeneID:3258347"
     CDS             join(471869..471918,471974..472285,472336..472459,
                     472507..474300,474350..476230,476278..476432,
                     476487..476571,476622..477095,477147..477288,
                     477340..477432,477487..477521,477583..477638,
                     477694..478285)
                     /locus_tag="CNF01610"
                     /codon_start=1
                     /product="chitin synthase-related"
                     /protein_id="XP_024513079.1"
                     /db_xref="GeneID:3258347"
                     /translation="MAQQPPPSRFQGVTDLSSLAVTEDTVLVTLQERYLAHKPYTSLS
                     PAALVFLSPYSYLPIDGEESLLRYVEEYYQCNNEEGGSRNEQGWWKKKLEEPHVFQLA
                     LGAYYNMRRTGQDQVIIASGPTGSGKSELKRLAIEAITQVSLANPGKKGSKIGLQVSS
                     AEFILKCFGNAHTLSNDEASRFGTYTELQFNERGRLEGLKTIVYYFERSRVSQVPING
                     ERNFHAFYYLVSGAPEEERNFLKLGDVSDYRYLNCRVRRVGVDDRHRYSQLRQAFKMI
                     GISSRLIAQIFQLLASILHIGNLRFSPSDGIQEGASVINIDTLDTVAEFLGVHSESLA
                     EIFSLKTILVRKEVCTTFLGPEQAEQVRDELARTLYSLLFSWLNEHINTRLCKDSFGS
                     FIALVDLPGIQRNSGSMGSLNSVDQFCLNFAAEKMHNWVLHRIHETTRQEAEAERLLI
                     SRVPYFDNSECLGMLSNPRGGLISVIDDLSQKKRSESNLLESLGKRFHNHPSMSISPQ
                     GNRSSASFTINHYDGPVTYSTSNFLERNANETSTDIIQLLRGDTTSRSQVSTTEGHGS
                     SNPFIKGLFGMKNIAMQTHPRSDSTIVAAQQSVRPVRAPSTRRKKMMSLVPVSEEGGE
                     EASDFQVGGGNDESSPKELHCIAGQHWAAVDSLLKSFDQTQTWYIFALRPNDSQLPFQ
                     FDLRSMKQQVRSFGLVEMAQQLQTSWEVRLPHKEACERYNEELVYRGIPEGTGDVERL
                     RDLKRLMSLNDADMGIGLQRVFLSNNLFHFLEDRLRAKEPGEQHAYEDLGHRKLQTDP
                     FSPHRYQPATFDSQEHVYRDPSIRPVDSSSNLPLMEHARPIVNNSLEIDDHESSPVPY
                     ISYGGRSITDIEGYASSRDLLASSIHKSEKDPLDTEPQAGETTEVYRESIARRRWVWL
                     CSILTWWIPGFVLSKIAGMKRQDIRQAWREKLAINMIIWFICGCAIFVIAILGPIICP
                     TQHVYSASELASHSYTLDPNNAFVAIRGEVFDLSQFAPTHLTAVSVVPTKSIMQYGGL
                     DASELFPVQVSALCGGVSGSISQYVTLDSTNTTDVYSQYHDFRAYTNDSRPDWYAEMM
                     IMMRHRFRVGFMGYTKKDLKTMAAQGKAVAIYDNLVYDMSNYIRQNGGGLRAPDGVNL
                     TAQDQADRQFMSDQVVSLFKYNSGKDITTLLDNLGSTIGTDVVDRQKTCLRNLFILGK
                     LDTRDSAQCQFSTYILLALSCVMVAVIGFKFLSALHFGSVRAPESHDKFVICQVPCYT
                     EGEESLRRTIDSLCKLRYDDKRKLILVICDGNIKGFGNDKPTPAIVLDILGVDVNNDP
                     EPLSFQSLGEGAKQHNMGKVYAGLYECAGHVVPYLVIAKVGKPNERQKPGNRGKRDSQ
                     MLVMHFLNKVHFSAPMNPLELEMYHQIKNVIGVNPSFYEYLFMVDADTTVDEMSLNRL
                     VSAMRHDKKIIGVCGETSIANAKQSIVTMSQVYEYFISHHLSKAFESLFGSITCLPGC
                     FSMYRLRSPDTNKPLFISHGIIQDYSENRVDTLHLKNLLHLGEDRYLTTLVLKHFQDY
                     KTKFVRHAYAKTVAPDSIKVLLSQRRRWINSTVHNLAELVFLDQLCGFCCFSMRFVVF
                     IDLLSTIIAPVTVAYIVYLIYLIVHDGSSIPTLSIVMLAAIYGLQAMIFIFRMRWDMI
                     AWMIFYICAIPVFSFLLPLYSFWKMDDFSWGSTRLVVGDKGKKIVIHDEGKFDPSSIP
                     LRSWEEYENELWDQESVHSGSYMPPKAEYSYDYPRAQSTYSYGGHGYEQPVHPVQTRS
                     TSPVSSRYQMSQFRQSPYQSPYQGPYGGSAVDFRPSRMDMAHQPSLDDTSSFHQPYQP
                     PPRPQSSYAFNLPDPSSDSFTAPAVDYLGAQAITDSQLERSIRKICANAELDKLTKKG
                     VRKELEREYGVELTERRETINRLVEKVLTE"
     STS             477077..478470
                     /standard_name="Grik1"
                     /db_xref="UniSTS:546807"
     gene            478702..480696
                     /locus_tag="CNF01620"
                     /db_xref="GeneID:3258477"
     mRNA            join(478702..478926,479106..479161,479234..479342,
                     479403..479491,479541..479566,479619..479649,
                     479700..479768,479816..479989,480049..480696)
                     /locus_tag="CNF01620"
                     /product="nucleotide-sugar transporter, putative"
                     /transcript_id="XM_571496.2"
                     /db_xref="GeneID:3258477"
     CDS             join(478743..478926,479106..479161,479234..479342,
                     479403..479491,479541..479566,479619..479649,
                     479700..479768,479816..479989,480049..480504)
                     /locus_tag="CNF01620"
                     /codon_start=1
                     /product="nucleotide-sugar transporter, putative"
                     /protein_id="XP_571496.1"
                     /db_xref="GeneID:3258477"
                     /translation="MSKPFVPTPNISRPATPSSLDYGKDEASSTLLRDMGERGDRERK
                     DREERDKKEAMPSGQDQVLPILSYCAASIMMTVVNKYVVSGANFTMTFLLLAIQSSVC
                     VLAVTTVKKLGFISFRDFDKNDAKAWWPISTLLVAVIYTGSKALQFLSIPVYTIFKNL
                     TIILIAYGEVFMFNGAVSGLTLCSFALMVGSSIIAAWSDITSVWNKEPELDPITGLEI
                     TVGPVSTIGGLNAGYIWMALNCFVSAAYVLFMRKRIKVTGFKDWDSMYYNNLLSIPIL
                     VVFSLVIEDWGSESLALNFPASNRVLLLSAMAFSGAAAVFISYSTAWCVRITGSTTYS
                     MVGALNKLPVAASGILFFGDPANFGNISAIAVGGVAGVVYAVAKTNQAKVEKARQARA
                     AGGRP"
     gene            480770..482486
                     /locus_tag="CNF01630"
                     /db_xref="GeneID:3258242"
     mRNA            join(480770..481134,481209..481672,481730..481932,
                     481992..482486)
                     /locus_tag="CNF01630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571498.2"
                     /db_xref="GeneID:3258242"
     CDS             join(480837..481134,481209..481672,481730..481932,
                     481992..482433)
                     /locus_tag="CNF01630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571498.1"
                     /db_xref="GeneID:3258242"
                     /translation="MPAPPPIAYATLSAPLSAAPYILGITPSPTTPHLVLRHPSQSLT
                     IADNQTLQPVAALQDGHAGHISSVSCDGGELWSAAVDGSIVRWDERSRQKATAIKAFI
                     RKPLPVTALTTSANDSLVIGGTELVSSEAHILFWDSRNSSAPLYTHSSTHSDDITHLS
                     LLRSSSTFLPPSHNPEIKTPSTLLLSASTDGLVALSDMKESDEEEALVAEENWGQSIA
                     DAGGYMHKGKMSVWARSDMDEMCLWGAGRGNIGEIELQDHKQYPSSEFKFKTFTPPKT
                     GPSITQTALDEFKSKTTYKSDYLINVIPSLGVSSDGAPMTAVGTNEGDMILQHHSAST
                     SSYKPSAFFLSGPGANRGHKDVVRAIYHDLANEALYTGSEDGVLAGFSLASLPERLTV
                     GDPEVDDDGGDGREEDEYMDEESEIETESSEESDDDEDEDMEEEGPRYGPIIGAGSTG
                     RPGADKKEERRKKRYGPY"
     gene            complement(482466..486437)
                     /locus_tag="CNF01640"
                     /db_xref="GeneID:3258069"
     mRNA            complement(join(482466..482677,482727..482757,
                     482816..482882,482933..482961,483020..483052,
                     483100..483205,483282..483340,483390..483443,
                     483505..483512,483570..483686,483754..483825,
                     483882..484063,484113..484240,484298..484334,
                     484385..484432,484493..484584,484636..484696,
                     484754..484911,484965..485042,485090..485166,
                     485222..485314,485376..486437))
                     /locus_tag="CNF01640"
                     /product="glucosidase, putative"
                     /transcript_id="XM_024657371.1"
                     /db_xref="GeneID:3258069"
     CDS             complement(join(482615..482677,482727..482757,
                     482816..482882,482933..482961,483020..483052,
                     483100..483205,483282..483340,483390..483443,
                     483505..483512,483570..483686,483754..483825,
                     483882..484063,484113..484240,484298..484334,
                     484385..484432,484493..484584,484636..484696,
                     484754..484911,484965..485042,485090..485166,
                     485222..485314,485376..486422))
                     /locus_tag="CNF01640"
                     /codon_start=1
                     /product="glucosidase, putative"
                     /protein_id="XP_024513082.1"
                     /db_xref="GeneID:3258069"
                     /translation="MTSSNEASCPRSRQNSTTSLNNPAGSPSSRKTSHSRNDSEVIAA
                     SGVRHPSANHRPNASLSGSPGHLRPRSSRTASPVSTLSRRKSSPNLSVPPSGRNMFGG
                     DGSHTSGAERIIKGTSKWLRDKMGSGGEKNDHWLVLDLPSPSMLSDAGSMAIPVYDTR
                     GYPSREGSLDRPPAEADAGTRQQGPALTSGPEINVCLSQSTKNKPSPLGYTHNASLTP
                     LAAQFPARSASPLNASLPSLADFYPDTVVFGNRTFGSDPRPALSVFGSSGSSIMTIRS
                     ISSLRSGFGTDTDSAARFRLDSDAGSDEGLIDRAAMLKRHAAKSAYGMKNILPKSRLV
                     NELEGNEEKRGLYDLLPFHIDPSQWEGANPEDDDELHRPESQDELDTQYFSSRGLANL
                     GCLAIMGLAVVILFAGLPIFEYYITLPADTHGGFNIGGINSTGQVPDVANIFQLIDPD
                     TPPEAYTHKSLDTGEEWDLVFSDEFNEDGRTFYNGDDPFWEAADLHYWQTNNLEWYDP
                     SRLTTKNGKLVITLDEIFSHGMNFEGGMMSSWNRFCFTGGYMEVSVSLPGTNDIPGLW
                     PAVWAMGNLGRAGYGGSLDGTWPYTYDSCDVGTLPNQTLNGKPTVALTQGDPGHNNEL
                     SYLPGQRLSRCTCPDDDTHPGPKHSDGSFVGRSAPEIDIFEATLDMSIGKGQVSQSGQ
                     WAPFNPNYHFINSSSKYYEIYDNDVTQINTYMGSVYQQATSGLSLTNQECYTDETGCF
                     AVYGMEYAPGADGYITWVNDNKKAWTVRGAAMGPNKEAGVDQRLVTEEPMYMVLNLGI
                     SENFGAVHFVGLQKLWPVQMEVDYVRVYQDPKKKNIGCDPADRPTASYISRFPEAYSN
                     ANITTFDQVPNKKRPKNSLVDQC"
     gene            487716..488600
                     /locus_tag="CNF01650"
                     /db_xref="GeneID:3258245"
     mRNA            join(487716..487810,487868..487970,488023..488397,
                     488453..488600)
                     /locus_tag="CNF01650"
                     /product="40s ribosomal protein s10, putative"
                     /transcript_id="XM_571499.2"
                     /db_xref="GeneID:3258245"
     CDS             join(487941..487970,488023..488397,488453..488491)
                     /locus_tag="CNF01650"
                     /codon_start=1
                     /product="40s ribosomal protein s10, putative"
                     /protein_id="XP_571499.1"
                     /db_xref="GeneID:3258245"
                     /translation="MIISKQNRRAIYEYLFKEGVLVAPKDFNRPSHPDLPTVRNLEVI
                     KAMQSLNSKGYVKTQFSWQWYYYTLTEEGLAYLREFLHLPSEIVPQTHMKPVARQTGR
                     PSGQREGAYRAPRGDREYRRRDDGEKEGGEYRPRFGGVARGAPAS"
     gene            489634..491659
                     /locus_tag="CNF01660"
                     /db_xref="GeneID:3258453"
     mRNA            join(489634..489709,489763..490368,490420..490473,
                     490526..491659)
                     /locus_tag="CNF01660"
                     /product="expressed protein"
                     /transcript_id="XM_024657372.1"
                     /db_xref="GeneID:3258453"
     CDS             join(489824..490368,490420..490473,490526..491612)
                     /locus_tag="CNF01660"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513080.1"
                     /db_xref="GeneID:3258453"
                     /translation="MSSLLSLPLLFPLGLSAFTVHLLVSTLGPRPKSQRDALPSYLVP
                     SIATHGRLLPASSRNAFSYPCLHLAVDIDSLASGCLDLPFRVFKYGGSPFGKILGLRA
                     ERYLTKGSETYREKLEKLLGKHGIAKERMGKVWLTTMPSLLGYEGDNPLTTWYIYENV
                     TEGKEGKLLAIVLEVHSAFDESHSYTLTPDSPLRHEPAKGYDFGFTIPRSFHVSPFNS
                     RDGYYRVDIINPFPVGHTKIPGFVPSFKIFLRVLSTDKKIKFMASSISGPSAPLRLER
                     GMKSVADVLWALTKWPGTLFLVRARTNWQAYVLHYRKNLALYPRPEPINSFSAGLFNQ
                     TEKDEHGVGVPLQRAPITSTEKRAQEVVCKWAARRAEEVRVRLEIEFEDDRDKVQLGP
                     QGKETLSIKTADSDFFNDLLITPSPQHFLILAHERYTAISNPSLFEEFFSAPIASQAD
                     WVSSCTNAIRRRYFVHLYSYSHLPPPPSIPPITGEFSHFSDSTFLSFRDRLKVLRAVF
                     WTWYGHNGLEWIFGFLRGAFVPGQEGWTVWDRAMRRSWGEDVDAGEVLGTVRL"
     gene            491779..495314
                     /locus_tag="CNF01670"
                     /db_xref="GeneID:3258070"
     mRNA            join(491779..491907,491997..492125,492184..492231,
                     492282..492305,492350..493091,493140..493258,
                     493308..493495,493539..495314)
                     /locus_tag="CNF01670"
                     /product="potassium:hydrogen antiporter, putative"
                     /transcript_id="XM_571501.2"
                     /db_xref="GeneID:3258070"
     CDS             join(492051..492125,492184..492231,492282..492305,
                     492350..493091,493140..493258,493308..493495,
                     493539..495198)
                     /locus_tag="CNF01670"
                     /codon_start=1
                     /product="potassium:hydrogen antiporter, putative"
                     /protein_id="XP_571501.1"
                     /db_xref="GeneID:3258070"
                     /translation="MAAFLTTISGAPTHFARLLSTRAVSSNVISGADPTEVDPSNPIT
                     LFIIQLVIIIVFTQSLGWAFSYMKQPKVIAEIIGGVILGPTVFGRVPHFTEHIFPAAS
                     LSYLNLISTIGLVLFLFLVGVEVDVGVMKKHGKASGIISAAGMILPFGLGAAIAVPVY
                     HNFVDTENVSFGHFLLFVGVAMAITAFPVLCRILTSTKLIDTRVGVMVLAAGVGNDVV
                     GWVLLALTLALVNSQSGATAVYVLLCAVGWAVILLWPTRKLFVYLVKRTGSLEHGPTP
                     GMMVLTLLIVFVSAFVTDIIGVHPIFGGFIAGLIIPHEGGFAIAVVEKIDDLVSMLFL
                     PIYFVLSGLQTNLGLLDTGRIWGYVILLCVVAFCGKFFGCAGAALAMKYPMRESIAIG
                     LLMSCKGLVELIVLNVGLSAGIIDQQLFSMFVVEAVVLTFLTTPCTLAVYPERVRVRI
                     SDLRKGDQGVDSEKQVGGSNIAGASGGREHTSRFLVILQKLEHLSAVMLLTQMLEPPV
                     PEAREPWDAAEHSAKEARKGKKSISDDESINSHSNTVTTLHHSHHHSDSKHNILHRVG
                     HVTHPSGDLPRLDALKLVELTGRTFSVMQSAEKDQLLHSDNALQLYRQFGRLRGLEIS
                     PHISIVGQDSFSQAVADYATDLGSELVILPWTVPTQGGNPELIDPSVGSSSSTTVSQF
                     DTIFGSESAGSPMYSHFVRRVFSECPSDVALFVDRGFGGASSFKPGSGQHIFMPFFGG
                     PDDRLALRFVVQLCGHAGVTATVVRVQKEEGDGEDEEVSRGLDGDKSNVALHQAALQS
                     NQLTVGGATQYPETQARLQSDTADSLAWSCFSSPSVSPSRPLHLETALSRISFHSTTS
                     HQPLTYAFTCAESAMRATSAHAKTWRPMLIVAGRGRRGAAISHETELNRVLAAKSLNP
                     SIGAELRKTVGDVAAGMILGGSAPGTASYLIMGAGKR"
     gene            complement(495269..496463)
                     /locus_tag="CNF01680"
                     /db_xref="GeneID:3258181"
     mRNA            complement(join(495269..495568,495619..496087,
                     496141..496463))
                     /locus_tag="CNF01680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571306.2"
                     /db_xref="GeneID:3258181"
     CDS             complement(join(495317..495568,495619..496087,
                     496141..496418))
                     /locus_tag="CNF01680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571306.1"
                     /db_xref="GeneID:3258181"
                     /translation="MSIPLPALSPAETSYIVTSLAHPSYPTRNDARPLFASRPIQISY
                     GVFPQANGSSQVKLGETEVVCGIKLEVIDITGQQIKDQEKWRTKVEVDVTPQAFPSIS
                     APSLSALSTHLTSIVTSHFIPSIPALPILPNKKYFQPHLHLTVLSSSGNIPSALILAA
                     RAAFADLKVPKTKVISWAGESGEDAIDGVDVGRGDMSGIKAAIATTKGKGKGKMIARG
                     SEDWDLDMEDGEGVEFLEGREALPVLVTLNMVPSSPNIFLDATPQEESACPTRIHLFF
                     KPSSAHDISKPKLCGLRLEGPDGLDAGRVRGLLEQGASVASELIKEVNRTIPSLDI"
     gene            496588..498195
                     /locus_tag="CNF01690"
                     /db_xref="GeneID:3258476"
     mRNA            join(496588..496685,496734..496812,496860..497073,
                     497123..497435,497484..497688,497741..498195)
                     /locus_tag="CNF01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657373.1"
                     /db_xref="GeneID:3258476"
     CDS             join(496591..496685,496734..496812,496860..497073,
                     497123..497435,497484..497688,497741..498070)
                     /locus_tag="CNF01690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513136.1"
                     /db_xref="GeneID:3258476"
                     /translation="MTIKQPKPLQIRLPFRVPRPNKTTTDVRVCGICRKNDSKYTCPR
                     CNVAYCSLDCFKNESHAQCSEPFYKTTVLDSISADPKAGLEEKRAMMEMLRRFEETEA
                     EGGNGLEELESEDEEDELITRLQGIDIDSLDSNELFKLLPPKHRDAFIQALQNPDSEE
                     AKVLLESASNELIPQGPDLLPWWESEEALDDGENESGEDKVEPEPGLIPQELLLGIKP
                     PEGVGRKLVYNAISIGIAYIHTLLSFRLPSLSPTHLASQDLETLDIKTCLGELVPFLI
                     DPKSTVRYESIGSAWGAVWESIGSEMSSPPSAQILQQLLSIISSLVHPPITTPSYPKL
                     LLILSDIYHLYTIPPGKLGAAVPRKLAFYVKALEQLERSEWLELENGIRKELDKLEQE
                     ENRENQVDVKKDNEQLKIV"
     gene            complement(498106..499823)
                     /locus_tag="CNF01700"
                     /db_xref="GeneID:3258191"
     mRNA            complement(join(498106..498464,498519..498780,
                     498830..498936,498986..499453,499516..499550,
                     499598..499605,499669..499823))
                     /locus_tag="CNF01700"
                     /product="ferrochelatase, putative"
                     /transcript_id="XM_571533.1"
                     /db_xref="GeneID:3258191"
     CDS             complement(join(498246..498464,498519..498780,
                     498830..498936,498986..499453,499516..499550,
                     499598..499605,499669..499811))
                     /locus_tag="CNF01700"
                     /codon_start=1
                     /product="ferrochelatase, putative"
                     /protein_id="XP_571533.1"
                     /db_xref="GeneID:3258191"
                     /translation="MTAIQRPISVFARPLLPSSSRLRLAPPAIARQRFLATVRDGPAV
                     GSKPPTAVLMMNMGGPSTVPEVHDFLSRLFHDNDLIPLPFQPLLAPLIAKRRTPSIEE
                     QYSAIGGGSPILKWTQVQGAAMCSLLDELNPKSAPHKPYVAFRYAKTLTEDALAEMKQ
                     DGVQRAVAFSQYPQYSSSTTGSSLNELYKQVKQLGWGGNGEVKWSVIDRWPTHPGLVE
                     AFAHNIKAALQTYPEDRRGDVTILFSAHSLPLDIVNRGDPYTAEVAATVWAVMSKLNF
                     SNPWRLTWQSKVGPKAWQGPQTAAAIEGYAKAGTKDICLVPVAFTSDHIETLYELDIE
                     VKEEAEKLGVHLTRASSLNDSPIFIRALADIVSNHLKDYDAGLIGPASKQLLSADPRH
                     VSPRSQETRRWLASGGTKMAA"
     gene            500114..501494
                     /locus_tag="CNF01710"
                     /db_xref="GeneID:3258365"
     mRNA            join(500114..500335,500387..500651,500701..501494)
                     /locus_tag="CNF01710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657374.1"
                     /db_xref="GeneID:3258365"
     CDS             join(500171..500335,500387..500651,500701..501449)
                     /locus_tag="CNF01710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513081.1"
                     /db_xref="GeneID:3258365"
                     /translation="MPAADHTTLFRSILTTQQSSRPESARSKSPAPISRKGKAKEGED
                     EAEFLKEAYRIHTHLRSLQQLLTSVRKAYLSTVEPPPLSRRPKEPRIDVNGTTKEEEQ
                     WARWEKVKYLTDKERDEIDLRARMILRRCQERVGILEMTEQKRKSKAVSSTKPASTLL
                     ALLPSLAPASISAIEPILSAHHASILWTLNDFLARLTGSVSDLQNERVKRREERSRTL
                     GAGATLEAQRLGLASQAAKRSIPEGVVTDVHDPAFSHTFASDPEDPHLNQGLGIIDPS
                     APPIEQVLSQEQIRAFESENDALLEHMSSTLSSVLSAEASLLEISQLQSELVRHLAQQ
                     TEMVEQLYEDAVGSVAEVKRANEQLTKARERGKDGRLFLLIFILGASFSLLFLDWYAA
                     "
     gene            complement(501382..502858)
                     /locus_tag="CNF01720"
                     /db_xref="GeneID:3258173"
     mRNA            complement(join(501382..501913,501965..502146,
                     502196..502335,502388..502530,502579..502589,
                     502645..502858))
                     /locus_tag="CNF01720"
                     /product="expressed protein"
                     /transcript_id="XM_571531.2"
                     /db_xref="GeneID:3258173"
     CDS             complement(join(501490..501913,501965..502146,
                     502196..502335,502388..502530,502579..502589,
                     502645..502782))
                     /locus_tag="CNF01720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571531.1"
                     /db_xref="GeneID:3258173"
                     /translation="MPRLELSPLRQSDPPLQRKFRSIWLRVKDLPYDALHRYHRLGRK
                     GKASIWILTVINLLIVAVVLIITPTRIGQWFNSLALSIKGMGWKGVVLCNIFAILSSH
                     PPLFGFVPTLTLIGFIYGIWPGFLIAGIASMLGAGIAFLSVRSFFLGLFKKNDKWEAF
                     GHVMRAKGLPLVIMIRFCPVPWGVSNGLFASIESVKFWHFMVANLMIQPKLLLVVFIG
                     SRLTSLASDSAAHDPLRFWLNLISIIVSACISIATGVIIYRLTLQQMRKLDQTGAGLG
                     DGELAAEALEENALLGDYDSGSGEDEAEFLTSSNHRDREGNGKGLKVGGGAGIIRRNS
                     SQDTTGDADLV"
     gene            502986..503953
                     /locus_tag="CNF01730"
                     /db_xref="GeneID:3258430"
     mRNA            join(502986..503410,503464..503664,503714..503953)
                     /locus_tag="CNF01730"
                     /product="expressed protein"
                     /transcript_id="XM_571514.2"
                     /db_xref="GeneID:3258430"
     CDS             join(503035..503410,503464..503664,503714..503841)
                     /locus_tag="CNF01730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571514.1"
                     /db_xref="GeneID:3258430"
                     /translation="MAHTTPRSHPPPHSLLQNLTTQSLLLSHLFTLIASPPNPNTSTQ
                     TQLNQVYSALQLSTLDLSGLVKEVGHHQEAYRRLVEKKNEVAGLEMRVRGLVKRLEEG
                     RKELEGMIDQGERSLEDIEKSEREPVPAKTLMAHAQSLSKHSSAPVSSLLAPVDKAQY
                     APWPTEMSMRMGLLFQLEGSMSGMGERGVVGEEQKAPQKVEERREHVEHEESDRRYDP
                     NAVFQLDLNSDESDED"
     gene            complement(503895..505186)
                     /locus_tag="CNF01740"
                     /db_xref="GeneID:3258205"
     mRNA            complement(join(503895..504507,504559..504716,
                     504764..504916,504974..505186))
                     /locus_tag="CNF01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_571308.2"
                     /db_xref="GeneID:3258205"
     CDS             complement(join(503954..504507,504559..504716,
                     504764..504916,504974..505116))
                     /locus_tag="CNF01740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571308.1"
                     /db_xref="GeneID:3258205"
                     /translation="MSRYLPQQGTIPTIIPPQHAESKRDRKRRETVNKIEMLHDESWR
                     TRDEKFGAMYKEYHAENKLVNSQPPTSAKYLLHAYPVSVERDARLEAAEEEYQYKVSQ
                     ARKMYEQERESIEAQYWEARDQIRQRLLGAIEDRRKRLREEKEGGEIITESLLEADVR
                     KPKRRSFFTTSTSTPRSTSPSGTNASSRDKSPSTARVNPADLMHHSQLTPTLALISTD
                     DILSNDSSLHVRPAPAGSTTYVPTQAGKRGGPRGKAAEITGEGKELAAPGTSAALGIA
                     AAQSNNRSRGVGGTRDQTLTLGRSLAELAKMTQAAQLEVDGDWARMQGNQGRGRRARG
                     D"
     gene            505393..511405
                     /locus_tag="CNF01750"
                     /db_xref="GeneID:3258154"
     mRNA            join(505393..505463,505503..506063,506132..506772,
                     506818..506909,506963..509228,509281..511405)
                     /locus_tag="CNF01750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657375.1"
                     /db_xref="GeneID:3258154"
     CDS             join(505420..505463,505503..506063,506132..506772,
                     506818..506909,506963..509228,509281..511229)
                     /locus_tag="CNF01750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513137.1"
                     /db_xref="GeneID:3258154"
                     /translation="MVNEAVPLTNEDFLCPLTTIRDTFLRPHSETVSIPKLRALLAWH
                     KKRISTPWEPFQRASSTFRDTINKSSFILPRTNVTFEVDDTTRKLALRLSDTLDLNEI
                     GAFLATKSYLTYSLDEDMDEDKVVERLLMWVAEEALAAPQIALAVLRISDDETPLGQL
                     AYDVRVEAIGDPEKYIEGLFRAFSGLAQREVDQKKEIDPLFWATHQLRLQETILNLLF
                     VVLYQTPKRPAAISEGLLRGCIMSSFGTSQANRKIWEEDAVSQRIAVRIRDLLLLIAI
                     ESLCLGQIISPLNPLEHDNLSTLIQSKETIASIHDFLADHSKDLSPHYPGVEPGTVPL
                     PLWPMPIICLVWSMILRSLPLALVPPAGEDGVTWQDMAIRALRLPSGLFPWMEAILDG
                     PLMQNDDDAFIGNEELYYRKVFKDVLIGLTELVQLESIADKPGLYRSWELLFGGGSLS
                     SSSLSAADFWIADFPYDERRAVLDRSQFPYQPVNLLRVLAALTGNGETEAFGTDPASQ
                     VYHYFTNLPTITHAFEPAWCQSLGKEEGIEVVETTQTLVLPGGESIPRGSKGVVLSNN
                     DTQQVMWTNQIISGWALMFEILQAAAGLRPVDEKARPNADHPADSIYLSVRDLDIQLP
                     STQILAGGLKFLRNILQSTAYIKATVLSLLNPEDQFSSGQLVLQLALTVLHHSRISDL
                     AMDVGVVTDAVDTIEALITAPSSNVWPALRASGFFDASGKRRGSVAGLIQSESIKGQH
                     TLTVSVLRLVLTLVQNREHVPENDTIILTSALNLVFLDIWNNFSSWRYQDVAKKYELS
                     TLVTTIFDTVLSHPMIPDSNTPTPAAKVLIDLFITSASPLTYRPLIDAVTQSNNLVSR
                     LIVHRRQADAQMVSKCLDEAMSFLSTLLRTAALIGTPANALPKSLFGLPVSIPSGSKI
                     QLVDSLFDLASIPIAMESNILNVLKTLRTYLEVTGGEPHRPSLASMLRSPTKTCNDLM
                     EVVKRTTDLDVQTAVWNLLASVIITQPGCVQSAVGSAKDHELEGALKVAVLEVEGWED
                     KFRNAPHMLAAVLSFVQSAMRSAGADDAIAILRKDKQFWQSVFELSTRIVPAPPSFSL
                     SLHSEDFTDRIRQYAYCVQAKANATSLLAAELAYAVNNDGDEEPETKARELALSLFRN
                     ELALQEAGLMACHSSCVPELHDEQERKVRESGIDLKYLRTSKLACEREYGNGYLYDGN
                     VVIPDSSAKQATATLAVDLLNLNWSMLDADVALTRSFKLLADSIAAWTEGDVLAMRAA
                     LRGAIAVGEIIAEEYREGDVMLAIQVERLSILAVLLETALDPHEGDHRPDSSLVQQLS
                     AFVYNIVSSQVFPPIISLRHPDLPPIHQPVLRILYLVLNNMSNNQSTSATVAAREAVV
                     DAGTVFALESADIVLDSIVRGVQPAFTAVISMIVAVLCEISKLSTMTTAWLDRVQDVN
                     LVGRSLDVLMRAVIVDGQVPLHLSSILLLHLALASNPTSVEKLAVSGILPAYSDNAIV
                     AEAELGRIEAPPSAYNSAHSSWCGMLLVVKALLTTLPDTATFTRTDVVPFLRVTSAQM
                     IRAMSWDGETPLTEPALEEMELVADIFFGVACALGPKSLDDFALPALNLLKGIRFAFS
                     HPRLLSTLLVPSSEEEKGKLEEELALIDDEKDADLFDVKRTPIIAGRTTTLMRIARTV
                     LLTLVVITRAWEALREAIEPEQVEDNVLLTDDETSGGTSSDPVGIVNDIYVLTQNILE
                     RLPSLTPTLGGQYKLTPSADATQAIRDIATQLLESSALVSFTQLLLRHTLLAPEEQDI
                     EQDTSMDLDGDSVSVKRRLSLSQGGSKEGMVLRELAGDLRGMLIGEGGMMGVLRNMTD
                     RVFGVEDA"
     gene            511483..514943
                     /locus_tag="CNF01760"
                     /db_xref="GeneID:3258066"
     mRNA            join(511483..511767,511945..512496,512546..512619,
                     512681..512712,512760..512838,512888..512939,
                     513002..513051,513110..513178,513233..513306,
                     513360..513573,513632..513763,513816..514293,
                     514350..514645,514702..514943)
                     /locus_tag="CNF01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657376.1"
                     /db_xref="GeneID:3258066"
     CDS             join(511570..511767,511945..512496,512546..512619,
                     512681..512712,512760..512838,512888..512939,
                     513002..513051,513110..513178,513233..513306,
                     513360..513573,513632..513763,513816..514293,
                     514350..514645,514702..514795)
                     /locus_tag="CNF01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513085.1"
                     /db_xref="GeneID:3258066"
                     /translation="MPRDTFSSNPFISSPVYHDRSADISSFSYDARRYAPSPSSEALP
                     QELPAGAMPAVADTFSVRNLSSYSQRPSMSTTPRMNSSFSGRDNQLEKDNLFGSSPTH
                     FNSSSRLAYEAGPHSNYMAPEPLGYGRTRTKKPTRTCIPTNPTKRRLLFFGVPILLVV
                     VAAAIIGGVVGSQKRHSASNDSSNGDSSSGTSGGGGSNSTSDTDANTWNSFIQPGSGG
                     DGSIVTTDLGVNFTYSNAFGGTWAQDPYDPYSVSGQAQSWSPSLLEDWVWGEHIVRGV
                     NIGGWLVTEPFIVPSLYEKYQTSTPKAIDEYTLSQAMGDNLATEMEEHYKTFITEEDF
                     ALIAGAGLNYVRIALGYWAVETIDGEPYLAKVSWNYFLKAIDWARKYGLRVLVDFHSL
                     PGSQNGWNHSGKSGSVNWMYGVMGIANAQRSLETLRSIVEYISQDGVKQVVPMIGLVN
                     EVQAETVGGDVLAAFYYQAYEMIREITGYGAGNGPVILLHEGFYGIAAWNGFLAGADR
                     IGLDQHPYLAFPTTQIADNHTVQAHTACGWGGGTNDTSTGYGIVIGGEWSNAINDCGY
                     WLDGVDSTPQFEVTGTGSCAALDEWFNYSDETKQGIMGYTLANMDALQNYFFWTWKIG
                     NSTVKGYPTSPMWHYKLGLEQGWMPKDPRVAGGYCQSIGVGGNQFAGTYPASAIGSFP
                     TEVATPTIDPTQVASHSVWPPTALGPSPSYSAAQITLFPTLTQTGTRNVLATPTHPSN
                     VTLEGGWANAADTTGAWVRVAGCDYPDEYDANTVAVPTAQCTGSGSTDSMRKRSLRR"
     gene            complement(514806..516487)
                     /locus_tag="CNF01770"
                     /db_xref="GeneID:3258425"
     mRNA            complement(join(514806..515802,515861..515985,
                     516025..516487))
                     /locus_tag="CNF01770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657377.1"
                     /db_xref="GeneID:3258425"
     CDS             complement(join(514990..515802,515861..515985,
                     516025..516328))
                     /locus_tag="CNF01770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513140.1"
                     /db_xref="GeneID:3258425"
                     /translation="MNGKNCLSRTKMRQQQTANMSPSFDSSRPIVIIGAGIIGLTTVV
                     CLLESQFYKQHRPPIHIIADHLPNDPFDAKYASTIAGAHHLSFADDGDGRQRKWDMRT
                     FQVMYEQWRQSGEDSGLMALKQTELFVGQNDHLKIYEEHPNFMTLPASELPPAVDHAV
                     SFTSLTITPSVYLNRLLKQISVLSNGQAKIHRFHLPSLSFLSHPSIRALIGQERPAAV
                     MVCVGLGALVLGDVNDSSMYPTRGQVVKVRAPWVRSGYTRQIGSLNGGEGGERTYVIP
                     RANGEIILGGTREEGDWYPYPREATTRDILRRAIEICPNLCPANLVAQPLSGTDRRPS
                     ILASDEQSPSYENPLDSLVIDSLVGFRPSRKGGIRLERGPDLDENTAVIYNYGHGGAG
                     WQSSWGTAEEAVALLCKATGN"
     gene            516646..517747
                     /locus_tag="CNF01780"
                     /db_xref="GeneID:3258067"
     mRNA            join(516646..517228,517287..517747)
                     /locus_tag="CNF01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_571683.2"
                     /db_xref="GeneID:3258067"
     CDS             join(516689..517228,517287..517628)
                     /locus_tag="CNF01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571683.1"
                     /db_xref="GeneID:3258067"
                     /translation="MSLSSSTLSLKFMQRGLARAAASTPQQQRGDSKPSSSAGPSTPT
                     PAATGNSNDRPEEISQALAREEQAKWFIPRQHRSVTASTSQTGDGGVQVKFEASYAPF
                     LPGYEESQDEEDEEEDKDVFETQAGGGRMVFGGFGKAKGKEKAGEEEGEGDDDERMEE
                     DEEVKNKRAKPPTKKKPMTKEQPKTFLRPALSPPPSQPKPTSNHPISKSNTSTAPQIS
                     QKKSAKRPPPESPAKPSTSSDSKKAKVESSTNAPKKSGNTNKSTGAGKTLDERQKMLK
                     AQKKAEKKKAKTQQGAD"
     gene            complement(518250..519198)
                     /locus_tag="CNF01790"
                     /db_xref="GeneID:3258058"
     mRNA            complement(join(518250..518399,518451..518609,
                     518836..518959,519113..519198))
                     /locus_tag="CNF01790"
                     /product="60s ribosomal protein l33-b, putative"
                     /transcript_id="XM_571529.2"
                     /db_xref="GeneID:3258058"
     CDS             complement(join(518376..518399,518451..518609,
                     518836..518959,519113..519123))
                     /locus_tag="CNF01790"
                     /codon_start=1
                     /product="60s ribosomal protein l33-b, putative"
                     /protein_id="XP_571529.2"
                     /db_xref="GeneID:3258058"
                     /translation="MASRLYIKGRILGHKRGKRNSRPNQSLLQIEGVDNKEAAGHYLG
                     KRVAYVYKAKREINGSRVRVIWGRISRSHGNSGAVKSKFRTNLPAKTFGASCRIMLFP
                     SNI"
     gene            520339..522687
                     /locus_tag="CNF01800"
                     /db_xref="GeneID:3258183"
     mRNA            join(520339..520410,520543..520779,520942..521137,
                     521191..521733,521781..521901,521955..522059,
                     522112..522687)
                     /locus_tag="CNF01800"
                     /product="chitin deacetylase, putative"
                     /transcript_id="XM_571516.1"
                     /db_xref="GeneID:3258183"
     CDS             join(520643..520779,520942..521137,521191..521733,
                     521781..521901,521955..522059,522112..522422)
                     /locus_tag="CNF01800"
                     /codon_start=1
                     /product="chitin deacetylase, putative"
                     /protein_id="XP_571516.1"
                     /db_xref="GeneID:3258183"
                     /translation="MSTFATFSALLVSLAGVMAQTTGTSVDSSILTKTADSTGPSGFS
                     IPALSELTSGAPTDSTVALYSTFTAGATPTISGAPVLPTSALTIADYPALDVIPPTNS
                     SLVQDWMAKIDLSKVPSYNVTTGDCSTDAGAISDGRCWWTCGGCTRETDIVECPDKNV
                     WGLSYDDGPSPFTPLLIDYLEEKNIKTTFFVVGSRVLSRPEMLQTEYMSGHEISIHTW
                     SHPALTTLSNEEIVAELGWTMKVIKDTLGVTPNTFRPPYGDIDDRVRAIAAQMGLTPV
                     IWTSYTDGSTTVNFDTNDWHISGGTATGASSYETFEKILTEYAPQLDTGFITLEHDIY
                     QQSVDLAVGYILPQVIANGTYQLKSIINCLGKDTSEAYIETSSNQTTTQITAATGTQS
                     TYFQPIVGTATGAEVSAPSEATGSTAAGSAATTSSGSAASASASATSDSSSSGSGRSA
                     TMGGSLIALAAVAVGMVYVA"
     gene            complement(522874..523685)
                     /locus_tag="CNF01805"
                     /db_xref="GeneID:36392895"
     mRNA            complement(join(522874..523277,523340..523408,
                     523473..523508,523579..523685))
                     /locus_tag="CNF01805"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658563.1"
                     /db_xref="GeneID:36392895"
     CDS             complement(join(522990..523277,523340..523408,
                     523473..523508,523579..523614))
                     /locus_tag="CNF01805"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514491.1"
                     /db_xref="GeneID:36392895"
                     /translation="MVYIKNWTDFEAAATDLYARSPNKVRYCVKFQPKTGHLVLKITD
                     DLKCIKYKTFSSIILNRFDSLNLRLLSSMSNTKARPKTIISTTISASETPEREGTPVL
                     AGASVEAPPLAVAPGGQEGMKQGAQGKSNTSGKKKKKGKR"
     gene            523835..528113
                     /locus_tag="CNF01810"
                     /db_xref="GeneID:3258492"
     mRNA            join(523835..523892,523940..524108,524162..524311,
                     524362..526189,526239..526442,526491..526803,
                     526854..527415,527473..528113)
                     /locus_tag="CNF01810"
                     /product="5'-3' exoribonuclease, putative"
                     /transcript_id="XM_024657378.1"
                     /db_xref="GeneID:3258492"
     CDS             join(523890..523892,523940..524108,524162..524311,
                     524362..526189,526239..526442,526491..526803,
                     526854..527415,527473..527636)
                     /locus_tag="CNF01810"
                     /codon_start=1
                     /product="5'-3' exoribonuclease, putative"
                     /protein_id="XP_024513086.1"
                     /db_xref="GeneID:3258492"
                     /translation="MGVPALFRWLSKKYPKIVERVKEDTPKKIRGPDGEIVEEPIRYE
                     NPNPNGFEVDNLYLDMNGIVHPCTHPEGRPAPETEEEMMVEIFKYTERVVNMCRPRKV
                     LMMAIDGVAPRAKMNQQRSRRFRAAQEAADKEEERREAIKLFEAMGHAVSEETANHKS
                     WDTNAITPGTPFMDLLSISLKYWVSHKLTTDPGWKDLKIILSDSSVPGEGEHKIMDWI
                     RRQRSYPTWDANTSHVIYGLDADLIMLSLATHEPHFRVLREDVFAQSSKGPHACKNCG
                     KVGHIAANCKSDKKFKDPNVAEVAKTEDPKPFIFLDVACLREYLAVELVVPGMPFPFD
                     LELAIDDWIFMIFFVGNDFLPHLPSLEIREGAIDVLLKIWRAELPRMGGYLTNHGKVN
                     LDRAQVILEGLAKSEDEIFQKRKDDEERQEHSQKRRRIEEHKRQDEDKAREEDRNTLT
                     LNGTEYVAVDNPAATARGGPLHPSLPSRPAFDLVPKEDAVKQPEDQDQKAKKAMAGSN
                     SDIVKNRKAIRMANMSAAQALKAELEGGNDVNVDDKKAIAQEGKEEDEAVVTVERTED
                     EEKEQLTKEEARGTLEEQGEKEGVDEEVVPPAIQTDEDEGEAPVGDATVAENDESTTP
                     EDDEDPTHVPRKRKRGDSDGDEDSNEEDDDDDDDDAPPNPEADQPIPKKKLKVNADGT
                     VDYEDDVKLWEPGYRERYYEKKFGVKLSEREFIDKVTKSYMEGLCWVLEYYYQGVPAW
                     DWFYPYHYAPFAQDFRDVGSMDIKFETSIPFKPFAQLLGVFPAASRIHLPEPLQTLMI
                     DEDSPILDFYPPDFEIDMNGKKMAWQGVALLPFIDQNRLLTALKSKEELLSDDEKRRN
                     SWGDNVMFIANENPLYDLFCDKLYGLRAKDVSKPIPIDTKASYGITGSVLPDPNCVPA
                     STFDTPIPSISECPDLNPNDSISVRYYFPRQAHPHRSILLRGYKPEPARLTESDKDWV
                     RRGGQGGRRGHRHNGGGNGNVTGGPGMARGRYESGPPRTNGYQPPPPRSNYGGSSGYG
                     YGAPAPLPSRPPVSSYGGGAGGYGYSNPYAAAPNPYAGGYGAPAPYAAGGYGQRPYVP
                     PLPPPNPYSAPPPAYGRPPGGGYGYGAPPPRGGGYNPYPSRR"
     gene            complement(528746..538364)
                     /locus_tag="CNF01820"
                     /db_xref="GeneID:3258401"
     mRNA            complement(join(528746..529060,529113..529415,
                     529464..529604,529664..530447,530500..531169,
                     531220..531503,531561..531794,531846..532002,
                     532054..532265,532317..532392,532448..532582,
                     532636..532716,532770..532842,532893..533105,
                     533158..533252,533303..533609,533660..534372,
                     534422..534640,534692..535034,535084..536300,
                     536345..537760,537809..537955,538010..538364))
                     /locus_tag="CNF01820"
                     /product="Ras GTPase activator, putative"
                     /transcript_id="XM_024657379.1"
                     /db_xref="GeneID:3258401"
     CDS             complement(join(529006..529060,529113..529415,
                     529464..529604,529664..530447,530500..531169,
                     531220..531503,531561..531794,531846..532002,
                     532054..532265,532317..532392,532448..532582,
                     532636..532716,532770..532842,532893..533105,
                     533158..533252,533303..533609,533660..534372,
                     534422..534640,534692..535034,535084..536300,
                     536345..537760,537809..537955,538010..538210))
                     /locus_tag="CNF01820"
                     /codon_start=1
                     /product="Ras GTPase activator, putative"
                     /protein_id="XP_024513023.1"
                     /db_xref="GeneID:3258401"
                     /translation="MPSLRRGSTASPHHSVSAPRIKSDLTSTYPSYPSHHLNDSASIM
                     SRPENQSGEQKILNALVSRLVNKLPCNSGIQLAILESDAAVQSTIQSLLQLSGTRLSL
                     VVQSLVNALEALSKYASSSASLAEIPLSVLHSQIYILYILNLCLSTSWRQHSHVSPPP
                     SSDLPRCWPDPYAFEDHLAKHMLNVLVIYTRLVSLEIEFGDVSGNHAPSKESKGSATA
                     SSSSWSKAMSASSGSCSLGTGFLQQHSYSRSSPDRDEPLGEKLSATCTTALSTVTQMT
                     KFTARAVFYLSASNWPLVSTQIRKRVHYLTTTIEDSPDLTELRLLEWSNVDQARLSQI
                     LAEISSAFSYIKRPAQITVATMLRKAIRNWITINPTEYEALIESGKKLEGGADALFDV
                     LHSASDLGSSSNARRTKAFYPLMAGLLVVCPDILRRVMARESTKGSSGLSKKMSYMDS
                     FRKGLNSTKGFEACALSYIEFMSAGMALSPRLETSAIRSLIHNIQNDLKNALFSSSLS
                     KEISDQNAIVEGLVALYRLNPTTTGGLLFPKLWNDSSDASKIVAVKACVMIAVEGCRL
                     PWYPPVEDLKKEVCSSIRGLLKAHTAASTPDRNAARRPRGSFELPSKQTELIFEILNL
                     YSLDPSFAFSGARLDPSTDDSVSLFMTLSSLMVLPNPEVTRVTAAKTNVTLVNYVREM
                     CQQSDHVMRLASNAAAGIWQMLLDVGRQVLFAFHDGEVDEVTASATAMREMAHAVIQM
                     AERHPGIMFPSPKAQPAAMVVSAAGFVCIVSPDVEQTTLTLPTLSTLGKLTRMAHRSA
                     SGEIMTSAYSTFPNNRADAFEKLAALPAAIGRQQQQRMIRRSLRPLAIGSSLTISVWM
                     GLASIWKALTAKIVAADAGNSISSREKRRMMTVDIEGLDAEESKEWQNAISFLAALAN
                     VGLTNLKPKCLSEVIGKEGFLPAAYDQDISDPGALIEAFIRQCVELLASNSIAVREST
                     KAALGSELPTTMCRVLVAQMIKLLSHAINPSGVNISDSFTSFVEQAVAVLRLQIDRMG
                     PDDDVPSVQVDMGELLYLLGKYIQRLGRSDLFLRLKTRYSQLMEAALRKPDNVLTTSG
                     GKLKTAALEWLAEWSMETSKDNDVYSTSMDSNARYQRELGHACLRAMVPVTDGLQLSA
                     GGEESEDPQGVLKSRLFYRHYRQLVKVIEKSNLEEDKSSDQLPSVHGQSSYKIAGPDD
                     APTLAILALSNLLSANIDVGLKHCLSLGYHEDPTLRTVFMQLLTNVLQQGTRFGGLAA
                     KRISYAPKLYLEGLTNPNLALALAMVDVCPQTGAEVDELSTLLFRVFEGKGTLLGLMR
                     VLIEREVTMTNHESELFRANSITMRMITIFAKTYGYNHVRATLQPLILSLAEKPAECS
                     FELDPRKAAPGDDIERNSDHLRLMCQALLDLICSSTPRVPLMFRAVCHHIWEVVDDRF
                     PDSRHSAVGSFIFLRFFCPAIVSPESIDLDVNPDTRETRRALLLITKVIQNLANNVVF
                     KEPHMKVLNPFLSDNIKQVTKFLSDIAIRPKTIEVQNAAKTFQEEAERSQDLDGDDAI
                     IHRFVFKHQARLEASLSSMPKSFRHASNSKLARTEFDGPAALERLRKVMNATGAPPDA
                     TLLPASVRGQVYDEFMRHNQGRNVDSVREVFYEGSASQNGRRIFYFIVSRVALIDYDL
                     LAYHVFLTLERVTEYFDLIIDLTDFSHSTELPMVWLKKSIQLCPSGILSCLNTLVFYN
                     PNSYARKRLRHLISELLTISAPVGKNVVAASSPSELVDHIPFSSLALPEHTMALAYEA
                     DHVFTNLVCLSDHGMQIPVVVKLGQDCLQVASWRKQDLTSSLKSYIIDVVKLNAIDDI
                     ITGGGIPSDQLIIKHSQKETLTLLSRKRNEMVHIIRSARSRLKEDTPLNSRILRPTDV
                     PATLLNVALLNLTSSNETLRMGAYVLVNELSQFFKYSLASRVLKVSAGLTIPNNSLSW
                     VHDLSRALASSASHLTLEFLKEWVIGFSKADTPLKTASLQYVGPWLANLDQFSRPTRD
                     DAEESVKQVRGIVRSLVSITVAERRRLHLTIQEHLWAPFARAHESLVDIVLFELIHGA
                     IDAGLGSDKTECIADILVSISSTNVRGKVIARLRKSLAQTYLRPSNHLTENATWNEVC
                     ALARITLALGFNPTTALDTQLFLPELFHVVTLLLGAGPVIMRQTVYGLLVSIIHSLAS
                     NATAGEMDADALAVLLRRLQEPEMMTSFGVIQGQGHLELSGLPRKDETDIHLLDRVEE
                     VSKFLGEVLVAGAVSVDCANAWRARWMGLVAATCFQHNPATQPQAFIVLGYLASEEVD
                     DDLIYQILVAMSTALSHFIESDSILIVSMLRCLSRIVPGLFPDSRYVASLFWLAVGVL
                     QLGYIPLFAPALELMITALRSINMASDGIQSTELMEYLLDARRTVADQVKKLDQVSGV
                     SFDTDITFALIAIIYKGVRHPSTKKLTTEILLELLQLAANTAGSSAGNGTLVVAGGVA
                     YFVALLSISANSGDELKDVFKAARLYVDVSHMDVERVSVFSLLSIPDNSTALLLVSMV
                     VSLLNGSGGSDAEKAILYKLLADASAEIPEVLAMAYDSLIPRIVSTLTSTNNTSIISS
                     STTILERALSDPNYTFTNSSAIPSADSSTSLPHPGHGKVYASSISSSPSAGAAREQVL
                     DDLGMKGLAELAFPQVKVDRLNMMAKWVASLIENFTI"
     gene            538618..539988
                     /locus_tag="CNF01830"
                     /db_xref="GeneID:3258130"
     mRNA            join(538618..538761,538813..538977,539031..539185,
                     539247..539680,539729..539988)
                     /locus_tag="CNF01830"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_571642.2"
                     /db_xref="GeneID:3258130"
     CDS             join(538673..538761,538813..538977,539031..539185,
                     539247..539680,539729..539857)
                     /locus_tag="CNF01830"
                     /codon_start=1
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /protein_id="XP_571642.1"
                     /db_xref="GeneID:3258130"
                     /translation="MSVAKVAPSKGPSDEKAPGILSYPTKLLQTLDAHQAPVNVVKYN
                     NGAKYLLSGSADRTIRLWNPALGKEIKCYRGHAQEVLALDIAQDNAKFASSGGDKAVF
                     LWDVASGAVTRRLQGHFGKINAVRFSQEAQVLASAGFDAKVMLWDMRASSRDPIQTLK
                     EATSTITSLILPTSPQIITGSSDGYIRTYDLRFGLLTDDLVGWPITSLKLSPTAPEES
                     VLVGTNDGKVRIFDRKDGGCLQTFQGHKVGEQTARWGMDWGYGDGLALAGDEEGKLWA
                     WNVLDAKPIDKDPNPIHKRTITSIITHPKGKEMITASNDGTIKVWSR"
     gene            complement(539952..541187)
                     /locus_tag="CNF01840"
                     /db_xref="GeneID:3258294"
     mRNA            complement(join(539952..540430,540481..540608,
                     540665..540758,540810..541048,541100..541187))
                     /locus_tag="CNF01840"
                     /product="maintenance of ploidy protein mob2, putative"
                     /transcript_id="XM_571312.2"
                     /db_xref="GeneID:3258294"
     CDS             complement(join(540159..540430,540481..540608,
                     540665..540758,540810..541048,541100..541125))
                     /locus_tag="CNF01840"
                     /codon_start=1
                     /product="maintenance of ploidy protein mob2, putative"
                     /protein_id="XP_571312.1"
                     /db_xref="GeneID:3258294"
                     /translation="MSGFLNSIGRLRAPKRSPTNTPTQQGFFDPLPSPGVENANQSYR
                     PPSPGPKPLYLCQPFVKAALVKGSFKTIVAPPKYVDINEWVAINLFDFYHNLNQFYGV
                     LTEFCTMQNCPTMSGGKTLNFLWPDHNQRLVSLAAPTYIDFVMSWLQKLLEDENVFPT
                     KSGKPFDHSFAYTAKHIYKHLFRIFAHLYHAHFEQVLHLSIEAHFNSLFAHFLAFGKE
                     FDLLVMKDLMTTQGMGQGVAELSEKWRQMGILES"
     gene            541326..542841
                     /locus_tag="CNF01850"
                     /db_xref="GeneID:3258443"
     mRNA            join(541326..541433,541483..541608,541668..541816,
                     541863..542841)
                     /locus_tag="CNF01850"
                     /product="expressed protein"
                     /transcript_id="XM_571313.2"
                     /db_xref="GeneID:3258443"
     CDS             join(541364..541433,541483..541608,541668..541816,
                     541863..542711)
                     /locus_tag="CNF01850"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571313.1"
                     /db_xref="GeneID:3258443"
                     /translation="MSRSMMDLEEELLRLWSLVGELSEQLSNNRALVAQLKARAENVK
                     GQAVHVGTGFPLRRFNLDISNEEFHSELEAFGSHLVLENQQLQHENKQLNALLKEYEQ
                     TLETVMNKFRGVAHSSQQHDLSLHSYYTSLLQTLQTAHSSAQLHDSTSLSLLLNRLST
                     LLRSALRSMQGEEPDSELDIAAILPALEQAEKPYLNSNHLVSESGPSGTNKVDDEDLR
                     GPSPTSQPTGVQSQKTIPRAPAKPTRFPGFLPGSSGGYAGTEGRSDWALEREMEILRL
                     EDENRALREMLGIAEEGKMPQDEDGDDKKAKVEDEEDSQRRKSSLTMEELEADAALEA
                     ERSSMMASGLYEATHGVEEELEETSKRPLLAGSMLGFQTDGPPPEQAIVDELDGDGEG
                     VPPMQ"
     gene            complement(542809..544158)
                     /locus_tag="CNF01860"
                     /db_xref="GeneID:3258106"
     mRNA            complement(join(542809..543003,543056..543307,
                     543362..543528,543580..543692,543743..543828,
                     543887..543901,543954..543980,544032..544047,
                     544096..544158))
                     /locus_tag="CNF01860"
                     /product="proteasome subunit alpha type 4, putative"
                     /transcript_id="XM_571314.2"
                     /db_xref="GeneID:3258106"
     CDS             complement(join(542825..543003,543056..543307,
                     543362..543528,543580..543692,543743..543828,
                     543887..543901,543954..543980,544032..544047,
                     544096..544098))
                     /locus_tag="CNF01860"
                     /codon_start=1
                     /product="proteasome subunit alpha type 4, putative"
                     /protein_id="XP_571314.1"
                     /db_xref="GeneID:3258106"
                     /translation="MARRYDSRTTIFSPEGRLYQVEYAMEAISHAGTVLAVLSKEGIA
                     MAAEKKVTGKLLDLSLTPGAGVGGEGTEAWMGGGGEKIFLLNNNILAGLAGITSDANS
                     LVNFARNSAQRHLFSYDEDIPVEMLVQRLCDMKQGYTQFGGLRPFGVALLFVGWDPLY
                     GFQLYQSDPSGNYSGWKATSIGANHSSATSLLKQDYKEDLSLEDAKGLCLKVMSKTMD
                     STKLSSEKLEFATMTLHPETKQPLAKIYRASELDELLQKLELGGTNDDLAEGSGGGGG
                     GESHVAIST"
     STS             544102..544334
                     /standard_name="AGC7"
                     /db_xref="UniSTS:470834"
     gene            complement(544521..548454)
                     /locus_tag="CNF01870"
                     /db_xref="GeneID:3258241"
     mRNA            complement(join(544521..547367,547416..548020,
                     548068..548454))
                     /locus_tag="CNF01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657380.1"
                     /db_xref="GeneID:3258241"
     CDS             complement(join(544825..547367,547416..548020,
                     548068..548120))
                     /locus_tag="CNF01870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513024.1"
                     /db_xref="GeneID:3258241"
                     /translation="MSNQVSDQEIEREIQTLRNLRRRSITSAGPGALPLDPDLPPPSP
                     NSRASFETSPQYTSNDDITLSTPDGLDGDGLFWVPAHLHPELAPGEFRAFLKSHTSTD
                     PTHADASDAGDAPGMSRSRSWMTRNPSTRGSEGLGRKRSMLSRQYQPSAGDNVEEERP
                     PLPTPKPVNIYGGRSGEKGLTLEDLQRLEQLVDEAGEDVDPENMRNLLRRSLSMNVAP
                     GFLQDDVPQGDNADAPLVAPRPGSILRRSARTKIRKAGLSGDGGGHRFAATRKGRMTA
                     APQREIPGLEDDDYASAPESPHRQGSDDASLESEDKFHDAQESHEGTSSHIEIRRDSD
                     TSTDEAHIFDAYVREPSSSISSSSHDHSTSPSPEPSPPSRKLSLPPVPESGETTDWFT
                     TEYDRTPTQESLSDPLASKPRSAEEKAFAAGVGGLSINTTFGEQDHAAPQARYAQLPV
                     EQDLPPGMAPPAQHMSLPPKPLPANAQPAPPVNIEMPQLAKTETNVSTSSVSTSGTTT
                     TKEKKGKFFSKKKDDKEKKGKKDKDRFLGSLFGGKKKNEESSSVSNFSSAGPAAAAAL
                     LGTSKSAKSIGAPPSPSPTSPNFQNYARYPIHVERAVYRLSHIKLANARRPLYEQVLI
                     SNLMFWYLGILGRNVTEEKKAIGDEKKEEAKPVIKGTPPKPADTGSAAKPGTVIQRPS
                     LNSAPPRAEAAVEHRPTPAQPAAAPSKKSSLSKPERARDGRNSEAPMRAPSYGAQTAQ
                     VDHEVRNQMMNQQMGGIMRGPPPQHAQPPSSQAPAGNYPQAHPPSPQQTPRPMASSGP
                     ARALSPPSPGVNGPRSPEAGYHRDIPSAARGVPQSSFGPPPAPNSQVVGEDQRDMRQR
                     TISNPNLPHPGSMSPPGGASPRRVVTEGRMPVEGAPRPLYPQRSGPQPGQLFQYPAGA
                     AVPPFARPGSPGPQPGQVFNHPRPPQSMPPQPGQIFQHPQHHPHPHPQARPPHPQYGQ
                     RPLPPPGQAQSWEPPQRLPPGASPPQWAGARPPAQQGAPGFDPRRAYPPQSQGQPQGY
                     YGGAGPAPAPGQPLGRPVAVQHGQGYLPAGEYGHHR"
     gene            complement(548976..552507)
                     /locus_tag="CNF01880"
                     /pseudo
                     /db_xref="GeneID:3258474"
     gene            552657..554072
                     /locus_tag="CNF01890"
                     /db_xref="GeneID:3258475"
     mRNA            join(552657..552854,552911..553346,553404..554072)
                     /locus_tag="CNF01890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571317.2"
                     /db_xref="GeneID:3258475"
     CDS             join(552755..552854,552911..553346,553404..554034)
                     /locus_tag="CNF01890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571317.1"
                     /db_xref="GeneID:3258475"
                     /translation="MARSKKGGRSSTGSKQAPPPQSSGQPHDAASLIEKAHTLLAQSN
                     FELAIKFLERALEVEPTHAEAKELLGIAELEGGDAERGRECLIQLLPPHAPEAPAHPS
                     PYLYLAQSAENPQEALGYYTTAAAMLEKIISAEEADAREKEKQVSGGEEVEDAVAEER
                     KMAVNALLAMIEIWMSDLCMEESAEGNCDALISRALSILPNDPEARLSLASIRMSQSR
                     FDEAKAIAMRLYNDFEGREAFDPILPPLPVRLALARLLLEHHEHLPALDIVSTIREED
                     TLNVEGAYLEGWALYLRAEALIENPALIQSDPAPISTPGEDLEEPEEPMSAEECLSEA
                     MRSLIECAKLYADEDYLDEGIGAHVAELLEELEKRGVTPAMNDVEDDEDVEMQG"
     gene            complement(554058..554924)
                     /locus_tag="CNF01900"
                     /db_xref="GeneID:3258325"
     mRNA            complement(join(554058..554320,554477..554577,
                     554666..554744,554807..554924))
                     /locus_tag="CNF01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657381.1"
                     /db_xref="GeneID:3258325"
     CDS             complement(join(554144..554320,554477..554577,
                     554666..554744,554807..554809))
                     /locus_tag="CNF01900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513025.1"
                     /db_xref="GeneID:3258325"
                     /translation="MAANSQGIQTLLEAEKEAAKVVQKARQYRVQKLKDARSEAAKEI
                     EAYKAKKEEEFKRFESEHISRTSTSQTSIDSTTKTQLSELDDAVAKNKEEVVKKIVSR
                     VLQSKPHLHPNLKKLEA"
     gene            555079..559723
                     /locus_tag="CNF01910"
                     /db_xref="GeneID:3258305"
     mRNA            join(555079..555485,555541..555836,555882..556541,
                     556591..556737,556799..557103,557151..558018,
                     558070..558235,558284..558666,558724..559723)
                     /locus_tag="CNF01910"
                     /product="cleavage/polyadenylation specificity factor,
                     putative"
                     /transcript_id="XM_571518.2"
                     /db_xref="GeneID:3258305"
     CDS             join(555167..555485,555541..555836,555882..556541,
                     556591..556737,556799..557103,557151..558018,
                     558070..558235,558284..558666,558724..558741)
                     /locus_tag="CNF01910"
                     /codon_start=1
                     /product="cleavage/polyadenylation specificity factor,
                     putative"
                     /protein_id="XP_571518.1"
                     /db_xref="GeneID:3258305"
                     /translation="MSLYADDDPTKALQLTDEQPTLQPPTDPQQALNAALALDSESPE
                     QQEGLQNAALRFEEHPERLPEVIPRLLGLITEGGDSLLRFWTLDMIALTVGRSGLMLD
                     VKLHVAQYCLTALNKLLHSDSVPTIKAVIPILSTIYPILFRLLATSRPSQQVLDLFNV
                     AKSKIISFALDPNARPFNVGIKAVAWKFVQRVLLAATRAAGSDPRLPQRGAGSNDVNV
                     SHIVPNGCLSASDIEKEGTLLQTQLVTHLYSSSDPAILHPLINTLPAIAKMRPTLAPL
                     VVHSLASWTPSALAAAGRSAMEIRAVDKTVRIAISHLLRHPPLSAHVAQLNDALVRQK
                     ARMEAAFLAEASARKERRQNLKHTIDPGAASEAESSEQAAKRAKLDGLGVGSGIGKGP
                     EIDVSGMRLEEVVEVVLSSLRGVSSELLTGTIENAKRALQENSADAQPLLAAALGISN
                     VVKEEEEEEILNPLDMEDDDDDLLMDGPEPLMEEEEPTSFTDFVLPAPEPLESSDKEF
                     IFSDTIERIWQTGADLASLPDPKDSDATKLAVKPKEMWMLLLARLATRGADVKRKVIC
                     DFVIADFANRSKFASVWLNEEWYNEKIGVSSPGQYLSNLEAIVTAYLPKVDSKDKSLS
                     TFILTLPAIPPSLISTLETICQEPERALVGFLALRDIVEARPPVRPQALQTLLELCTH
                     PDRKIRVMAIITTVRRWGNDSPMMPFLTKYALGVLWRLINDDIKSEDVDMEEGEQADE
                     KIQSKFLGEPNADNVQQHVELAFALAKRKQDLLDDIFRLYPRLEPAVQDVVEAQLMPL
                     IQSLGATEKLLEILRKFPNGADKLVMRVVGVLSAEGSKTLVTLMKTLLSERDLDPRFV
                     IPIVGDLDKAEIEKQLPRIVSLLGDTDSKDMVKTAFASMLQKMTPSDLMVALHQEGAP
                     LKLTIEAIGICFSMTTVFRSDVLANAMSRIADLPTIPLIFVRTIIQVVTTYKSLAPFV
                     ANHILPKLVTKKIWEIPQLWDGFIMLAKRIAPASFGALLQLPKEQLKQVVEKQPGLKS
                     GLKGFLSNKPGSKAAMAEIFGDD"
     gene            560122..562727
                     /locus_tag="CNF01915"
                     /db_xref="GeneID:36392896"
     mRNA            join(560122..560544,560609..560781,560855..561810,
                     561864..561937,561987..562057,562106..562727)
                     /locus_tag="CNF01915"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658564.1"
                     /db_xref="GeneID:36392896"
     CDS             join(561137..561810,561864..561937,561987..562057,
                     562106..562402)
                     /locus_tag="CNF01915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514492.1"
                     /db_xref="GeneID:36392896"
                     /translation="MDNQSSLWSDTLARDPANVQCPSPRSQADDVGPSLYPQTVDAPW
                     YKDPVEGSPSAFPQAQTRSTSTFQMPLNGEEEYACGRQLASSFSRAISTQTFDSGWAS
                     PAVCTRSSPKSQVITLHNRRLSYVTYPTPMSPRRYTPQPSPSPAPHRFQHPLQPHTSL
                     WSDNGLIPLRYEPQRGNERNITTVVKYGRTRVQSWIDIDPDSRKKEKNGTESDETSSL
                     KGRCHPCPVCAKRFTRPSALKTHMHTHTGERPFICGWPGCGRDFSVQSNCKRHIRQTH
                     EAKEARKKEEVEEIIKASKITFPVEQQCQRSNTSSCFNFSSISPLSPSCDAHRMYMGR
                     SLVSESAHHLHFMSSQRAHRNSSSGGKSDLRDRRCPY"
     gene            complement(563325..565219)
                     /locus_tag="CNF01920"
                     /db_xref="GeneID:3258120"
     mRNA            complement(join(563325..564085,564159..564239,
                     564294..565219))
                     /locus_tag="CNF01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_571643.1"
                     /db_xref="GeneID:3258120"
     CDS             complement(join(563678..564085,564159..564239,
                     564294..564611))
                     /locus_tag="CNF01920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571643.1"
                     /db_xref="GeneID:3258120"
                     /translation="MGHSGNASSLEQISKTFGVSQGHVRCTARVLKAVLDTPAIMGAI
                     NLPAKGSAEREDAKRKMEEKGGPEWRDGWLVVDGTLIPLAFRPIIRRESFLGRKKNYS
                     INLLVFNTADRRIVDFKSGFVGNRNDASCFASSRLAREPNEVLSPGEWCWADQGFPLC
                     RHIIIPFSESDLSRFNTYLSRCRISSEHAIGFYKSRFQFAKGVRYQIRSFRQLELLQL
                     YVQSSLVLHMFAYDDESQDRTWDFDQDVFHLEGQRMLEEEDRARKVSPQK"
     gene            567579..571977
                     /locus_tag="CNF01930"
                     /db_xref="GeneID:3258260"
     mRNA            join(567579..567849,568306..569371,569430..569769,
                     569822..570546,570596..570968,571022..571977)
                     /locus_tag="CNF01930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657382.1"
                     /db_xref="GeneID:3258260"
     CDS             join(568868..569371,569430..569769,569822..570546,
                     570596..570968,571022..571818)
                     /locus_tag="CNF01930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513138.1"
                     /db_xref="GeneID:3258260"
                     /translation="MPETLMSLSTSTLLERRRSSLSPPSSPPAERSKTQPSVTPVPSA
                     TLSVYPSPSSMSLPTVPLKDVPADQSQEGGLQPSSQRYHPPPLLPRRESFHCSNNRPH
                     PPPFRTALSSLGPMTTSNLILGTPTEEKASPKFSIKRGKEEKVDKEELTTKGRKRKRL
                     AKACSACHKNKRRCDGFAPCSNCEFSNRPCQYLNAQGEPIPPPRTRDPSNNTSSKGKD
                     DCKASSADGSDIASQEDRRESGESNQSLRDGQMDPESEVDRKPSIGPLQVVDMDVSLG
                     AELVDIFFKRCLPLPFMLHAPTFNYRLYLNQVSPILLDSMYAFAARLCENPFFLQTFP
                     PNHPPHLRGELFALRAHRSAENLIQQRNIWSEETRRADRGSWQETELAQAAYLLSVYF
                     TCLREPKLGLFYLDAGVDILRPSPATYIQPPAAPTGASPIEYTTHMECRTRTFWAFVL
                     HDLCAASNGRPRKLGEVDLGAIPLPGTEAHWARWGGGGIGGREPGRRDGLIAGTGNWL
                     GEEGAVGEIGNVIRILSILADIMSLATDPNAGDSKQTLAARLEAALKAWAMALPSHMH
                     FNEPNLTMAVSKLSSPVAEIKTSGWMYAYMHAVAECGMFYLQAAVAPVSDGVFTARRQ
                     SQAIENLIVIMDAINQTGREGFSFLFPLLVISNWQEHLEKSDLLVRDVKHHLTEERLN
                     HWWSEMAREWGVERHDVLRRGFYILPISPVVPQRKYRYSQSSHPDRPFLATSSLGLYQ
                     ASPPNRISLESAATTSPTSTAAIPVTTPNFNRTSRFNLPTLPPLRPRATSGASVLSNY
                     YGRSPSPPLHLPSVASALSDRGSDKEHERFSLPSISSELRYREPSSPRHPLSQSISLR
                     YIPKQHPYVREKPRSPRRSISERDMRDGDHITGIAALVTAAERERERESGGQNIRS"
     gene            572418..574026
                     /locus_tag="CNF01940"
                     /db_xref="GeneID:3258152"
     mRNA            join(572418..572745,572814..572823,572877..572917,
                     572966..573014,573065..574026)
                     /locus_tag="CNF01940"
                     /product="expressed protein"
                     /transcript_id="XM_571519.2"
                     /db_xref="GeneID:3258152"
     CDS             join(572542..572745,572814..572823,572877..572917,
                     572966..573014,573065..573915)
                     /locus_tag="CNF01940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571519.1"
                     /db_xref="GeneID:3258152"
                     /translation="MDRSDCSTAANDQADEAHVEDCLDTNHDARAGGTSTAEKQCRIC
                     FSGPEEEDALGRLISPCMCTGSMRYVHVSCINAWRGTGANAKAFMECPQCNFRYQIRR
                     TRISGLATSKPILLLFTFFLFSILSLTLGSILRSLLAYSTTSRTLLSSSPPINVATPF
                     DLFGGEFVDRGGGVVIVGGSGALVWDIVLAAVQTFASLADRMTYFQSHLHDCLPGPIA
                     VFVSALFVRFFLGLAVLGSLSFISLSISLSLFGPLQLANALRGGFIGSWGRRRLARNG
                     RDGGIGTVIVVILVVIGAINTLRQVYEGVGRLAIKLLKYLETQILEVNPDEIRRSTRP
                     TGERSRAIWYEQLRTWNGWKEMGYRCYTRVEGWLQSLWAFWAPAEHEHVE"
     gene            complement(574677..576775)
                     /locus_tag="CNF01950"
                     /db_xref="GeneID:3258410"
     mRNA            complement(join(574677..574930,574988..575039,
                     575093..575850,575900..575904,575969..576026,
                     576078..576185,576244..576395,576657..576775))
                     /locus_tag="CNF01950"
                     /product="transcription initiation factor iib, putative"
                     /transcript_id="XM_571527.1"
                     /db_xref="GeneID:3258410"
     CDS             complement(join(574829..574930,574988..575039,
                     575093..575850,575900..575904,575969..576026,
                     576078..576185,576244..576276))
                     /locus_tag="CNF01950"
                     /codon_start=1
                     /product="transcription initiation factor iib, putative"
                     /protein_id="XP_571527.1"
                     /db_xref="GeneID:3258410"
                     /translation="MVAVAGPKAPGPRFGQSVVPNLNIKQICPNCRTDPPNIVEEYAK
                     GDLVCADCGTILGDRIVDTRSEWRTFAGDENGDDPSRVGDAGNPLLGSNHLDTMISHK
                     DGRTGIARDLNRAQARANTLSNGIYGKSSVAQLSAVFSRIGEKCDAMQLPRGVRERAQ
                     HVYKIVDEARAIKGKNEPAVIAACIVYACRDAKVHRTFQEVCKALKISKKELGQVFNH
                     VKSVVQSSSAQGSMVSVHGSNNAQESAEGLLGRFANYLDLGNAVFNVSKHIAGEAVAK
                     SAIDGRSPVSIAAGVLYFTCVLLGKSTTAKDISAMGGVSESTTKLITKMVASKLDDVI
                     RPEWRTEYPDGYAALAQLGKVSESNKNSRSGSLAAQS"
     gene            576926..578633
                     /locus_tag="CNF01960"
                     /db_xref="GeneID:3258090"
     mRNA            join(576926..576948,576998..577093,577168..577287,
                     577383..577474,577524..577728,577784..577977,
                     578040..578218,578268..578352,578401..578633)
                     /locus_tag="CNF01960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571520.1"
                     /db_xref="GeneID:3258090"
     CDS             join(577210..577287,577383..577474,577524..577728,
                     577784..577977,578040..578218,578268..578352,
                     578401..578485)
                     /locus_tag="CNF01960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571520.1"
                     /db_xref="GeneID:3258090"
                     /translation="MAGAVPQFMVDEYVLAYHGPLLYEARVILAEVWDESNTLLGTVG
                     PHYFIHYKGWKQTWDEWVPESRLLKLNEAGFAKRRALLDAQAKKGRSTGGSGGTGSPG
                     AGKGGLKDKKKDTKKRGRDAMESESDFMKRPEVKIVIPDVLKLVLVDDWENVTKNNQL
                     VALPRKPNVRELLEEYRQYASASKKQERSDRATALLSEIISGITLYFDKALGNNLLYR
                     FERAQYVEQKRQNPEKPMSEIYGAEHLLRLFVNFGPFIAYTNIDTESLNILRDYINDI
                     MQWMIKEQKRLFMKEYEETTTHYQNLSRS"
     gene            complement(578684..579549)
                     /locus_tag="CNF01970"
                     /db_xref="GeneID:3258297"
     mRNA            complement(join(578684..578953,579007..579029,
                     579125..579269,579339..579549))
                     /locus_tag="CNF01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_571525.2"
                     /db_xref="GeneID:3258297"
     CDS             complement(join(578889..578953,579007..579029,
                     579125..579269,579339..579444))
                     /locus_tag="CNF01970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571525.1"
                     /db_xref="GeneID:3258297"
                     /translation="MDLQGRSPSPEQQGVKFPRFGPDGQPLKAVIKNVDMSEEMQQKA
                     VETVFESFDRYDQEKDMAMYVKKQFDRLYGTTWHCVVGKNFGSFVTHESKNFIYFYLG
                     RVAILLWKTT"
     gene            579756..581151
                     /locus_tag="CNF01980"
                     /db_xref="GeneID:3258109"
     mRNA            join(579756..580022,580082..580204,580265..580338,
                     580399..580421,580484..580594,580649..580678,
                     580734..581151)
                     /locus_tag="CNF01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657383.1"
                     /db_xref="GeneID:3258109"
     CDS             join(579816..580022,580082..580204,580265..580338,
                     580399..580421,580484..580594,580649..580678,
                     580734..581131)
                     /locus_tag="CNF01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513026.1"
                     /db_xref="GeneID:3258109"
                     /translation="MFGGPPLARTIIPDNASPSGGNALHKMDYNMLALNHKEPSLTDL
                     HISGLPIHVYGLQEVKDSKRPLAVMIASHGRMNSKKNMKFFAQGILGELSKKDDKERL
                     RDLIVVTFDQRNHGDRIVDKKSNLSFDQNPKHLVDMAATIEGGCHDVSLIMDFLAPIL
                     FPNGEKTVESFVITGISLGGHVTWKLLHDDPRVQIGIPIIGLPFESFPVYLRDRALSQ
                     GLKWEPPIYPPSLKSFIEPVRNPVEEQQKYSGKKILSLHGKEDRLVPYGKGERDLRQI
                     EKWIEEDKSKGGVCAIDVQNDVGHVCSIQMLRKAAEWTWMYALRA"
     gene            581314..584283
                     /locus_tag="CNF02000"
                     /db_xref="GeneID:3258074"
     mRNA            join(581314..582312,582388..582472,582524..583058,
                     583108..583256,583305..583446,583502..583772,
                     583825..583969,584028..584283)
                     /locus_tag="CNF02000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571522.2"
                     /db_xref="GeneID:3258074"
     CDS             join(582120..582312,582388..582472,582524..583058,
                     583108..583256,583305..583446,583502..583772,
                     583825..583969,584028..584106)
                     /locus_tag="CNF02000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571522.1"
                     /db_xref="GeneID:3258074"
                     /translation="MPTNFRTCLYALAGLAMAGVSLGAPDHWILTHAQTLLLGRVDPI
                     VNPGAISSHVHNVVGASNFNWNPNTPSEQLGAACSSVIVADDKSNYWAPELYYQHENG
                     TFSPILSGTRIYYFTKGDEVKPFPTGLKMISGTAASKNTSDTKALGVKISCDEGEQGY
                     WLPNGTSHPGGCSTIAMATYFPSCGLESGDLDSEDHFSHMTWPQSYNGSILVNDPNGQ
                     YCPDSHPIKYPTIFAQFNYYLDDNQPWRNDECTLVLSNGDCSGNTYHADFFNGWEPDV
                     LQAAITECGDGNGVDDDLMACAPLAKSTNESATWDCRLQGPIPAEDVGLWRPINQLPG
                     CNPLWKSDVATKPTCESTADPDMVGANVYFENLKYRMHIPMAMSSIHNTSELEGLIPG
                     LGNTGDSKLQAWGSEGVDQAEMTVGTWEEIEAAEAAGSNSSSSSTSASETVTSSSAAV
                     SVSATSKLSGDGIAAVATADNTSENTFSVNGDSSTVAPASQSAASSVTSSSSGKTCKR
                     RKRGLTVRDSVKNHLHKSRLHRQL"
     gene            complement(584648..586059)
                     /locus_tag="CNF02010"
                     /db_xref="GeneID:3258323"
     mRNA            complement(join(584648..585760,585823..586059))
                     /locus_tag="CNF02010"
                     /product="expressed protein"
                     /transcript_id="XM_571524.1"
                     /db_xref="GeneID:3258323"
     CDS             complement(join(585294..585760,585823..586012))
                     /locus_tag="CNF02010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571524.1"
                     /db_xref="GeneID:3258323"
                     /translation="MPSNFPPVQPKPKLKVCEVLANQIYTVDDFFSPSELRAVLAWAQ
                     SLELEGPKKPGKGEAERTGRRASLHSPEIASSLLRLLHPLLPSLSPPYTSHPGLSANI
                     RVYHYPPHTFFGQHYDMPQLDHASRRLSCWTVLVYLSDGVTGGGTTFYPHEETGKKGK
                     KGSKTGLKYGQKEKVTVEPKAGRMLLHWHGVSGGGCMKHEGDEVLSGDKWVLRTDVLA
                     "
     gene            586229..587450
                     /locus_tag="CNF02020"
                     /db_xref="GeneID:3258123"
     mRNA            join(586229..586347,586401..586785,586851..587450)
                     /locus_tag="CNF02020"
                     /product="expressed protein"
                     /transcript_id="XM_571523.2"
                     /db_xref="GeneID:3258123"
     CDS             join(586323..586347,586401..586785,586851..587433)
                     /locus_tag="CNF02020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571523.1"
                     /db_xref="GeneID:3258123"
                     /translation="MSSSPFTEDALNRYRITHSDRELRPLLRRLHQLPKLSSSASPEE
                     SIVERQLVYLELLKWRTGIERIIGSVGNLEKQKSDYERQTREIKGRTESMKQLLAKEE
                     EYLGKARKLRDHRVKCDELAAKIRARSRSRNELDEQITTLETSLEEQRASHAIYVQTA
                     QARADTFAHIAKLIEECRNVKLPVDPSLATVALEKTDVVEPPAMTSAPPTIQLNPAAV
                     PYQPTAAKTASSSTLKAPSGGYALPSRPSNSPLHSSGNSRNQNSSRPASYLLPNRPNG
                     GGRGPATSLAGQVKGRGGLEDGEVGPEEGELDERGTKRGHETEVTTRRSTRRRM"
     gene            587831..590453
                     /locus_tag="CNF02030"
                     /db_xref="GeneID:3258301"
     mRNA            join(587831..588088,588145..588343,588397..588582,
                     588631..588810,588869..589165,589219..589305,
                     589358..589776,589828..589935,590003..590453)
                     /locus_tag="CNF02030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657384.1"
                     /db_xref="GeneID:3258301"
     CDS             join(587873..588088,588145..588343,588397..588582,
                     588631..588810,588869..589165,589219..589305,
                     589358..589776,589828..589935,590003..590302)
                     /locus_tag="CNF02030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513028.1"
                     /db_xref="GeneID:3258301"
                     /translation="MSTDAPHPAPGPSKKTPAELAASINPSPRRRLAIILSFPLLILL
                     AVPFWWYTTSIERLPLPEGRISALEDANYTIPRAHILFTADSSAFPTPPPGKRRFDTK
                     DILRSLGKEVTKGVDGIYAKQRPSERDVRRWDLVYEGDDEATGTNLRVHIRRWEYANS
                     SFPLEPYVQLPETGLMTSGIPAGTLVVPVHPDQVGDRNLKLHYKIALINAILSVYPPR
                     PPEIPLRALKYTPNVTLSFVLLNEDASQGDYVHSWDIEGAIRDHFLPHLEPLRPIFNC
                     TIESQILYHAPLSFEPSYSEIPGIERGKAVEAAVDMINSLPDHDQKISMEAAVKGMED
                     EQGNGAWMVDREQMTIFVNSEKWSLDSGSTNNPVLRFLIYVPSIRHRPMRLITGDSAQ
                     AFLLPQFGGVVILNPPPPSFQSHSYHLSSTALTPAFHLFTQHLYSLLALPSLPYKPNK
                     LHVPPPSSPLHKPSSLMQPLTPWQVHQVLLARLEENFQEGKKTLKGIVRLVKKIGEMK
                     VGEGVRDTVLGAVIRLERVQQSANSTALQAFILARDAVELANKAFFDPSMMGLLYFPD
                     EHKFAVYTPLFAPVAVPLIIGLLKELVSRRKRGKAAEHTGKPPDVQVMLDEIQKGAVD
                     GTTTSQMEVEEGEKTVQPHGGSLPDNSPLRTLSSRAIHE"
     gene            590458..591445
                     /locus_tag="CNF02040"
                     /db_xref="GeneID:3258343"
     mRNA            join(590458..590672,590732..590795,590858..590972,
                     591043..591445)
                     /locus_tag="CNF02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657385.1"
                     /db_xref="GeneID:3258343"
     CDS             join(590657..590672,590732..590795,590858..590972,
                     591043..591297)
                     /locus_tag="CNF02040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513139.1"
                     /db_xref="GeneID:3258343"
                     /translation="MSNFERLNKTGDAILQHDDSKGPGISAENPAGVYPDVGVNPAPR
                     GSMPGSGAPDHHGDVRGIFGNPQVFKDTFGHLSSAFSEAISSIQHESGSGIGFVGKAL
                     IARLENMRDEVDGWRTGKGLPEVEKHGGELGEDVEQAEGDEGGLYKD"
     gene            593045..596016
                     /locus_tag="CNF02050"
                     /db_xref="GeneID:3258057"
     mRNA            join(593045..593366,593416..593537,593594..594272,
                     594338..595559,595612..596016)
                     /locus_tag="CNF02050"
                     /product="sulfur metabolite repression control protein,
                     putative"
                     /transcript_id="XM_571327.2"
                     /db_xref="GeneID:3258057"
     CDS             join(593202..593366,593416..593537,593594..594272,
                     594338..595559,595612..595730)
                     /locus_tag="CNF02050"
                     /codon_start=1
                     /product="sulfur metabolite repression control protein,
                     putative"
                     /protein_id="XP_571327.2"
                     /db_xref="GeneID:3258057"
                     /translation="MSSSSAPPNMTAFPRENHYELEDQALDVIPTRAGRKLCVRHKQM
                     ANQNVNEKLQRSLDNLNPSERAAITQMWSTFSTAPHGKRKIILEGILTMCCFSQLSHL
                     SDSLNQIIRIDPFSLLPRETSLRILGYLDAFSLGRAAQVSRSWKALADDDLLWRRMCG
                     QHIDRKCDKCGWGLPLLERKRLRVELKDRSPAGLVEHDHKHENENGESRLVTRDQVLS
                     GNANTVSSIGGLKSCDTSAMYLFPPNVNATAPKGIKRTAPESSVGAAKKVKMNDSDSD
                     VEIIKPGGSSLTREVRLTRPWKTVYCERLMVERNWRKGRCSTKILKGHTDGVMCLQYH
                     TALTNPSYSVLITGSYDRTVRVWNLDTGEEVRVLRGHTRAVRALQFDQMLLFTGAMDG
                     TVRMWNWRAGECLRVMDGHTDGVISLNYNGYLLATGSADSTINVWNFRTGNRFTLRGH
                     EEWVNNVVLWDGKTSPSDTDPAAIPSFTQAVSNRCQKSKSPAAASNEPTLPNIDPGAM
                     LFSSSDDMTIKLWDLETAACIRTFEGHKAQVQSLRVLMVDMTEEEVAARDRRQRRQAT
                     PPTTGFTAASLVSPPGSQAAFGAGGASIHDAPAGFDPLEHRGRSRSDTVQPRVYVHSP
                     DGTHKKSEREQSRGHEKKAIVASGSLDGTVKIWDVETGREQSTLFGHIEGVWAVDIDA
                     LRLVSASHDRTIKVWEKESAQCVQTLVGHRGAVTSLQLSDDMIVSGSDDGDVMIWNFA
                     SSANNVSNTASVSGPCVDITPSPTPAIV"
     gene            complement(595973..598343)
                     /locus_tag="CNF02060"
                     /db_xref="GeneID:3258259"
     mRNA            complement(join(595973..596486,596540..596794,
                     596846..596971,597030..597251,597301..597909,
                     597958..598131,598177..598343))
                     /locus_tag="CNF02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657386.1"
                     /db_xref="GeneID:3258259"
     CDS             complement(join(596029..596486,596540..596794,
                     596846..596971,597030..597251,597301..597909,
                     597958..598131,598177..598282))
                     /locus_tag="CNF02060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513097.1"
                     /db_xref="GeneID:3258259"
                     /translation="MDIVPGVQGVWVGWQRGATTGVLRAEVGVDKAGNHFIQTVPLAL
                     PVMTPPAFDGVGKRTRIHSTLQSMSFISTPAKDEAAAESVAAVLVYEDHVFTPPESIR
                     RTRLETATFERRLIQLAPGFSEISGGDTELNSMWEWYAAPQSTNTVLSPVNTTIQALQ
                     PLHSIPPHSLALAVISSPDGTRARVHLDLAAKQWNPTGHHPIKGIRGDFPSLVVSQGA
                     ERGQLGLCAVVDQYRSHLGPVNKLDEQPLLGELPQSASDTEKYAACAATSIILAERQD
                     TNWSDVIHALEAILPASSRGEFIPLVLQRIYDLAAKEIHIDQLHLVSRVQIALFSAFK
                     DARLALATDIFRLNEASELVDRCATFQDDGSITFDLDSIWPLITVFDWAIGVIARAMR
                     EAILVGASAEWQGSDDSLMIDPCSPLLLLLHPILRSLVLRLLSQFHQLSIFLSTLERP
                     ILQPESKTLPASNTRDPMATVVAREQIRDIPLRQGVDVEQWGRALESLTTASEQKDID
                     KSLIELSLTPLQPQIPTLINILHTSSNLFTSEYFQLDASAGSSTSLAYDAIDWSVLQE
                     HGHRDDDDGGDDDGEAGDKDKMTVVVCDRCGWRTEALTMSVPAASGIKTHETTISPWM
                     EWKKQSEANCICGGTWVRKQVEIEY"
     gene            598748..608472
                     /locus_tag="CNF02070"
                     /db_xref="GeneID:3258065"
     mRNA            join(598748..600038,600087..601643,601718..604990,
                     605040..605659,605713..606094,606148..607191,
                     607247..607458,607507..607831,607882..608266,
                     608322..608472)
                     /locus_tag="CNF02070"
                     /product="telomere length control protein, putative"
                     /transcript_id="XM_024657387.1"
                     /db_xref="GeneID:3258065"
     CDS             join(599127..600038,600087..601643,601718..604990,
                     605040..605659,605713..606094,606148..607191,
                     607247..607458,607507..607831,607882..608266,
                     608322..608341)
                     /locus_tag="CNF02070"
                     /codon_start=1
                     /product="telomere length control protein, putative"
                     /protein_id="XP_024513087.1"
                     /db_xref="GeneID:3258065"
                     /translation="MRHQLVLPPRIFAPALLDYSKALSTLLAYPPHVESLDRHTWLAL
                     MSMCFAAILGDDLVSDDQMDDADMLGVAAELERLDAENVPPHRPPVTLNTSSLVQIIP
                     ALLCSTVSPIVPPTMKSGDTLTAGQKVGLGIVLKIRRFFTMYPHVTIYHLHLLTALNT
                     VLSDMELNCRDLFLLGSVKIFPHLVTLWAAPERDRDRRIPEQIAIAIHRILPHLAHSA
                     ELQGAQDVTENVERLMEMLAKESTMSRGIEPLDLGSMRLKTVAARGRHHFAACPFETR
                     SFSAGHHFTVDHALSWTAIEIYCDACLHLYQTRAFPSTATPSRQSTPSKRRKLENPLA
                     SLVSAVGMGRPESRLIALQTLVFVIDRHWSKLAKDIQSDIRRTLVSLLTDDSETLQSW
                     AYIALSTIILSSYTAGANENNNDENNNDGQSQDDWKQVWSFALRKCHLPGPSRSASHA
                     AAVLLQFDKVDSPSTIRGIQTMLTTIAVQGPPTAHDSVCALYSIALEAARSDIQLYSL
                     NLEEQVLSWLEKTFAREKFERDKMDQRLDQATPGDILRLFSAVSRIQYHVPLAEPVTK
                     EFLPDSAVVSYALERAKTQPIRDFLLYHTCPTPPPPPPPLDDSHTTPLLAASENHSTF
                     LGGRPRRLSELLLSILNATTAQWETKPVISSGERPRRCVDLVALGLAFQGLLQLDGYI
                     PHAACINAAIRLLHLLKPSLTSSDLSIPSLDLVWRGLRCLADVPLAKEEEEEEEEDWP
                     ILVKPDVQSGIRQDLLPPTMYDTPPQEEEAESSDPPKRFTQYPPTFPSTLLPTPTPIT
                     PSSLSTFQSQSNSASLVHAIWRLPDVSAALQGLFSVCLQVITRSSSSTSSGQPTQLSH
                     HEDDDGEDDDDDFAVASGETTSAPLPEKAAELRASTSLLRSAVAFRLQGVMLVSAGAG
                     GGAQSKAYKDTQLVNSFLQADGLRAVEIGWAICEAMQKGWLRLGIDAVDLVVASLGNM
                     LNSYGYARDERLLQLCLEFLKCSAPVWMGNDHSNDDDLKDEAMRLVCYIATKITAGSI
                     TSWRVRLAMLRFIEAFLHYDSASKLWADCMVQEEAEEEEDDVSMEDENHLFHYIAQSL
                     SDPDMRVRARAATTAASALYRPSIHPSEHPIIYDQVSNSQAGDPTFAEHYLSYVLWKL
                     NCCIASAKQRQTVIFDLYEAAIGGTEYSDHLQAGLNAVARRLGLPSITALYLPYAPTT
                     TISHDTSRSSAITFVLNTTHRLFGLSNRSAFFTACLEHAGAYMLYCGKIGLFTSACDA
                     AGVLPEDLALQLSVAAAAMAMALPLSNDKATNVSMNKCKAEALALLSSFPGISGPDAA
                     EEFLHSYANGVAAHLWELMDLESSVDEIVAWFDKTEKESAAGIAFAQMMAHDNAKTGR
                     VKAINPAASFQSIHNVCRFLEKNYSSISLHAFTFAAILRLTSLINNAFLVSEQRRYLR
                     ALAMLLSVHQGTLQRPLIWEAFLTETITLLLQPDICRTVLSMVMWAFDWLESLSSTPS
                     KLVNIFCQLGEIRIELGGSGTPGSQPNQMGDALEDWIVKMSPKWFKSQISQEAFERAV
                     ALWPDSLRSRLSVHASPLSLRDLDDLSQNDAVHNAGQLCKHFLHLADADHGQDVVSVF
                     VDSTFWSLKDKISSVWDKEGINAFQDLLYLCNGEVRAPSLNFYGQDTFSKALNATTGE
                     HKKTEAMNALYHAMCKTMVQLLHDRRPQIRSAAYRCLQRMKPILTGKDLKELPADVSD
                     VVPILVPIPIGSVRQSQAMKLDGVINNATWNKKAEHFATWSLELSRLLCKTASQHDKF
                     FLSFEPLLSTPLLPLHHFLGHFVHAALVCSRSMSSERSKAISEHFETVLQNPFASIEA
                     VRSIVNIVLQLRRYEHPFTSGMLGYNAWLSVNFVDLSKAAVKCGLYVSALLFLELAND
                     QGESLDLAEPRVRQIMYDIYSNVEDPDGFYGIHNKDIRDSLRRRLEHEGLSWQALGWA
                     GAVYNVDGNDSRSAIPVLHHLHDIGLSRLASVVATETRTSGSVPLDDPFFADLSWRTG
                     DWNLPIGRESSATSSGLLYSALSAVHRSKSYESASKIVDKAVRAEMTRLGGLQKEMLT
                     SIQSTVTNLLCLRELNRWLDPQLQQGMQEVIDKGTLRDLQDINDKFEFASAERIIATR
                     LSVFDSVKQRESQDMIGDALTPKMELVTKAESTCHIKLSRLALKSNNLQAAINSLTAL
                     QKLQTYVGVIDEAQDVFCEVLWKQGEHTLAIQLLEDLLLREKEKKSKGQRIPALEGRL
                     AHWASEARLKAANEIFGMFSNVTKSIKRSTADVSEHAEIFYQFACFADKQYVSQSSSA
                     DVKQLKEYSKLRASQALRLSARQSRARESDQKDSAVREAERDEEKLKKFEMQQKQYLN
                     AALQFYAEAVSMSDNFNDCITRLVTLWLENDENEESNVTFSRAAHKVPSYKFIFLGPQ
                     LAARLHRPESPTIFNSTLNGLMFRMSQDHPYHTLYHVIPLLWEHKQPQSTNSSMLGRK
                     SAADDIMRRLASSASNRLAVGAAKSMKRFVAIAMEWTSFFEKDKRLEYKLPSDSPLRK
                     APRDIPVATSTPSIDVTCQYKDIATFDHFSEWYTRAGGLSRPKVMTCFDSNGQKYTQL
                     FKKDDGFRQDAVMEQIFVLVNDLLNRNRQTRSRKLRYRTYGVLALPEATGVIEFVVGT
                     KPLIKYLPPAHEKYHPKDITSHDFLKAMQEVQSVKNNDEKIIQVWTKLKKRFRPVMRH
                     LFTEKYRDPMAWFSMRLTYARSLAVTSIVGWVLEIGDRHCSNILMDECTGELVHIDFG
                     IAFGAGRILPIPELVPFRLTDDLVDALGVTGVNGTFRQCSQLVLQTLIDSSDVILTIL
                     EVFKQDPLHTWMVDDKMKKAQDGNHKMYPERGQEKADRIMRETRENLSKELSVQYRVN
                     QLIQEARDVNNLATIFRGWHSWL"
     STS             600208..600971
                     /locus_tag="CNF02070"
                     /standard_name="Pst1"
                     /db_xref="UniSTS:470835"
     STS             601317..601524
                     /locus_tag="CNF02070"
                     /standard_name="AAG37"
                     /db_xref="UniSTS:470836"
     gene            complement(608616..610023)
                     /locus_tag="CNF02080"
                     /db_xref="GeneID:3258095"
     mRNA            complement(join(608616..608822,608878..609016,
                     609071..609202,609263..609389,609440..609524,
                     609580..609733,609789..610023))
                     /locus_tag="CNF02080"
                     /product="proteasome component pts1, putative"
                     /transcript_id="XM_571562.2"
                     /db_xref="GeneID:3258095"
     CDS             complement(join(608725..608822,608878..609016,
                     609071..609202,609263..609389,609440..609524,
                     609580..609733,609789..609959))
                     /locus_tag="CNF02080"
                     /codon_start=1
                     /product="proteasome component pts1, putative"
                     /protein_id="XP_571562.1"
                     /db_xref="GeneID:3258095"
                     /translation="MNTLLQQVQQPSKLDTLAAAEDEFARSDHAAWGSMAGFGNLSRT
                     GSVSGMSVPRVHDPTSFLDIHTDSMSANPEAKIKIAHGTTTLAFRFKGGIIVAVDSRA
                     TAGSYVASGTVKKVIEINKFLLGTMAGGAADCQYWETYLGMQCRLHELRNKERISVAA
                     ASKILSNIVYQYKGMGLSMGTMVCGWDKTGPCIFYVDDDGQRLKGDLFSVGSGSTFAY
                     GVLDQGYKWDLSDEEAQELGRRSIVAAGHRDAFSGNTCNLYHVRQEGWEFIGNYDINE
                     LWYEYEGKKKAARQAAVGSPMAVEA"
     gene            610181..611180
                     /locus_tag="CNF02085"
                     /db_xref="GeneID:36392897"
     mRNA            join(610181..610338,610401..610431,610495..610584,
                     610641..610903,610958..611180)
                     /locus_tag="CNF02085"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658565.1"
                     /db_xref="GeneID:36392897"
     CDS             join(610292..610338,610401..610431,610495..610584,
                     610641..610862)
                     /locus_tag="CNF02085"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514493.1"
                     /db_xref="GeneID:36392897"
                     /translation="MVRSGLQQDVINLYRQGMRIALSKPAQVRPAFLLHLRYNFRNPP
                     LRQRDYVAIEHQLRKMSKTLEMLSDASVQRISVSNEMEAWWAEEVSRARGRDVDKKKE
                     KDQVKKTNTQGRDRDQFGGRLPGHGGT"
     gene            611216..612581
                     /locus_tag="CNF02090"
                     /db_xref="GeneID:3258254"
     mRNA            join(611216..611605,611662..611750,611809..611838,
                     611890..611993,612049..612247,612316..612581)
                     /locus_tag="CNF02090"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657388.1"
                     /db_xref="GeneID:3258254"
     CDS             join(611249..611605,611662..611750,611809..611838,
                     611890..611993,612049..612247,612316..612463)
                     /locus_tag="CNF02090"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513030.1"
                     /db_xref="GeneID:3258254"
                     /translation="MSLVSILTSLLKICCGSQEPTGPQQQQQQHQQYGYPGTVNQQQT
                     AYPPQSQPSWANVAAVGQQQQYQPQQHPQGWQSPMHQQQGGWQSPPHQNGYATGSPSP
                     VHLPAGGVVGPHAPASQHMNDDQINATNQHYVELRNKARKEGDEAHRCFAASQAAYQA
                     GDGAKAHELSVQGKAHQRTQDQLDDQASAWIFNENNKDSPAGTIDLHGLYVKEAIERT
                     EAAISGCQRQGREELRIIVGKGIHSQGGHAKIKPAVENLMRKYNLSAYIDPENTGVLV
                     VDLEGKQTGPRSRDIGGMVDSLGKADEGCTIM"
     gene            complement(613004..615110)
                     /locus_tag="CNF02100"
                     /db_xref="GeneID:3258355"
     mRNA            complement(join(613004..614260,614328..614572,
                     614714..615110))
                     /locus_tag="CNF02100"
                     /product="regulation of carbohydrate metabolism-related
                     protein, putative"
                     /transcript_id="XM_571330.2"
                     /db_xref="GeneID:3258355"
     CDS             complement(join(613048..614260,614328..614572,
                     614714..614737))
                     /locus_tag="CNF02100"
                     /codon_start=1
                     /product="regulation of carbohydrate metabolism-related
                     protein, putative"
                     /protein_id="XP_571330.1"
                     /db_xref="GeneID:3258355"
                     /translation="MAQIVPSITSLPVDSSAAPSVEDLQDRLPSICVDYLSHDWSEED
                     VWASWRNMTRHKHEIANGVRLENASWRTWQKQRNNLKTINPETLNWLKDSDVTWLYGP
                     LHTASVEPVRAPKVASTDERLGIDRPNPAAKKKTTKPILKHRTISEMLATSMPSSPVL
                     ESAVGEPVPATIASVSDRPKLPQTKSDTNVLQSQGVMPRNKSPPRHPNLREELPIDSP
                     ISPTESQQNANKKHISFNTFVEQCVAIEDPSQVPPQENKGPEVLEMKPAHERRESHGS
                     RPSLSRQSSSTSSAERLTISMLAPTTLKPGPGTNPDLQMVYVPPVEYQSPDRDDQRDA
                     YDFPSPEVDPRTGLEESEREYGQGDYLSPGSPATKERKGVPIPGRDGSPMQSKRQPSS
                     PQQGKAEPFSYSPSSSTSSFNVSSSPQPGRGILKTRTPSHEIPESESPPLAEFDYNPS
                     AATGIGGMRGSGSSYDYASGSASPLMAPEIVGGERGRAQSREH"
     gene            616832..619818
                     /locus_tag="CNF02110"
                     /db_xref="GeneID:3258086"
     mRNA            join(616832..616969,617079..617323,617425..618979,
                     619038..619818)
                     /locus_tag="CNF02110"
                     /product="regulation of carbohydrate metabolism-related
                     protein, putative"
                     /transcript_id="XM_571332.1"
                     /db_xref="GeneID:3258086"
     CDS             join(616946..616969,617079..617323,617425..618979,
                     619038..619463)
                     /locus_tag="CNF02110"
                     /codon_start=1
                     /product="regulation of carbohydrate metabolism-related
                     protein, putative"
                     /protein_id="XP_571332.1"
                     /db_xref="GeneID:3258086"
                     /translation="MAQVIPPITSLPSDSGAAPSVEDIQDRLPSICVDYLSHDWSEED
                     VWASWRNMTRHKHEIANGVRLENASWRTWQKQRNKLKTISPETLNWLKDSDVTWLYGP
                     LHTANVEPARPLRIASTDDRLGIDGPDSRISVKKPILKHRTLSEMLTIPMPSSPVLEH
                     VSTDGSSETSGDDDDRPNLLQTKSDTNIFRTRGVMPRRRSPPRYHNLGKTPPELPVLS
                     PSTESQTTSGKRHISFNTFVEQCVAVDDPSQNQQQNDSDDDVLEMKPSSMGSRSSRTS
                     RPSLSRASSSGSEHITIAKIAPTMLKTGPGVNHTLQMVYAPPAEYQSPGYDNLSSYDF
                     PSPQVEAAINRWQTDDEGYGSVGYDYFNGPDFSGNVDKSSIPIPAHVGTSYGGGRPSP
                     NKYRPAASSPQQSFEPSSVSSSNSSSSVNVASPVQPGRGILKTRPPDQAFSPESSSPP
                     SAYFNYNPSAATGIGSMRGSSVAYEYPVASGSPVTSPGVGIEERGRGRTPSRERLHDR
                     STSRGTSSGSTSSKSPTEIAASHSSSRKIQTPPQLDKVQEETRHIEPEERVDGNHTPQ
                     ASQSAVIGKSTSASVDSFKLSEEDKDYIPDRSSTPTPHSSPQIAFRPLKDTSPASLPH
                     TSATPRPSSSRSDFPEVDPPTTVPSSYKSNAGARATIAHVGTNAQPTLFQPTEDDDGA
                     SIMGRAANIASTAKDLLGALWYGANDGQGDDSQYNWQDQTQGGQRHGTDGTQGKSPFH
                     KRSGSGAQS"
     gene            complement(619804..622457)
                     /locus_tag="CNF02120"
                     /db_xref="GeneID:3258197"
     mRNA            complement(join(619804..619992,620053..620305,
                     620355..620584,620635..620647,620706..620777,
                     620828..620861,620907..620981,621043..621048,
                     621112..621254,621312..621370,621424..621471,
                     621522..621573,621625..621711,621768..621842,
                     621897..622003,622077..622097,622153..622457))
                     /locus_tag="CNF02120"
                     /product="expressed protein"
                     /transcript_id="XM_024657389.1"
                     /db_xref="GeneID:3258197"
     CDS             complement(join(619889..619992,620053..620305,
                     620355..620584,620635..620647,620706..620777,
                     620828..620861,620907..620981,621043..621048,
                     621112..621254,621312..621370,621424..621471,
                     621522..621573,621625..621711,621768..621842,
                     621897..622003,622077..622097,622153..622258))
                     /locus_tag="CNF02120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513095.1"
                     /db_xref="GeneID:3258197"
                     /translation="MGLTQSTMSSNQPGRGFLKVSGKDITLDGKPITLRGTAIGGWLN
                     MENFITGYAGHEHQVRHALKQVLGTEKYNYFFEKFLEYFFAEDDAKFFASLGLNCIRI
                     PVNYHHFEDDMNPRVFKKDGLKHLDRVIQICAKYGIYTVIDLHAAPGGQNFDWHSDNP
                     THKALFYEHKDFQDRTVFIWENLARHSKDNTWVAGYNPLNEPSDEQHVRLVAFYNRVE
                     KAIRSIDSNHMLFLDGNTFAADFSRFGKPLHNCVYACHDYSIYGFPNPPSLYEGSKEQ
                     IQFHIDSFNGKTEYMRKHGSPVWVGEFGPVYQTSKDGYPDWKHINDTRFDVLQLQLDI
                     YAKARASWSIWLYKDIGFQGMIYAGEDTAYVKLLKEFLHKKKVVAADKWGADDRAVRP
                     LFTPVESWLLKTVPSISDRYPQDWSVGEHLSRLVRNMLLSEELVKEYAEHFRGKSLEE
                     LDELAKSFKFSNCTQRKRLNDVLKSDSERGTDEKKSLWQAGEKV"
     gene            622657..624223
                     /locus_tag="CNF02130"
                     /db_xref="GeneID:3258281"
     mRNA            join(622657..622779,622850..622858,622910..622982,
                     623038..623051,623107..623176,623241..623325,
                     623377..623388,623455..623520,623579..623672,
                     623730..623744,623818..623874,623927..624223)
                     /locus_tag="CNF02130"
                     /product="ubiquitin-conjugating enzyme E2-28.4KD,
                     putative"
                     /transcript_id="XM_024657390.1"
                     /db_xref="GeneID:3258281"
     CDS             join(622753..622779,622850..622858,622910..622982,
                     623038..623051,623107..623176,623241..623325,
                     623377..623388,623455..623520,623579..623672,
                     623730..623744,623818..623874,623927..624172)
                     /locus_tag="CNF02130"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2-28.4KD,
                     putative"
                     /protein_id="XP_024513089.1"
                     /db_xref="GeneID:3258281"
                     /translation="MATKVAQKRLQKEYLSMQKSPPPFIWACPEEKNILDWHFIIRGP
                     PDTPYEGGEYHGLIWFPSDYPFKPPDVKLFTPSGRFEVGHKICMSMTSYHPSTWNAAW
                     SVATILTGLLSFMLSNEITAGAVKSTNEEKRLLAKQSHAFNLKSKKFREIFPDYATPE
                     MTDLPDMGGPAASSASKVSEPVNTSAAPNSSSPTNIPVAVPLAQLTQTTHTPHAQARP
                     EQRVQRHAAGNWLFSWRWVVAVVVLAILGRLSSFAGL"
     gene            complement(623714..625530)
                     /locus_tag="CNF02140"
                     /db_xref="GeneID:3258258"
     mRNA            complement(join(623714..624433,624487..624623,
                     624684..624800,624862..624974,625070..625530))
                     /locus_tag="CNF02140"
                     /product="30s ribosomal protein s5, putative"
                     /transcript_id="XM_571558.2"
                     /db_xref="GeneID:3258258"
     CDS             complement(join(624296..624433,624487..624623,
                     624684..624800,624862..624974,625070..625494))
                     /locus_tag="CNF02140"
                     /codon_start=1
                     /product="30s ribosomal protein s5, putative"
                     /protein_id="XP_571558.1"
                     /db_xref="GeneID:3258258"
                     /translation="MAPALARPLRSLNPAARRLARCASTAAPQSSSAPPPPSDPQSSQ
                     HTPLPRPAFSVPYTPVPRLSGFPNSFKSPSHKHYNYPTPLFNSPPTEKMPDTLAEQSQ
                     AKKETKLAAVSGLSREELRNLCRFTVRSTKVQHMTKKGKMASQQAYVVVGHPEKGLVG
                     LGRGRGHNHAAAQDDGFQKAVLNMDYVNRYEERTLWGEGKDLQGKWGAAKVHLRARPP
                     GFGLMVPPMIHRVFTACGIKDASAMIVGSRNRPDVLKATIQVLHGGGNPSGFGTGIFG
                     KKGPRENKGRGMRSKDEIERERGRYGVDVGRRI"
     gene            complement(625907..627477)
                     /locus_tag="CNF02145"
                     /db_xref="GeneID:36392898"
     mRNA            complement(join(625907..626381,626440..627477))
                     /locus_tag="CNF02145"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658566.1"
                     /db_xref="GeneID:36392898"
     CDS             complement(join(626010..626381,626440..627393))
                     /locus_tag="CNF02145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514494.1"
                     /db_xref="GeneID:36392898"
                     /translation="MDTPQQPILRRRPKRPSYAPTALPIVPSSSTYTGNTQQAMSPSL
                     YRTSIRSASLQLDTVATPQRLRDLEMEWKNRRKMALADISNGYGGNSHQQQYGPRQTT
                     TIDKLDIKPIDRQHGPSLKPAKNGPRLPTDAGHTQSSQSKSTAARPNLIRCVEPPTPP
                     DTPSTSITQLKLDQIVRDSVPSLTRPLEPSKRLATKHKTELIPNIETRIRNPFAALPI
                     LASPLPTTTRPVPLIHPHKGAIHVRPSKFSEFDIILTHDELLRIIGGGMELIWMRGTS
                     DDTSSFRKHLKLWDSAKWTDEEANLWYRVQLIVENLKRKTPQARIYHSLGNITVMCCK
                     PPDIVISFRFPSPYNKLSSTNISSSTIKVRLCYSRISKEIRLHTSYAKASHSEKSEER
                     LRTKRIVPLTSNGDIDVACGTNHTEDWRDEEKEGLKRLWDTKREWEKWC"
     gene            627735..628740
                     /locus_tag="CNF02150"
                     /db_xref="GeneID:3258469"
     mRNA            join(627735..627790,627912..628070,628227..628382,
                     628449..628740)
                     /locus_tag="CNF02150"
                     /product="ribosomal protein P2, putative"
                     /transcript_id="XM_571539.1"
                     /db_xref="GeneID:3258469"
     CDS             join(627912..628070,628227..628382,628449..628469)
                     /locus_tag="CNF02150"
                     /codon_start=1
                     /product="ribosomal protein P2, putative"
                     /protein_id="XP_571539.1"
                     /db_xref="GeneID:3258469"
                     /translation="MKLIAAYLLLQQGGNASPSAADIKALLETVGVEAEEDRLSKLIS
                     ELEGKDINELIAEGSSKLASVPSGGAAPAAAAGGAAAGGAAEAAPAEEKKEEAKEESD
                     DDMGFGLFD"
     gene            complement(629020..629966)
                     /locus_tag="CNF02160"
                     /db_xref="GeneID:3258386"
     mRNA            complement(join(629020..629167,629218..629237,
                     629292..629309,629387..629563,629630..629649,
                     629720..629966))
                     /locus_tag="CNF02160"
                     /product="protein kinase activator, putative"
                     /transcript_id="XM_024657391.1"
                     /db_xref="GeneID:3258386"
     CDS             complement(join(629135..629167,629218..629237,
                     629292..629309,629387..629563,629630..629649,
                     629720..629766))
                     /locus_tag="CNF02160"
                     /codon_start=1
                     /product="protein kinase activator, putative"
                     /protein_id="XP_024513094.1"
                     /db_xref="GeneID:3258386"
                     /translation="MAPGKQPATLEELSERIIYSDRYSDDRFEYRHVILPKQMLKLIP
                     KRYFASDDSGLLRILEEDEWRGIGITQSLGWEHFEVHAPEPHILLFRRPLPGSNANAK
                     RQ"
     gene            630105..633124
                     /locus_tag="CNF02170"
                     /pseudo
                     /db_xref="GeneID:36392899"
     gene            633460..641287
                     /locus_tag="CNF02180"
                     /db_xref="GeneID:3258139"
     mRNA            join(633460..633719,633982..634064,634116..634381,
                     634428..634819,634873..639392,639443..639533,
                     639583..639768,639825..640307,640369..640560,
                     640613..640719,640774..640973,641025..641287)
                     /locus_tag="CNF02180"
                     /product="acetyl-CoA carboxylase, putative"
                     /transcript_id="XM_571316.1"
                     /db_xref="GeneID:3258139"
     CDS             join(633638..633719,633982..634064,634116..634381,
                     634428..634819,634873..639392,639443..639533,
                     639583..639768,639825..640307,640369..640560,
                     640613..640719,640774..640973,641025..641136)
                     /locus_tag="CNF02180"
                     /codon_start=1
                     /product="acetyl-CoA carboxylase, putative"
                     /protein_id="XP_571316.1"
                     /db_xref="GeneID:3258139"
                     /translation="MSSATPNGSAVNGQSDIYDHSKVAQFIGANSVESAPSGRVTDFV
                     KAHNGHTVITKVLIANNGIAAVKEIRSIRKWSYETFGSDRQIEFTVMATPEDLRINAE
                     YIRMADRYVEVPGGSNNNNYANVDFIVDVAERAGVHAVWAGWGHASENPRLPETLAKS
                     KIIFIGPPGSAMRSLGDKISSTIVAQHAKVPCMPWSGTGISDTILSPQGFVTVPDKAY
                     DDACVHSWEEGLERAEKIGFPIMIKASEGGGGKGIRKVEDGEKFKNSFQAVAGEVPGS
                     PIFIMKLAGSARHLEVQLIADQYGNAISLFGRDCSVQRRHQKIIEEAPVTIAKPETFE
                     EMEKAAVRLAKLVGYVSAGTVEYLYSHSDDSFYFLELNPRLQVEHPTTEMVSGCNIPA
                     VQLQIAMGIPLHRIRDIRTLYGMDPHGITEIDFDGSKPESVNTQRKPTPKGHVIACRI
                     TGENPDAGFKPSSGNLTELNFRSNSNVWGYFSVSSAGGLHEYADSQFGHIFAYGMERS
                     EARKSMVVALKELSIRGEFRTTVEYLIKLLEKPEFENNTLTTQWLDGLIAEGMTSERP
                     DPVVAVVCGAVVKAYIAYEASLAKYKSVLDKGQVPPKDSLQTFFKSEFIYENVRYSFA
                     MAKSSAYSFTLYLNGGRIFVGCRGLSDGGLLISLSGATHTVYFREEVGAMVLSVDSKT
                     TLIEDEQDPSQLRSPSPGKLVRYLIDSGDHVDAGDAYAEIEVMKMIMSVTASESGIAQ
                     FMKQPGQTLASGELLGILTLDDPTKVKFAKPFEGILPTFELKNGRYGTKPHQRLREHL
                     EVLYDNLSGYDNSASVLSSLRIVETALRDADLPYSNAQGVMSTLSGRIPQKLEDEIRS
                     ILDSCRAGRFEFPSRKLQHTIDVFVEENVLPKERPQVIAAISPLKVLIDAFAHGLKVH
                     EWQTWADLLSFFADVEEPFADTTRTQENVILKLRDDCKDLDQVVNLVLSHSKIALKTK
                     LVLALLDVIKSESPRASMTPESRVNDALSRLAALDSRPTAKVALKAKEVMIVGSLPSY
                     EERLGQLEKLLSAAVTTSYYGQQGSGHRLPSADVLKEVTDSRYTVFDVLTTFFDHDDP
                     WVALAALEVYVRRAYRVYNVLHLDYEAGEKGGEPHIITWRFKLGGHQSEPATPRVDST
                     KDFTRIASMSDLSYVVTTKTEPVRFGLMTSYNDLASLEQSFAKLLSIYPAFSHAEHIE
                     KFGKDARHPHVMNVALRLFNGEQMSDIELNERFHALANQYAAEINGKGIRRISFVICR
                     KDQYPAYVTLRESVEGYWKEEEAIRDIEPALAYQLELGRLSNFKITPQPSSNRQIHVY
                     HAVGRENTSDVRFFVRALLRPGRFQGNMQVKEYLISETDRLVGDILDTLEVVSSQHRQ
                     ADCNHIMVNCVYNLNVTFDDIQEALAGFIERHGKRLWRLRVTQAEIRVVIEDEEGNVL
                     PIRSFIENVSGFVVKYEAYQEIDNDKGKSILKSIGENGQFHLQPVNFPYSTKESLQPR
                     RYQAHVIGTTYVYDFPDLFRQATDKAWHNLQTYLPNIKIPSDLLTATELIFDEHGELQ
                     EVNRAPGLNTCGMVAWVYTLKTPEYPQGRRVVVISNDITYQIGSFGPIEDEFFYKATQ
                     YARKHGLPRIYLSANSGARIGLAEEVMALFDVAWREAGKPEKGFDYLYLTPANLDKLN
                     DMGPGSVITDEIEVDGERRHKIVSVIGLKDGLGVECLRGSGLIAGETSRAYDDIFTIS
                     MVTARSVGIGAYLVRLGQRVVQVEGQPIILTGAQAINKVLGKEVYTSNIQLGGPQIMY
                     KNGISHLTAGSDLDGALQIINYLMFIPEQRGRAIPILPTGDHWDRAVEWKPTKAAYDP
                     RNFLSGCSEDIDGVQSWKSGILDNGSFFETMGGWAQTIVTGRGRISGIPVAVIAAETR
                     SIERVDPADPANENSQESRVSLAGTVWFPDSSRKTATAIEDANREGLPLVIFANFRGF
                     SGGMSDMAQAILKEGAKIVDGLSSYKHPVIVYLVPNGELRGGAWVVLDPSINPEHMTM
                     FVDNESRGGVLEPEGIVEVKYRKPKVQATMARLDEEYARLKKEVENPNASPEEKTAAT
                     AKLEAREKHLGPAYQSIALEFADLHDRSGRMKAKADCIPCDWENSRRAIYWSLRRKLS
                     ETRILKKLENANPRLTYPERKELLQQFIPIELSSDSEVAAYIEKSGEAIESFIQGVRD
                     EWCSDTLVSWAGTNQEGVMSGFKRILEGLSAEQKAQVLAELGMQGQA"
     gene            complement(641267..642280)
                     /locus_tag="CNF02190"
                     /db_xref="GeneID:3258379"
     mRNA            complement(join(641267..641577,641629..641721,
                     641787..641860,641942..641952,642014..642280))
                     /locus_tag="CNF02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657392.1"
                     /db_xref="GeneID:3258379"
     CDS             complement(join(641336..641577,641629..641721,
                     641787..641860,641942..641952,642014..642214))
                     /locus_tag="CNF02190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513142.1"
                     /db_xref="GeneID:3258379"
                     /translation="MSDSAQRSFRSQLSSFRWANSVQDDSQPAPPPSTSNPFSRAWNS
                     MSGYIPLRNEGNSQEEEAYFALSRWERFIGFLACCAGGIACFGIAFLFLPILAIKPRK
                     FALAFTLGSCLFMLGFAILHGPWNHFKHILSPERIPFSLCYFGSLGLTLFFAIGIRST
                     IGTLLASIIQVVALLSYVIAYFPGGMTTLRLGGQMAMRGAGNLLPI"
     gene            complement(642786..642881)
                     /locus_tag="CNF02200"
                     /db_xref="GeneID:3258332"
     tRNA            complement(642786..642881)
                     /locus_tag="CNF02200"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3258332"
     gene            complement(643006..644568)
                     /locus_tag="CNF02210"
                     /db_xref="GeneID:3258155"
     mRNA            complement(join(643006..643811,643865..643959,
                     644019..644279,644330..644568))
                     /locus_tag="CNF02210"
                     /product="expressed protein"
                     /transcript_id="XM_571318.2"
                     /db_xref="GeneID:3258155"
     CDS             complement(join(643153..643811,643865..643959,
                     644019..644279,644330..644361))
                     /locus_tag="CNF02210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571318.1"
                     /db_xref="GeneID:3258155"
                     /translation="MGVQNKDIRINWDSEPRLTNHLVNLIAANSRYSACIFGSNTGDR
                     WLIERELCLEVLKQEPWMRDKEVQGWVRRSANGWEATDKWTSGMVHPVRNRLHLLVKR
                     MKEGWYKSKYAIDPEWSREEQVPEVTRVTLGRDHPYYFTLRSLWLKNQHPVSASTPAT
                     VQSSHEQNKCKQRTASTSRYWPSAKNANHLEGLHKQKIQGDASQMMAECFSDPEGEQE
                     RSPKRPRIDASDRSYEGNPDEEAVVEDTLAESPHPADEPDSREREGMGTPKGSNRHRV
                     QEGFGVENSVASRPTPSSEKRPRGRPKGSLNKKGKKIEVHNEGREMPKPLDGEPVKRG
                     RGRPKGSTNKRKQY"
     gene            complement(645884..647273)
                     /locus_tag="CNF02220"
                     /db_xref="GeneID:3258175"
     mRNA            complement(join(645884..646305,646368..646388,
                     646453..646806,646867..647108,647156..647273))
                     /locus_tag="CNF02220"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_571320.2"
                     /db_xref="GeneID:3258175"
     CDS             complement(join(646300..646305,646368..646388,
                     646453..646806,646867..647108,647156..647219))
                     /locus_tag="CNF02220"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_571320.2"
                     /db_xref="GeneID:3258175"
                     /translation="MAISHLLAQPMTSRTGAMLTMSLTRPVRLPLAFSIARNTRSFYA
                     TPKRCISHFDTYLFVEKLEKNGMTREQAEGVMSVLAEVIEESIKGMEASLVSKAEQEK
                     QRYTEKVDFARLKSELQLHEKNDLTLMKAENDRLMADVEKLKQRLREEVTRTQAGVRL
                     DLNLEKGRIRDESSQQELKIKEVDTRIESEIAGLRTQIEQAKFSILQYLVGVATGSGA
                     LLLAYMRMMR"
     gene            647387..648976
                     /locus_tag="CNF02230"
                     /db_xref="GeneID:3258399"
     mRNA            join(647387..647478,647542..647576,647624..647644,
                     647701..647810,647872..647975,648030..648142,
                     648198..648537,648590..648976)
                     /locus_tag="CNF02230"
                     /product="Glutathione S-transferase 6, putative"
                     /transcript_id="XM_571543.2"
                     /db_xref="GeneID:3258399"
     CDS             join(647473..647478,647542..647576,647624..647644,
                     647701..647810,647872..647975,648030..648142,
                     648198..648537,648590..648892)
                     /locus_tag="CNF02230"
                     /codon_start=1
                     /product="Glutathione S-transferase 6, putative"
                     /protein_id="XP_571543.1"
                     /db_xref="GeneID:3258399"
                     /translation="MQSDDVIWSVINHQFCSYKVKTPTQNFCRNEYNLTGFCTRQSCP
                     LANSRYATVREKEGVLYLYVKTIERAHTPANMWERIKLSSNYTKALEQIDKELIYWPN
                     FVTHKCKQRITKITQYLIKMRRLSMTQQPKKVGIKKKLERREATRERKALAAAHLEKN
                     IEKELLERLRSKAYGDAPLNVNEDVWQQILDMDKKGKDRELELEDDESMDEEEEEEWE
                     GGEREYVEDTDDESVGDLEDYSGSEFDEFDSEEEGSEGQEFPSDLEISDEEDQGEDDA
                     SEPSSPQPPSKSSKSAPGPSALAGTKRKAPPKTGKSGAAKKAGRKPRVDVEYEMETEP
                     LSREMLKNW"
     gene            complement(649036..651850)
                     /locus_tag="CNF02240"
                     /db_xref="GeneID:3258185"
     mRNA            complement(join(649036..650870,650922..651155,
                     651203..651702,651748..651850))
                     /locus_tag="CNF02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657393.1"
                     /db_xref="GeneID:3258185"
     CDS             complement(join(649335..650870,650922..651155,
                     651203..651702,651748..651787))
                     /locus_tag="CNF02240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513027.1"
                     /db_xref="GeneID:3258185"
                     /translation="MPHMPSIAPKHNHTSHTSPLNPAQPSPTARYPPLPRNQPSTSKS
                     ATRPRTKASNQRSIFSDSDSELSPPSSEEDDNEAEAEENEQYEEVVTPRKGQHKGRVA
                     QNNVANVEKSGQKKTASQNKKGKKVVGKKKSHSVEVVTKTTTTGPAGREKKRSIKLED
                     AERRRARDAKFDVDDDFGNTTPTPALNHGRTVPPEDSTSSYGDDESDRGELTEDDQLL
                     AGIPEAFLGQEVEDLAYGAGDMDTEMMTFWDDETDEEEEEMFINHLSGSEVDRLSQSS
                     VSVDSDQSTSESESDSEEVLDEFGFPIPSCSHFPIDDTESGEDPGLILMENWDGQFVL
                     VQPRLERSRSRHRNDRGSRTGGSVNGSTTSANDQALLIDPDAADHEFSSDDSYWSGMS
                     DEDDDGGDTTDSMAEEDMPVLDSPALNGMMEHQMAEAVLRMVVDGDIPVVLPEAANTN
                     MASAVQPSIVVTEVEDSTPALSTTSSAPPTNTLPDTPAPLPTPSSSTDSTAPPPPQGP
                     VMGTFIPVTGDPAQHAVIDGSGMTTKSPFTHRRRSRRNRDAASLSSSKEDKERRRRSS
                     ANDPFSPTFSPSANALSAKSKRLRYSSIPGHPRYVAARRAAEAVAMAEEDRATTTSED
                     EAADGAVGGFELEDMLEEAVLLDPSAEGQEEMDGEGLRHMLRFDRVGVSTYLRRNFGA
                     PNPVATLAPPGRGKPPPYNYNYTVGGYPSPGNTRLDDTLAGPIGGRMLVSPVLTAMEE
                     VEGTAQARKEKKKRRKAQYAATTVPELII"
     gene            complement(652015..652660)
                     /locus_tag="CNF02245"
                     /db_xref="GeneID:36392900"
     mRNA            complement(join(652015..652064,652117..652660))
                     /locus_tag="CNF02245"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658567.1"
                     /db_xref="GeneID:36392900"
     CDS             complement(652131..652448)
                     /locus_tag="CNF02245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514495.1"
                     /db_xref="GeneID:36392900"
                     /translation="MSNLSRSSLANDIALLRSVPASSLPLSSVQAEPSGSRTPLEVLQ
                     AFSPSTATSQTSQDLSKAYIKEMNGIKKVYERKEGEEVGERIDGLRARGEEIQEVLRD
                     IKA"
     gene            complement(653044..656584)
                     /locus_tag="CNF02250"
                     /db_xref="GeneID:3258509"
     mRNA            complement(join(653044..653223,653274..653321,
                     653382..653738,653803..654014,654163..655423,
                     655481..655759,655807..655894,655948..656058,
                     656121..656251,656326..656563))
                     /locus_tag="CNF02250"
                     /product="arg-6 protein, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_571553.2"
                     /db_xref="GeneID:3258509"
     CDS             complement(join(653164..653223,653274..653321,
                     653382..653738,653803..654014,654163..655423,
                     655481..655759,655807..655894,655948..656058,
                     656121..656251,656326..656553))
                     /locus_tag="CNF02250"
                     /codon_start=1
                     /product="arg-6 protein, mitochondrial precursor,
                     putative"
                     /protein_id="XP_571553.1"
                     /db_xref="GeneID:3258509"
                     /translation="MLRRSHIPRAALNINRAPAARAFTKPSLPLSASSQLTKKDSSNV
                     LFEFDAHKVGNEIRKRGLGNLLGVQREGGMDRDTIIRLLYSLGSRHEVERYLRIFTQS
                     SRASPGGVLPEAKFAVLKIGGAILSNELDDLALSLSFLNRLGLFPVVLHGAGPQLNEI
                     LESEGVIPDYEDGIRITDAKTLAIARRVFLQENLKLTTALERLGTRARPIPTGVFTAD
                     YLDKSKYGLVGKITRVDKAPIEAAIKAGCLPILTSLAENAEGQILNVNADVAAGELAR
                     VLEPMKIVYLNEKGGLFHGVTGKKISTINLDEEYDALMKESWVKFGTKLKIREIKELL
                     DTLPRTSSVAIISTDMLQKELFTDAGAGTLIRRGYKLYKQPSVEAVGSTQLRQVFTER
                     DPEVESGRKSVAEIFSELKNSPHTIYGDEPFDVVAVVSHPAGETPVMTKFLPSRNGIL
                     NKIVDNVFDAIKKDHKRLFWTAKADDENRAWHFERADGSFTRAGRSLFWYGVPNVKEV
                     ERIIEGFEENGRIERVFLPVGPSVPPHRRAAAAPAAGATPAGARAFSTSTRPHLAGTS
                     NTGARGYATVADAAPRKRVALIGARGYTGQNLISLIDNHPHLDLTHVSSRELAGLPLK
                     DYKKSAVNYSNLSVEDVGKMAEANEVDAWVMALPNGVCKPFVDAIDKASKKGGKSVIV
                     DLSADYRFENDWTYGLPELYGRDHVKQANRVSNPGCYATNTQLLLAPLMPHLDKVQMP
                     SVFGVSGFSGAGTKSGEKDAEGRPKTVPKISAEDLKGGIRPYSLTDHIHEREASRHLS
                     SLIPSSTNPFSLAFIPNVAPWFSGILSVLTAPLDKSMRASEIIELYEEKYGKEPLIQV
                     QKTVPDVTEVMGKHGWRVGGVQVHSSGKRVVVVGALDNLLKGAATQAMQNLNLALGYE
                     ELAGVPTDKF"
     mRNA            complement(join(654058..655423,655481..655759,
                     655807..655894,655948..656058,656121..656251,
                     656326..656584))
                     /locus_tag="CNF02250"
                     /product="arg-6 protein, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_571554.2"
                     /db_xref="GeneID:3258509"
     CDS             complement(join(654140..655423,655481..655759,
                     655807..655894,655948..656058,656121..656251,
                     656326..656553))
                     /locus_tag="CNF02250"
                     /codon_start=1
                     /product="arg-6 protein, mitochondrial precursor,
                     putative"
                     /protein_id="XP_571554.1"
                     /db_xref="GeneID:3258509"
                     /translation="MLRRSHIPRAALNINRAPAARAFTKPSLPLSASSQLTKKDSSNV
                     LFEFDAHKVGNEIRKRGLGNLLGVQREGGMDRDTIIRLLYSLGSRHEVERYLRIFTQS
                     SRASPGGVLPEAKFAVLKIGGAILSNELDDLALSLSFLNRLGLFPVVLHGAGPQLNEI
                     LESEGVIPDYEDGIRITDAKTLAIARRVFLQENLKLTTALERLGTRARPIPTGVFTAD
                     YLDKSKYGLVGKITRVDKAPIEAAIKAGCLPILTSLAENAEGQILNVNADVAAGELAR
                     VLEPMKIVYLNEKGGLFHGVTGKKISTINLDEEYDALMKESWVKFGTKLKIREIKELL
                     DTLPRTSSVAIISTDMLQKELFTDAGAGTLIRRGYKLYKQPSVEAVGSTQLRQVFTER
                     DPEVESGRKSVAEIFSELKNSPHTIYGDEPFDVVAVVSHPAGETPVMTKFLPSRNGIL
                     NKIVDNVFDAIKKDHKRLFWTAKADDENRAWHFERADGSFTRAGRSLFWYGVPNVKEV
                     ERIIEGFEENGRIERVFLPVGPSVPPHRRAAAAPAAGATPAGARAFSTSTRPHLAGTS
                     NTGARGYATVADAAPRKRVALIGARGYTGQNLISLIDNHPHLDLTHVSSRELAGLPLK
                     DYKKSAVNYSNLSVEDVGKMAEANEVDAWVMALPNGVCKPFVDAIDKASKKGGKSVIV
                     DLSADYRFENDWTYGLPGEKAVSL"
     gene            656769..659800
                     /locus_tag="CNF02260"
                     /db_xref="GeneID:3258178"
     mRNA            join(656769..657403,657457..657524,657588..657598,
                     657646..658239,658288..658445,658496..658576,
                     658626..658688,658743..658868,658918..659014,
                     659069..659245,659299..659496,659550..659800)
                     /locus_tag="CNF02260"
                     /product="kinesin, putative"
                     /transcript_id="XM_024657394.1"
                     /db_xref="GeneID:3258178"
     CDS             join(656795..657403,657457..657524,657588..657598,
                     657646..658239,658288..658445,658496..658576,
                     658626..658688,658743..658868,658918..659014,
                     659069..659245,659299..659496,659550..659686)
                     /locus_tag="CNF02260"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_024513090.1"
                     /db_xref="GeneID:3258178"
                     /translation="MEQENNPPPLSRLPRLASPIKPSSIPVPSAASSIPHMPPLTSDN
                     NANTGISKRKMPSSPMHPPVAKRSVSGGAPPISASALGKSTMGAAASAGLRTSQRKNT
                     SGGFVPKPKALATRPGTSLGVSTRRTAGSAGSTTSASSSEASVRPTATRSRSGLAPPA
                     RPPTAAGTSRTGTMTRAGSALGRSAGPTTRLGARVPAVSGAVKDHDGRLENVEMMLGN
                     FHHLFEAEQAKISTLQSSQESLQALLQSTQTTERAARLDLTSASEEIAALRSSHAREV
                     DELERTIARKEREKINLEDELRDGRDELSRERDTVRALKVQLAEQSTKHLTLEAQLSA
                     SQTQLTNLQSEVERATLAVSAMKAELQVGQDRARDAEMKAEKKVREAEEERDRRIAEI
                     EEELRTAETIRRKLHNQVQELKGNIRVFARVRPVLPHELSNPEGVADIAYGDERTAQE
                     TGQSQIVVTSRSESAMGKEREQINQFTFDKIFAPQAGQKEVFEEISMLAQSVLDGYNV
                     CIFAYGQTGSGKSWTMEGAQDEENAGLIPRAIDMIFKVSGQLKDRGWKYQMEGQFLEV
                     YNEVINDLLGNGQFDTKRHEIKLDKDGKISVTEAVSVPLSNPKQVHTLLERAQSRRAV
                     AATLMNERSSRSHSVFTLKVKGVNPLTDEKCEAMLNLVDLAGSERIEKSGAGENKDRL
                     KEAININKSLSALADVIGALGQGQQGGHVPYRNSTLTRLLQTSLSGSSKTLMLCNLSP
                     LATHLGETLCSLRFATKVNTTQVGQAKKAISR"
     gene            complement(659774..660589)
                     /locus_tag="CNF02270"
                     /db_xref="GeneID:3258459"
     mRNA            complement(join(659774..660445,660491..660589))
                     /locus_tag="CNF02270"
                     /product="expressed protein"
                     /transcript_id="XM_571324.2"
                     /db_xref="GeneID:3258459"
     CDS             complement(join(659820..660445,660491..660515))
                     /locus_tag="CNF02270"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571324.2"
                     /db_xref="GeneID:3258459"
                     /translation="MPRPSISTALARLSIRSLQTSAPLPPPATSLPPSSSVTPIPNLP
                     PLLPSATPSTLPSSTSDALALIKSQSTPSTGRYILARLHARTYLLHPRDILTLPTLKP
                     LQAPGSTLSLTKILEVGSREYSLRSPAAQAKELKKGLTWKEKKTAEFATIPPEVVRCE
                     LTVLEHTKSPMERLLKKKRRKGYKKTIEHKQGWTRLRVGDILLGEGNVVKPEGLQI"
     gene            661160..663549
                     /locus_tag="CNF02280"
                     /db_xref="GeneID:3258196"
     mRNA            join(661160..661278,661460..661514,661664..662127,
                     662179..662595,662651..662864,662915..663113,
                     663167..663265,663318..663549)
                     /locus_tag="CNF02280"
                     /product="ATP synthase alpha chain, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_571326.1"
                     /db_xref="GeneID:3258196"
     CDS             join(661231..661278,661460..661514,661664..662127,
                     662179..662595,662651..662864,662915..663113,
                     663167..663265,663318..663444)
                     /locus_tag="CNF02280"
                     /codon_start=1
                     /product="ATP synthase alpha chain, mitochondrial
                     precursor, putative"
                     /protein_id="XP_571326.1"
                     /db_xref="GeneID:3258196"
                     /translation="MRAAIRNSLRGAVAQTARARVAPLAVRTYATAKPAASEVSSILE
                     GRIAGASAGGDVQETGRVLTIGDGIARVYGLRNVQAEEMVEFSSGVRGMCLNLEADNV
                     GVTIFGNDRLIKEGDTVKRTGQIVDVPVGPGLLGRVVDALGNPIDGKGPIKADGRTKA
                     QLKAPGILPRRSVHEPMQTGLKSVDSLVPIGRGQRELIIGDRQTGKSALAVDTILNQK
                     KWNDGADESKKLYCVYVAVGQKRSTVAQLVKTLEENDAMKYTIIVAATASEAAPLQYL
                     APFSGCAMGEWFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHS
                     RLLERAAKMNADYGAGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLEAELFFKGV
                     RPAINVGLSVSRVGSAAQTKLMKSVAGSLKLYLAQYREVAAFAQFGSDLDASTRYLLN
                     RGARLTELLKQPQYSPMPTEVMAPLIYAGVNGMLDNVPVEKITAWEKSFTELLKSQHG
                     ALLEKLGGGVLTKEIEEEMKKIIDGHVADFLA"
     gene            complement(664425..667071)
                     /locus_tag="CNF02290"
                     /db_xref="GeneID:3258192"
     mRNA            complement(join(664425..665830,665886..666093,
                     666152..667071))
                     /locus_tag="CNF02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657395.1"
                     /db_xref="GeneID:3258192"
     CDS             complement(join(664589..665830,665886..666093,
                     666152..667038))
                     /locus_tag="CNF02290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513029.1"
                     /db_xref="GeneID:3258192"
                     /translation="MSQPAATARGDPGRASLRTSMRKGKGKMSETVLAGVEVPSLRRT
                     RSAKSKTQAKGPEDEQQDETLVSSPAKRTRGAKTNPVPERNEVTPRKRAKGARGKAMG
                     KAPKPDSDSDDEAAPRKKKVGAGSQASSDNKTNVARRKAAEKNDESITQASKRSRRSP
                     PLSSMSPLPPSPELNAETHKKAKTNPASSEYPLSGSQSNPSGPSRQKDTFHVEMNDLH
                     PTLEPQLNGRTKTKEKNRERKKREPSLALELSDVELDEQTLEAFIDFVDHLPEKKESE
                     EDAEGSDAEEEFVPTPLPQNLKINDFIFTKYPSGYYLSQLIAYHPAQSWRDQEEGKDY
                     CTVKDANGVVHEKIKLSDLITKDDERIATCKLGKFESVDYRGPEFKNDAHIRPPTPEP
                     EPRVASTSSLPTPSPTQLSQPPPMNPSVFIDLDRVEQLRLIRPHLQLILNEAYPPAQW
                     RIDKFFGSAHDRSALSHVVRYGDISDTEVDEVLVPELLRWSLRGDRWTRNEVNAGNRP
                     PEPPRPKGSERYNSLPLSETRNFVCDVLLPEAVIELCIRSIEKESLLDALKKQNKPVD
                     IDEEDIEEDMRALSDISSLSSDTDSEDENVPTGEEPAKQRPGSQETAVSAVASRSAAQ
                     SQVQASVIGTNPQSTLPASSSFCSDLLLGTQQPSLDTDALLVTQLQGDPSSSAQSVPE
                     AVSEEQQLYRGALQYLSDLSNSSATNIWETEEARFKYYRREMRKKLNLPEEGLSKEER
                     KKWEEEQAFNQLKDLMMGKKFQRKRMTKTRSFADMDSD"
     STS             666434..667239
                     /standard_name="Bam2"
                     /db_xref="UniSTS:470837"
     gene            667175..671661
                     /locus_tag="CNF02300"
                     /db_xref="GeneID:3258360"
     mRNA            join(667175..667273,667324..667345,667409..667459,
                     667510..667563,667632..667747,667804..667936,
                     667986..668062,668109..668276,668334..668501,
                     668552..668947,668998..669230,669289..669433,
                     669492..671019,671080..671091,671147..671453,
                     671508..671661)
                     /locus_tag="CNF02300"
                     /product="Bromodomain and PHD finger-containing protein 3,
                     putative"
                     /transcript_id="XM_024657396.1"
                     /db_xref="GeneID:3258360"
     CDS             join(667190..667273,667324..667345,667409..667459,
                     667510..667563,667632..667747,667804..667936,
                     667986..668062,668109..668276,668334..668501,
                     668552..668947,668998..669230,669289..669433,
                     669492..671019,671080..671091,671147..671453,
                     671508..671565)
                     /locus_tag="CNF02300"
                     /codon_start=1
                     /product="Bromodomain and PHD finger-containing protein 3,
                     putative"
                     /protein_id="XP_024513031.1"
                     /db_xref="GeneID:3258360"
                     /translation="MPLHDLPKVSFTLITDDPALLHPAGVQSEQSRSYGYNDFSDFER
                     PEHYIRYIEPIESELAVQVEYDMDEQDQAWLDTYNAERKKDQCGPISYEVFEIIMDKL
                     EKEWFNLSKRIPQPQQQLAPEDSKCSICDDGEGENSNAIVFCDGCNLAVHQDCYGVPY
                     IPEGQWLCRKCTVSPENPVSCIFCPNEGGAFKQTTTGHWAHLLCAIWIPETTLGNSIY
                     MEPVESVELVPKGRWKLVCSLCKERVGACIQCENRNCFTAFHVTCARQLGLLKSMKSL
                     TTDGTLHAYCHKHMPLDESKDQEVEDEEEEDDGWEVSPRNHHAHAKTKSKTQSSKSRT
                     SKSHPTPTAKRPAQPLVIPVTKKSAQAHSKSFRPGPPIIPKMIVNRILEYVGKVQLRK
                     KPQVVEKICRYWSLKREARRGAPLLKRLHLEPWTASTAARTQTESEKAQKLKFLQMLR
                     NDLEKVRMLADLVRKREKEKLRQAQVIKDVIDRFIFPYSERLRVTLERISAMDRREMF
                     LNPVTPAEAPDYSDIVKEPMCWLYIDEKLEKNAYIDIADFKRDIMLVLDNAMLYNARD
                     TPFHRAASKLKTAAQPLLNELDSITASHQSTSTESLVPSDLPVGDLEPALPHILAFFQ
                     ETTVSSQPEEPQDLLTSLFATELEPPKPPTPTPSPPPQPRKYRRPTKEEKQKKWNALV
                     KERQEKGLGRSTRGTEKLTREFEEEAGLAAAATQREKSTPVPAEEGNGMGIDHDRRAV
                     RRSTRNSLGGASSAVSTPKSAPRQRKREPAQVPVAEEPSRSARSTSTILPPTRQQRGV
                     IGLEALPLLTTKERLEQERALDLTTTEIDAADQFKRFNVGWVLPEGTKRKRSQNATSG
                     GASSTISRAPNNSTSRARGKKNEASPSAAPATSKSKSRSRKGSHNISVIQEEEEGEIE
                     VTTPKRSDKGNAVEPENGGFIEAADDDSDLSPPPTSLPGSAAPSPRATSSIAKPADAH
                     GSDIENDARSDDEDQLQTEKKKPDLEGQGDQETISHGTKRKGESDIETPVREKKRSKT
                     TQAKEEKVAKTPPKGKGRVKALYPPGTLVWAKIHTFPFFPAEIVDLIDDRDEVPDAVL
                     KEETASRAAAKNVNKDVWLVRFFDARSSYGWITGDRLDELGEDENVDAMYLAGKDREG
                     KSKGFKTPSLKRACRKGYRDALNSMETSANEGGRKEK"
     gene            complement(671631..674905)
                     /locus_tag="CNF02310"
                     /db_xref="GeneID:3258446"
     mRNA            complement(join(671631..672938,673003..673090,
                     673155..673233,673285..673412,673463..673557,
                     673607..673824,674528..674654,674723..674905))
                     /locus_tag="CNF02310"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_571551.2"
                     /db_xref="GeneID:3258446"
     CDS             complement(join(671914..672938,673003..673090,
                     673155..673233,673285..673412,673463..673557,
                     673607..673721))
                     /locus_tag="CNF02310"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_571551.1"
                     /db_xref="GeneID:3258446"
                     /translation="MQNVNIPADSVPQGLKHIEQILKRAKELKQAEPIVSYWCSFSAA
                     QKALKVQNRTKEDTLFLMSLIDALEQMKVIMGNNEAIHSEAAGAAYIENFALKVFMSA
                     DNDDRAGNTGKATIRKFVVAGQFIEVLRCFEHGMTEEMEQKLQYARWKAADGAKALRE
                     GRAPKPGPPITEDEALLPVPPTGSPDGLSQGIQSPNALGGSRNGSFSSTVRPTIPSPP
                     AMSPRTSPSLSPGKNINVNVPPLDAHTADNLGTTRSQNSGSGAWSTVATPGLPDDENS
                     QIHFDLSRTEVPSSDVLGTPPEERSPSGERKNVRFTGPDGAPLSPASTYNTISSYDAP
                     PPPPPTYISSPVASSKSIPSASSVPVADNPPEGRPRGDSSASARSNDRHNQPATHIPD
                     VSARGAESATTIPKPKAAPTSSSGLRTSAVPSSINVPPAPPPSLASAPSLPPPLHPQS
                     HGLGLTSPPISLTPAPKSLSRRDVEQTQKHAKWAISALDFDDYETAKSELRKALNLLG
                     G"
     gene            674741..678060
                     /locus_tag="CNF02315"
                     /db_xref="GeneID:36392901"
     mRNA            join(674741..675472,675519..676781,676834..677573,
                     677635..677691,677745..678060)
                     /locus_tag="CNF02315"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658569.1"
                     /db_xref="GeneID:36392901"
     CDS             join(675287..675472,675519..676781,676834..677573,
                     677635..677691,677745..677871)
                     /locus_tag="CNF02315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514496.1"
                     /db_xref="GeneID:36392901"
                     /translation="MSNSDTSQALILWEINPGQPLVAASSIANTSSASLTDLIEPLKK
                     QEKENRTTYATSIGPTDNQDDGPSSTNRWVINKVFSDSFTSHLRVCTQEPYILVPIQS
                     GDVARRIYHPFWKEQEGLLNKSRCVQGVPLPLLGSKKRRRELENPFVAADTANTANTF
                     ADPPAGPYHSMALIKRPRLTLVHVPKPDLRQNHHGTVKPFHPVSHPWPIDQKGDPVFI
                     LNQEFRRHLCYSLILPTPAFFQIHYPQASATKCIAQRQLSRTFLPIANYKYNPNRLIT
                     YHSGITMATDKAATQGQGAVARLSNYANPADENQVQDPLSIIQPIIMRHLVCPTSHSP
                     SPTIVEHSHHEFMMPEYDNPVIDDYDVMEVRSEYDGELCVMPLEDSDANYQTLAQEQR
                     SLAKAPKKRPLVNRITLRPRSPSPDVFLSEAQGENPNKHRRSSEDDEIIDSCEGQWRV
                     GRIPGHQGFHSRSGRKVIGSDSESSGQKRSLSQSISGQAERVLKKPFRPPTRVILPKA
                     SPKPSTSPLAGGIPDSTPSKDITSTPSTSASDSTLTDSTLNSQAKWTPSHRSSKLTRP
                     FKTPIRSDRSSAPSPSTSSLSSTHRGHQATILTVQNEVMLLKKAAKYENDDSAGRLEE
                     LIIQWRNAGREMVERLFSLIPRPLDDGLLQTSSAYAPNAFSSGWYEGPSTLELTPEQQ
                     DYLAKAPLNKDDEPVDTEGNLLFENEGDQDVVKYLQKLEENKTYAFKESSQVRRTPMD
                     ESDVDDYSNCRNAEESSSNEWNYGSLMRGLGVDPPLLGWDACAEDWIDFS"
     gene            complement(678089..681864)
                     /locus_tag="CNF02320"
                     /db_xref="GeneID:3258452"
     mRNA            complement(join(678089..680672,680735..680922,
                     680970..681252,681307..681745,681792..681864))
                     /locus_tag="CNF02320"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657397.1"
                     /db_xref="GeneID:3258452"
     CDS             complement(join(678093..680672,680735..680922,
                     680970..681252,681307..681744))
                     /locus_tag="CNF02320"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513093.1"
                     /db_xref="GeneID:3258452"
                     /translation="MSMHFAPQWAKPIKPSGSTTTTPTTEVPLRKSTTSSPFPALPAN
                     PRSASPTTTTHPTLSYSRVTHTPSSPNVATDGYFPNQDLNGGIVNVHPFRYSREQILS
                     LFDESKFKERPIELVEMAEGGGVLVSQSVNRPVGMRDLTDTEKKILATSVHPALSTRR
                     QLNQTNTPGEHATNGLSTRRNAGFTRGEGGAFSGSLGKMGSFGGGVLSPSGIDHKAPG
                     ALGGGFGGVAKRMSRRNEDVGGESRSSAATWRSGPKTPAGNFEGVLGFGNSAAPSSPS
                     VETSEQKEVGQRKWRIAAGLPAGESDKTLDVPISNQAGVSASVIATPSATPIPDRDAT
                     VLDSIPAPTPTSQTPQVPIQEPKEDLGAVEWFYRDPNGQEQGPFTGTQMHDWYSHSYF
                     TDDLPLRRASESDFRPLSELKAATGNAVQPFLSPIRPRQLPPNLPIPIAALQQHAMSS
                     LPDNFRNLSMQSPIGSDPRVSPQPPLPSVPGAAPYIPGYDTAFSHNYPLGHQPLDQVA
                     SPGYAPSPTQGWNALAPQPSLRMGMSPLSPAPFSNIGVPSPIGSAPLQYMQQQQQQQQ
                     QQQQQQQHQGYFGAPQQMGMRSAPGDIYGQPQPWGVHGLQQQAGGFPQQIGYQSQPQN
                     QPQSQSAPVQWDQAQLPQQVLYEQSQPQQQQQQQQQQQQEVEQSVPISEPVDEGSQSE
                     QVEETAQIKVSAEPEADIQLETVEDVKEQLAIDLDQEEEDEVEELTPVESPVISTPAF
                     KPAPAPTTSAWKKTLTPSDETSLTDPVDPTPAQAASIRPSKPTSREEFEIIPTPVQLP
                     KVVDVSTPGPTADASASPSLERSSSKPKIAPWAIKNEERAAPSPSLRDIQEAEARRAE
                     ARRVALAEARAATASPVLVSASSEDLPASMSWGLPSQTGKGTVRSHSPATPSTPGPAV
                     AAWGGAGEAPKKTLKQIQEEEEKRKTRAAQAARVAQGQAAGAGASAIPNAGSTRRGYA
                     DLAAAPVKREEIQPGWTTVGAGGRVASSSGVPRAATPVNVKPTPAPVVKPAAAPVPVK
                     KATGPSASTSIVDDGAPSVEFVRWTKQALTGFKGDVDDFISVLLSFPIDPPAASRADQ
                     MEIISDSVYANSSTLDGRRFAQEFMAKRKADAARPGGAAGGKKISSLADVVKTQPKQT
                     TDAGFKVVKAKGKKKN"
     STS             679552..679751
                     /standard_name="CTG12"
                     /db_xref="UniSTS:470838"
     gene            682015..683215
                     /locus_tag="CNF02330"
                     /db_xref="GeneID:36392902"
     mRNA            join(682015..682067,682119..683215)
                     /locus_tag="CNF02330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657398.1"
                     /db_xref="GeneID:36392902"
     CDS             join(682050..682067,682119..683183)
                     /locus_tag="CNF02330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513141.1"
                     /db_xref="GeneID:36392902"
                     /translation="MGRVHILGIGSIGTLIAHHLRLAHPSLPLTLLVRNASLFSDLSV
                     TRNGITSRSSNYDFESPNSEGCHITSLIVTLKTTQTLSAIRPLLPRLSPTSVVTLLQN
                     GMGVYDELCEHLWPENTNRPFFVLGTTPHGVAPAGGKGVIGHHTPNGHGDIKWGVVPH
                     PRKVADPLEKWLFGSNSTVIESPLQLPAVPEGSGDLTNLHFTLSALLSTTPLNPMLLS
                     YHQLRLALLLKLAVNAVVNPLTAVLGRGQLRNGTLSTYSGGTALVEAVVDETSRVFLS
                     YLQTQSFSSEELQAFQPHVLQQHLTNIIASTVDNTSSMAVDIREKRLTEVDYINGYVV
                     KLGEKMGLETPVNEMLYNMVKFIESI"
     gene            complement(683015..684305)
                     /locus_tag="CNF02340"
                     /db_xref="GeneID:3258028"
     mRNA            complement(join(683015..683402,683451..683552,
                     683608..683699,683750..683845,683903..683963,
                     684028..684305))
                     /locus_tag="CNF02340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657399.1"
                     /db_xref="GeneID:3258028"
     CDS             complement(join(683246..683402,683451..683552,
                     683608..683699,683750..683845,683903..683963,
                     684028..684206))
                     /locus_tag="CNF02340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513143.1"
                     /db_xref="GeneID:3258028"
                     /translation="MSSPAPNTPSPPSHTSGLPSSLLILERPELSHLAQWSVSSHKYG
                     FGVDNLRDGNDSTFWQSEGAQPHTIDLAFPRKVMISAIAVHMSHPRDDSYTPSKIGIR
                     CGTGVHDLQEVRYMEFSKPDGWHLIPLRPMEHTASRMEKEGPPIPCHFLRVLIFANHL
                     NGKDTHVRGLKVFGPPGPKENTQVSSPSITMSQQAVDEIGSGRRLLELGHDGLSGFTS
                     TEFKMHEWIR"
     gene            684468..686843
                     /locus_tag="CNF02350"
                     /db_xref="GeneID:3258110"
     mRNA            join(684468..685242,685296..685399,685449..685541,
                     685595..685742,685795..686315,686368..686843)
                     /locus_tag="CNF02350"
                     /product="expressed protein"
                     /transcript_id="XM_571333.2"
                     /db_xref="GeneID:3258110"
     CDS             join(684712..685242,685296..685399,685449..685541,
                     685595..685742,685795..686315,686368..686755)
                     /locus_tag="CNF02350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571333.1"
                     /db_xref="GeneID:3258110"
                     /translation="MLFSLLTVPTSILLFLAYILNEVTVTPIANFTVPLHRPTSTSTF
                     NLLPAAPINGSWNVIWQPPSLLTLWTSALNGLPSSILTALKFKNIQRLKRFYDFSIGA
                     CLLGVAIGVGGAGWITYSVWMDVWRELEGHVRLSPDIEGEVVEGVGQEIVRRAFAPVI
                     EVPTAIGGATGGGLRPLIPGLTVPWSHTPSLILALVVNQLIHELGHALSASLDDIRPS
                     KLSFNLHYFLPSMTVEFPSVQSLTANGKMRIASSGPAHNLIIWFILWLLTFSGFGRIF
                     WKTQSTGGVVVQDVDWTSPLARHLQADDIITHLNDIALSPTSSSPSPVDKWIWYLTSS
                     IEDDPERGWCVTRSDFLALSPTPCDFKTQKGQGAIPFRSVNTRGYPQEPLERCIHPHP
                     ILDIPSKACPCPDENWLCIRPKATDILRIRVGGRKEKVVLWEGTREEVLRVVNVGVQV
                     GRIWSAGMRTLGLIFRYTQIIASSLFLFNLLPLPSTDGSQLLEALTEWTPTGKPVKPL
                     TAKSMQATLNTPESRELTEAEGYELASDEEAAIGLKADQSGNTGTRQKPKVAKWKKFL
                     KITVQVYMVAVCVMWVIGWGMILLLQSS"
     gene            complement(686799..688442)
                     /locus_tag="CNF02360"
                     /db_xref="GeneID:3258199"
     mRNA            complement(join(686799..687143,687195..687714,
                     687764..688007,688054..688144,688345..688442))
                     /locus_tag="CNF02360"
                     /product="expressed protein"
                     /transcript_id="XM_024658570.1"
                     /db_xref="GeneID:3258199"
     mRNA            complement(join(686799..687143,687195..687714,
                     687764..688007,688054..688207))
                     /locus_tag="CNF02360"
                     /product="expressed protein"
                     /transcript_id="XM_571547.2"
                     /db_xref="GeneID:3258199"
     CDS             complement(join(686901..687143,687195..687714,
                     687764..688007,688054..688144,688345..688380))
                     /locus_tag="CNF02360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514497.1"
                     /db_xref="GeneID:3258199"
                     /translation="MPRTHATASSISVPTSLVSGLRSLIGSFTSSSAPLLPFIPKPLK
                     LILLLLFLSHSPSWPFVWHVRVWWHGVKAYYLAWHKGRAKYLADWKAQNDKNGGIRSL
                     RVRHKRIAGVDDCDYNMHLSNSSYAKNSDALKMDWCIKALSPSFTARGTYMALGATHY
                     VFFKEIPIGSEYTMEAYCLGWDEKWMYLACEFILYPKKTSKAGAAKNKVAAGVVSSAP
                     HIVPTISAPPTRTASPNSSASVSGTVTPAQGSPLGNKVEEIKRAWLARRKENPREDGG
                     VTCCLSVSEYCFKIDRVTIPPRISLYTSLQSPSKEHQARARAMLMSKDGGRAFLRGGW
                     REEPNSELLGADIGLFEGEEFQDSWVKRAAESMEKVVDGMSAF"
     CDS             complement(join(686901..687143,687195..687714,
                     687764..688007,688054..688162))
                     /locus_tag="CNF02360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571547.1"
                     /db_xref="GeneID:3258199"
                     /translation="MELLSQVPTSLVSGLRSLIGSFTSSSAPLLPFIPKPLKLILLLL
                     FLSHSPSWPFVWHVRVWWHGVKAYYLAWHKGRAKYLADWKAQNDKNGGIRSLRVRHKR
                     IAGVDDCDYNMHLSNSSYAKNSDALKMDWCIKALSPSFTARGTYMALGATHYVFFKEI
                     PIGSEYTMEAYCLGWDEKWMYLACEFILYPKKTSKAGAAKNKVAAGVVSSAPHIVPTI
                     SAPPTRTASPNSSASVSGTVTPAQGSPLGNKVEEIKRAWLARRKENPREDGGVTCCLS
                     VSEYCFKIDRVTIPPRISLYTSLQSPSKEHQARARAMLMSKDGGRAFLRGGWREEPNS
                     ELLGADIGLFEGEEFQDSWVKRAAESMEKVVDGMSAF"
     gene            688705..690921
                     /locus_tag="CNF02370"
                     /db_xref="GeneID:3258472"
     mRNA            join(688705..689110,689162..689413,689463..689983,
                     690040..690063,690117..690195,690249..690519,
                     690571..690921)
                     /locus_tag="CNF02370"
                     /product="protein farnesyltransferase, putative"
                     /transcript_id="XM_571334.2"
                     /db_xref="GeneID:3258472"
     CDS             join(688773..689110,689162..689413,689463..689983,
                     690040..690063,690117..690195,690249..690519,
                     690571..690651)
                     /locus_tag="CNF02370"
                     /codon_start=1
                     /product="protein farnesyltransferase, putative"
                     /protein_id="XP_571334.1"
                     /db_xref="GeneID:3258472"
                     /translation="MATEFTPSVYSLVSTPLPSNSRPSATLDEQAETEDLISQLFDLT
                     ADPNALVSQHGKIYSGLRKQEHTQFLASTFFQLPGKFVSLDASRPWLIFWTVHSLDLL
                     GVALDQGTKDRVVSTLLHFLSPMGGFAGGPANSQIPHLLPTYASVCSLAITGNDGPTG
                     GWKDLADARQSLYEFFMRCKRPDGGFVVCEGGEVDVRGTYCLLVVATLLDIITPELLH
                     NVDKFVSACQTYEGGFACASFPFPSVVPSTSALPTSEPSCRVSMAEAHGGYTSCSLNS
                     HFLLTSVPLPSFPSSIDASAALRWTVLQQGEAIEGGGFRGRTNKLVDGCYSWWVGGGA
                     PVAEELVRREKSKKVKKSRVELIEEEEKEGDWEDVPPIPPTFNRVALQEFTLVAAQQD
                     PGSTGGLRDKPGKRPDQYHTCNNLSGLSIAQHKMSHSPSAVSSNRLKFDASKGLPAIE
                     PVAPGGGWKNEDERRNARREIWANALGWIEEEGGEIIVGGRDNRVNTTTPVFNILGLR
                     LKPFINYFYCQEN"
     gene            complement(690824..692350)
                     /locus_tag="CNF02380"
                     /db_xref="GeneID:3258261"
     mRNA            complement(join(690824..691074,691133..691411,
                     691463..691548,691601..691933,692012..692350))
                     /locus_tag="CNF02380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657400.1"
                     /db_xref="GeneID:3258261"
     CDS             complement(join(690893..691074,691133..691411,
                     691463..691548,691601..691933,692012..692085))
                     /locus_tag="CNF02380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513144.1"
                     /db_xref="GeneID:3258261"
                     /translation="MKGVVWDSRTQLLHWVDIFRSELHTLDPATGNRSIDVYPQSPCL
                     SYITPRANAPGFIATNASSLVVLPPATTPTTTSPTPVKREYEAVLDETLDAKLVEDGV
                     IRFNDGGVDPDGRVWFGSMGIDESKPEMPGKLFVWDGGKAVETMNNVGVSNGLGWSPD
                     GRTVYYIDSRYDLVSAYNYSTTPPYWSNKRTFALPPPALDAENPTHGAYDGLCVDGVG
                     NVWVARWRDERVVGFNPEGKLIAMVTLKGCKNPTIPCFGGKDLTTMYIVSATSYRGGD
                     GDHQKWPRSGDLFKVECGPGTEMGKILGAGWKGAERHRAQL"
     gene            692522..694153
                     /locus_tag="CNF02385"
                     /db_xref="GeneID:36392903"
     mRNA            join(692522..692679,692769..693164,693225..693472,
                     693520..694153)
                     /locus_tag="CNF02385"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658571.1"
                     /db_xref="GeneID:36392903"
     CDS             join(692566..692679,692769..693164,693225..693472,
                     693520..693754)
                     /locus_tag="CNF02385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514498.1"
                     /db_xref="GeneID:36392903"
                     /translation="MRGQKRLLDVDPDDLVSFHTAISPSTGRGQAETMVRAHKRPRQQ
                     TPSPRRHTPSLQLAVNLSQSSRSPPAFLSESNIRTTCGASMPLDFTDCPRQTRKEWYA
                     GVFSSPSSSSHWSSNSSSPINILHSTPTKRRDHRLSFAPSSDGKPSVYQHPDATTRSE
                     RQENNEIILGVTSYPSPRYTHASRSPKPATANGFHHILSGLNDLRIRDQYTAQSSESL
                     SRSTSGRSAMTLQTPPTGSSRRSFAIYGDNGEQNQYLSPTSAAGAPHPKQPNFSFSKP
                     TAEGSPLSRRQCRDRIPERNLALAKAMSDLDSDSGSEIDVVMEEPMILGAYGKI"
     gene            694314..697654
                     /locus_tag="CNF02390"
                     /db_xref="GeneID:3258039"
     mRNA            join(694314..694538,694589..694776,694831..695116,
                     695176..695243,695303..695565,695631..695728,
                     695778..695809,695858..696000,696048..696455,
                     696508..696600,696653..696666,696718..696903,
                     696950..697654)
                     /locus_tag="CNF02390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571335.2"
                     /db_xref="GeneID:3258039"
     CDS             join(694528..694538,694589..694776,694831..695116,
                     695176..695243,695303..695565,695631..695728,
                     695778..695809,695858..696000,696048..696455,
                     696508..696600,696653..696666,696718..696903,
                     696950..697382)
                     /locus_tag="CNF02390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571335.1"
                     /db_xref="GeneID:3258039"
                     /translation="MNPVSPTSSRGMREYIPQGMEDEDLDGEYLDMEEPIEGDFTLRA
                     ILAGLGVGVVLCMTNIYFGLQTGWVSMMSLQSALLGFAIFRVPTFLPRLFPSMRPFTP
                     QENVVLQTTAVATGTMPLAAGLVGIIPALSMMSPEIDGREPLFMGWGDLIMWCLAVAF
                     FGVFLAVPLRKQVIVKEKLVFPSGTATAQLISLLHHTPPVEVQGARTTAYRRLRRSST
                     SVSPNRSRRHDNDEEDEWGEDREAEWEEEKDVDIMTGKGWWALGASFIASGSLTVLSF
                     LFPILFSIPVFDVLSLPFGSSLAASWMWWFTPSLSYVGQGIIMGFPVTVSMNIGMVVG
                     WAMLSPLSKHLGWAPGPVSSTTDGARGWILWVALAIMIAESIISLLPITFSYVSTAFR
                     QYRQRNYRPGIFASAPRSPSSQVSGEDDYFTPPDKDEEPEHEPPERLVPNSWVLWGLG
                     VSGVMGVILVWFVFGSDGIHPWATAIGLLLASILSLIGVRALGETDLNPVSGIGKISQ
                     LFFAILQPGNVVANIIAGGVAEAGAQQAGDLMQDLKTGHLLRASPRSQFYGQMIGSLA
                     SVFVATAGYKFYTSAYTIPGPEFAVPSAGIWLNLARLLNNGHLPSHVIPFMLGFGALF
                     ACLSFVKAFRSSFPASIASSRLVTLLPSGIAFAVGFLNSPSFSIARLIGGYIAYRAAK
                     ATRTGETPLLMIVVASGFVLGEGVVSVITLGLTSAGVGAISCWGCGINGGGYCSGGCS
                     "
     gene            697937..699370
                     /locus_tag="CNF02393"
                     /db_xref="GeneID:36392904"
     mRNA            join(697937..698336,698396..699370)
                     /locus_tag="CNF02393"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658572.1"
                     /db_xref="GeneID:36392904"
     CDS             join(698334..698336,698396..699187)
                     /locus_tag="CNF02393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514499.1"
                     /db_xref="GeneID:36392904"
                     /translation="MPKTLITPFIYHPDAPSSQPNPSLSNPSFPEAKPPRRSIFCIPT
                     ASFNPFKRFRTHKDLPRRPYQPSEVIQSYDGFCNISSSKTRIASDMWCDVSCMADRYS
                     IRSISASQISTAGGDEDVTKDESEDANVPNSVAIDFREGNTPVPARQANGKEMGNSMA
                     TSEIVFQDKQAKDAMWVEVLPNSSPICDEPTLKATKRDTVCLDLLDKGQQIVLSAFSE
                     FSPSESIKRARTSLRDISPSRPAYSWNNKRKSRKLTRSNAIRRYKR"
     gene            699459..700850
                     /locus_tag="CNF02395"
                     /db_xref="GeneID:36392905"
     mRNA            join(699459..699949,700005..700097,700151..700850)
                     /locus_tag="CNF02395"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658573.1"
                     /db_xref="GeneID:36392905"
     CDS             700153..700719
                     /locus_tag="CNF02395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514500.1"
                     /db_xref="GeneID:36392905"
                     /translation="MSRSSSPDIEKGVPPPPRRSRGKCCCILFCVLLLLAALAVGGFA
                     LYEYVIKPRIIDTHLLSDIDGNGSTTASAPTLLQTTVIPTATSPSFNGAVGGYTPAIG
                     VWSKADKDDLDGEGDGSGTVDQDVSNDGQSNNSAGIDDAIMAIDHTTSASASDPSSAT
                     KDSVTKDWDGYDSGQWNNDKWGWQNYGP"
     gene            complement(700835..705183)
                     /locus_tag="CNF02400"
                     /db_xref="GeneID:3258358"
     mRNA            complement(join(700835..701226,701288..701491,
                     701542..703080,703141..703283,703342..704258,
                     704318..704731,704839..704920,704962..705183))
                     /locus_tag="CNF02400"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_571337.2"
                     /db_xref="GeneID:3258358"
     CDS             complement(join(701009..701226,701288..701491,
                     701542..703080,703141..703283,703342..704258,
                     704318..704731,704839..704920,704962..705077))
                     /locus_tag="CNF02400"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_571337.1"
                     /db_xref="GeneID:3258358"
                     /translation="MAYVAVAKALYDYQPQDPDTELAFHEDHILYIIDKEDNDWWKAK
                     LKDDNGGADGQVGLVPATYVEEIPPISTTRAMFAYESTSPEELSMSDESALHVYSVED
                     DWLLVRLDSDPSSKLGFVPRNYCEPLDASEQVQVADAADTEAELEAQRQAEHEKELAE
                     KQRQLKLKDKVETWSISELEGKKKKKGTLGVGNAAVFFASDTDKAAPVKQYPITDVLS
                     VSQPSSKNLSLALSTLAEPLQFHCGSADTARAILAKLEQSKAAAGEALELLNNETQPV
                     SSEDEAEPEPEPQPQPERAPQPAFTPLPPPPHPSRTISATSNNSEPKGVRFAEPEPEP
                     APAQKGEEEAATVLYDFDAAGDDELTVKENDTVAIVDKENDEWWLVKDSNGQQGVVPA
                     AYLQLNDGSVPAPSASAAGGPAAYDEDDEEEYRASEAKAEAEAEARAAQQESERQRQL
                     AAEEERRRIQAAAEARRMQEEEDRQLAIQIEEEQKERAARKALRRQEEERRRREEEAK
                     AARENARAGGLQPPQITKRPSGNDVAAAANRLPTRGHAAPARPPDNARSKPNPAKVRT
                     WSDKSGQFDVEAEYLGLLNGKVRLHKLNGVIIDVPLEKMSARDTELIRRHEAKKAKKA
                     SMDEDDRPLGQQPTGRRPGQRSVESTHRSEEPIPAEVVRASKAAASKRPPFDWFEFFL
                     SAGCDMDDCTRYATNFERDRIDDSILPDLDNGTLRSLGLREGDVIRVRKVIQSRFSKK
                     TPEQQAQIEKDEELARQLQEQEAGGKPPGLFTGPNGKLANNTRRGRPEKKSTGPESVD
                     AAALAAASDKLAQVTLTPTPPSAPTPPPVILTPPTVEEKKPAAAPATSTGFDDDAWTI
                     KPISKPSSPAPATVTTSSSPGPSAAPVSTSPKVANNTDSLLAQINALRPASTGISQNN
                     TGGSFDKFSHMTGAGAPRAPSAPAQHPAAQQPQSQLSPQPTAQSQQSFVPNAYGLGVQ
                     NSGQPMSMLAQQTGMSNSSNAPRGPLAPVPVNQGLLNPMQPQATGMFVPTRDLLPMGA
                     QQTGFQPQQQQPQTTSSFHAQQQMMPQQTGFFTGQMGMQPNFTGFPQQQQQQQQQQQQ
                     QSTFNTIASMPPPQPQQAQQAPDKFAPSNIFAAMKKTDFGKPEEQQPQAAGKYDALRP
                     LTTGYNGAPGMMPQQTGMMAQPTGMMPQQTGMMGMQGQGMPGMMSQMTGYNPMMYQNQ
                     TGYGYR"
     STS             701320..701518
                     /standard_name="GTT9"
                     /db_xref="UniSTS:470840"
     STS             704231..705047
                     /standard_name="Xho14"
                     /db_xref="UniSTS:470839"
     gene            705242..707530
                     /locus_tag="CNF02410"
                     /db_xref="GeneID:3258481"
     mRNA            join(705242..705319,705357..705826,705876..706601,
                     706659..707063,707132..707227,707292..707530)
                     /locus_tag="CNF02410"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_571592.2"
                     /db_xref="GeneID:3258481"
     CDS             join(705677..705826,705876..706601,706659..707063,
                     707132..707227,707292..707402)
                     /locus_tag="CNF02410"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_571592.2"
                     /db_xref="GeneID:3258481"
                     /translation="MTKREREENKLPRLTAYATAEGYKLKALQAFLKREHGVSVVRVY
                     DDCVYAIYNLPLLPGYATTKVRSSPVVKSPGGVSLMERMTMAEEQGYNDSYFPREDPT
                     EATPAEYILSSSPSGGDGISGVGTDLDVLAQDGEREREMREAEREGERPTTHYETVKP
                     EDESHPREHTHHDPGTHLSPDHPGYLEHTPSTALTPMDLPPHHHRRLSTGMQMPEEYT
                     AHSSPRAQHRPRRRKSQASLNNVAEAIFFSYGVSVFFGFNEGEEKEIMEDAETAGAWT
                     RGLGEDDWEIEEFHYVHDPDAENPRIYNDMFTFKSRSHLFKLSLAHAIAQSTKLSIYE
                     SVMQETLSLTASFPKELSITGHLQLTRREALKMTGRLFKLRMDVNLSGGILDTPELFW
                     SEASLFPLYEAVHEYLEIGPRIQVLNDRLAVAGDLLEIIHEYIEEQATHRLTWIIIWL
                     IVVACFVELGEVIARMIFHAIPREQGEFLMLKAPQLLIGAGQSFV"
     gene            complement(707473..708388)
                     /locus_tag="CNF02415"
                     /db_xref="GeneID:36392906"
     mRNA            complement(join(707473..707752,707811..708024,
                     708088..708388))
                     /locus_tag="CNF02415"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658574.1"
                     /db_xref="GeneID:36392906"
     CDS             complement(join(707656..707752,707811..708024,
                     708088..708289))
                     /locus_tag="CNF02415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514501.1"
                     /db_xref="GeneID:36392906"
                     /translation="MPSERVIRFTHTFLFTLVLLASIVALGISGSLVGHYNSNGYPPA
                     HTNAYRDRIRILLVASVWTTAWGLILTVGFQLLGQSRAFGLLTHLIPIAISFILYLIG
                     VSSLTALTDKVDCGNSGQTFSRCSVVKGLVVISWIDTILVLFALVFLIVLCFMARGRY
                     GAHRSTLYLE"
     gene            708547..711059
                     /locus_tag="CNF02420"
                     /db_xref="GeneID:3258348"
     mRNA            join(708547..708812,708876..709024,709097..709327,
                     709380..709849,709901..710165,710219..710291,
                     710336..710385,710452..710673,710729..711059)
                     /locus_tag="CNF02420"
                     /product="glyoxal oxidase precursor, putative"
                     /transcript_id="XM_571566.2"
                     /db_xref="GeneID:3258348"
     CDS             join(708646..708812,708876..709024,709097..709327,
                     709380..709849,709901..710165,710219..710291,
                     710336..710385,710452..710673,710729..710997)
                     /locus_tag="CNF02420"
                     /codon_start=1
                     /product="glyoxal oxidase precursor, putative"
                     /protein_id="XP_571566.1"
                     /db_xref="GeneID:3258348"
                     /translation="MLSPSTLLHALSLAALAALPAQAQLANTFQYVGLSGVSAQQMFL
                     GTLHKVYIVDKTENNNATVNGHPAWASEYDLATNTFRTMDVLSNSFCAGGTVLGNGTW
                     LNAGGNQAITYGGAAMPSTQQSGQSPYGDWDGGKAVRLLDPCDDESCEWVDDPALYMT
                     SRRWYPTLETLEDGSAIIMGGCEWGGYVNYADNQNNPTVEYFPPKGQPFTLNFLLNTM
                     PVNLFPLVWLLPSGNLFVQAEYQAEIFDYKNNIEYPISDIPDCVRVYPASAGTAVLPM
                     TPENNWTATIIFCGGTFLESDQWTTDWNISQYPANQSCVHISPDVDLTWYQNDPLDTG
                     RSMGNFINLPDGRLFYVNGARTGTAGYGTQDWAVGESYADHPLYQSWYFDPSQPSGQR
                     WSKAGVSSIPRMYHSSASLLPDGTVIISGSNPNADYVDAVNNASYTYFTQYQVEIFYP
                     DYADHVKPTPQGMPSNITYGGDYFNITLSASDLFNVPININKTRAVIMRTGFSTHTMN
                     MGQRHIELETSFTTTDDGGGILHVAQLPPNPGILAPGPALFFIVVDGIPSNASWVMIG
                     DGIIGEQTLHEKSVLPRSQISAQIMAQYGFITYSTNTTSTATTTWGSWKLAGMSLMCL
                     WGGIVLL"
     gene            complement(711024..712251)
                     /locus_tag="CNF02430"
                     /db_xref="GeneID:3258032"
     mRNA            complement(join(711024..711331,711380..711455,
                     711508..711884,711935..711950,712007..712152,
                     712210..712251))
                     /locus_tag="CNF02430"
                     /product="acyl-protein thioesterase-1, putative"
                     /transcript_id="XM_024658575.1"
                     /db_xref="GeneID:3258032"
     mRNA            complement(join(711024..711331,711380..711455,
                     711508..711884,711935..711950,712007..712251))
                     /locus_tag="CNF02430"
                     /product="acyl-protein thioesterase-1, putative"
                     /transcript_id="XM_571591.2"
                     /db_xref="GeneID:3258032"
     CDS             complement(join(711156..711331,711380..711455,
                     711508..711884,711935..711950,712007..712207))
                     /locus_tag="CNF02430"
                     /codon_start=1
                     /product="acyl-protein thioesterase-1, putative"
                     /protein_id="XP_571591.2"
                     /db_xref="GeneID:3258032"
                     /translation="MFVIGFTVRNLLIACIALVTISLYWISSIPSKTRLPSPLLQDTM
                     PTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPTIPV
                     SLNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVDSGIPENRIVLG
                     GFSQGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEHAKDIPVFWGHGTNDP
                     VVDYRFGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMPHSSCPQEIEDLKSWL
                     MEALK"
     CDS             complement(join(711156..711331,711380..711455,
                     711508..711884,711935..711950,712007..712078))
                     /locus_tag="CNF02430"
                     /codon_start=1
                     /product="acyl-protein thioesterase-1, putative"
                     /protein_id="XP_024514502.1"
                     /db_xref="GeneID:3258032"
                     /translation="MPTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSF
                     PNVKWILPHAPTIPVSLNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQ
                     AEVDSGIPENRIVLGGFSQGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEH
                     AKDIPVFWGHGTNDPVVDYRFGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMP
                     HSSCPQEIEDLKSWLMEALK"
     gene            complement(712744..713805)
                     /locus_tag="CNF02440"
                     /db_xref="GeneID:3258169"
     mRNA            complement(join(712744..713129,713181..713344,
                     713392..713805))
                     /locus_tag="CNF02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657401.1"
                     /db_xref="GeneID:3258169"
     CDS             complement(join(712862..713129,713181..713344,
                     713392..713547))
                     /locus_tag="CNF02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513033.1"
                     /db_xref="GeneID:3258169"
                     /translation="MRFTSMFVAALPFIGSVFAAPLVESALTPVTSDLTKKDVDVLSV
                     ITELQTRVNAAGSIGPNSVEAEVTACLNIVIDAFNWCGNELGIDLSVGVSAGVSLFSR
                     DVVIARDTDKEQVAQALSNVIQTVNVNIIQPIPPYIAHKTTVSKLLYQIDDSLTLILK
                     GVDSLVAGVLKLVNSLLKDVGLILKSLLGGFLSIL"
     gene            complement(714731..716257)
                     /locus_tag="CNF02445"
                     /db_xref="GeneID:36392907"
     mRNA            complement(join(714731..714888,714937..715181,
                     715239..715262,715413..716257))
                     /locus_tag="CNF02445"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658576.1"
                     /db_xref="GeneID:36392907"
     CDS             complement(join(714851..714888,714937..715181,
                     715239..715262,715413..715441))
                     /locus_tag="CNF02445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514503.1"
                     /db_xref="GeneID:36392907"
                     /translation="MSFPNLMTPSDFHYVLHARDLTDDVSKLLAAIVEDLNSLLSPIV
                     GLLSQIPIVSPILEDINTALDAIVQGLDNILGGILDLVATILKDLGINITPLLSGLLQ
                     LLTGILGGS"
     gene            716480..717904
                     /locus_tag="CNF02460"
                     /pseudo
                     /db_xref="GeneID:3258389"
     gene            complement(716559..717708)
                     /locus_tag="CNF02450"
                     /db_xref="GeneID:3258255"
     mRNA            complement(join(716559..716748,716805..717052,
                     717104..717246,717300..717708))
                     /locus_tag="CNF02450"
                     /product="expressed protein"
                     /transcript_id="XM_571341.2"
                     /db_xref="GeneID:3258255"
     CDS             complement(join(716711..716748,716805..717052,
                     717104..717246,717300..717464))
                     /locus_tag="CNF02450"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571341.1"
                     /db_xref="GeneID:3258255"
                     /translation="MRFTSFFIAVLPFVGSAFAAPLSNKASEALVVRSESLAPRTVDY
                     VGILTTLDNDIKNAGPLSGDSTEGEVTAALTTVKEAFDTAKSALHIVSSKRDLDMGVV
                     ARDSTADEVSTLLSTVSADVKALIAPVDVTLLSLPAVGGLVKEVNSALDSVLTGLGDV
                     LGGVVSLVAKTLNSLGIDIAPFLSKDINVLYDIFGKL"
     gene            complement(719480..721421)
                     /locus_tag="CNF02470"
                     /db_xref="GeneID:3258451"
     mRNA            complement(join(719480..719807,719854..720300,
                     720354..720427,720481..720568,720620..720678,
                     720726..720950,721015..721100,721153..721185,
                     721237..721267,721326..721421))
                     /locus_tag="CNF02470"
                     /product="conserved hypothetical transmembrane protein"
                     /transcript_id="XM_024657402.1"
                     /db_xref="GeneID:3258451"
     CDS             complement(join(720101..720300,720354..720427,
                     720481..720568,720620..720678,720726..720950,
                     721015..721100,721153..721185,721237..721267,
                     721326..721342))
                     /locus_tag="CNF02470"
                     /codon_start=1
                     /product="conserved hypothetical transmembrane protein"
                     /protein_id="XP_024513035.1"
                     /db_xref="GeneID:3258451"
                     /translation="MTVKAEQDLYLDPSIRDWVLIPITLIMLLVGVLRHYITQFLNSA
                     PKKQTAAAVREQRALGRSALLRATATLSPLPPASYKALSGSLAASLSTGEYIKPAPES
                     KGDASPANPLEGAGMENAMDGMKKQAVMMVPNMVIMQYINVFFSGFILMRLPFPLTAG
                     FKSLLSRDIPMADLDVRWVSALSWYFLNLFGLNGVFKLILGAENAAVDSRDLTSLSAL
                     SGAGGPMPGPGGPPDMVKLFKAEVENLALAESSYKWVGDGVEDRVLRAWGKV"
     gene            721648..723350
                     /locus_tag="CNF02480"
                     /db_xref="GeneID:3258500"
     mRNA            join(721648..721799,721857..721945,722054..722375,
                     722431..722676,722738..722949,722999..723173,
                     723227..723350)
                     /locus_tag="CNF02480"
                     /product="ketol-acid reductoisomerase, putative"
                     /transcript_id="XM_571345.1"
                     /db_xref="GeneID:3258500"
     CDS             join(721665..721799,721857..721945,722054..722375,
                     722431..722676,722738..722949,722999..723173,
                     723227..723253)
                     /locus_tag="CNF02480"
                     /codon_start=1
                     /product="ketol-acid reductoisomerase, putative"
                     /protein_id="XP_571345.1"
                     /db_xref="GeneID:3258500"
                     /translation="MSFSRASSNALKQALKSTASRQVARRSYSLLSGAAPRAAMATRL
                     GATRGIKTLDFAGTKEVVYERADWPLDKLQDYFKNDTLAMIGYGSQGHGQSLNARDNG
                     LKVIVGVRKGGESWKQAQEDGWVPGETLFDIPEAINKGTIIMNLLSDAAQSQTWNEIA
                     PLITKGKTLYFAHGFSVVYKEDTHVIPPKDVDVILVAPKGSGRTVRTLFLEGRGINSS
                     IAVYQDVTGHAKEKAVALGIAVGSGYLYETTFEKEVYSDLYGERGVLMGGIQGMFLAQ
                     YEVLRKNGHSPSEAFNETVEEATQSLFPLIGKYGMDYMYNACSTTARRGALDWAPKFK
                     EANLPVFEALYNSVRDGSETRRSLEFNSRKTYREDLQKELDEIDNQEIWRAGKTVRGL
                     RPDVNKDEL"
     gene            complement(723401..726105)
                     /locus_tag="CNF02490"
                     /db_xref="GeneID:3258170"
     mRNA            complement(join(723401..724453,724515..724794,
                     724857..724980,725049..725076,725130..725212,
                     725304..725356,725408..725498,725566..726105))
                     /locus_tag="CNF02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_571347.2"
                     /db_xref="GeneID:3258170"
     CDS             complement(join(723565..724453,724515..724794,
                     724857..724980,725049..725076,725130..725212,
                     725304..725356,725408..725498,725566..725733))
                     /locus_tag="CNF02490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571347.1"
                     /db_xref="GeneID:3258170"
                     /translation="MICFLRHPLLSIAALALFSKVVLGLSFTLENTSPKQCEEVEITW
                     SGGQSPWSLTIIPAYDYPTTVSIPSSSYDSDTNTGSYNWTVNYPSGTSFVIMMSDGSG
                     TGTGGVSPLYTVSGTSTSSCTLRSTSTDFFFYLNETSLTQCESVDIYWDSSAVSPVSI
                     LGAIPGGQVFQLVSANGATTSLVWNTNIQSGTEVIFAAFDSGTYQQGGSSDLLTIGGS
                     SDSSCIDSSSPSSTSSASHATQTGTLANSSSGTKTSAGGVKTVTAITTETASPGGGAG
                     LSTGAIVGIVVSAVLAVAVLQIALVWFCCRRQIKALIYHRREMRGQEVKPGGDVDLGL
                     ASRNSYSSVMGSDQRPMTGDYATEAARSSRYSNAAHSGVPRSGSGDDFDAVSSISPFW
                     DGAAAVPPRSNSIASMVASSRPPTIGALGFDSDADSLVPPRALTLHDRGRNDSLSSSS
                     IFIPETIGEGGGYPSPAISHTTLSPLVPGSPNLAATGSNTTNRNMTKAQMATSLNAHN
                     PDESAPTGDDFGTRLPPQHAPTGGFRRHEDAGRIDAPPPDEESVEDLPPMYMPEWEND
                     SQRQT"
     gene            726516..726586
                     /locus_tag="CNF02500"
                     /db_xref="GeneID:3258460"
     tRNA            726516..726586
                     /locus_tag="CNF02500"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3258460"
     gene            726893..728542
                     /locus_tag="CNF02510"
                     /db_xref="GeneID:3258033"
     mRNA            join(726893..727036,727121..727362,727432..727465,
                     727530..727644,727700..727834,727905..728082,
                     728153..728542)
                     /locus_tag="CNF02510"
                     /product="alcohol dehydrogenase, putative"
                     /transcript_id="XM_571349.2"
                     /db_xref="GeneID:3258033"
     CDS             join(726978..727036,727121..727362,727432..727465,
                     727530..727644,727700..727834,727905..728082,
                     728153..728463)
                     /locus_tag="CNF02510"
                     /codon_start=1
                     /product="alcohol dehydrogenase, putative"
                     /protein_id="XP_571349.1"
                     /db_xref="GeneID:3258033"
                     /translation="MSSSSIPAKMRALVVPEPGVNYYTLQEQDTPSPKGTKVLLHIKA
                     SGLCHTDSIVRDGSFGGNWPIIGGHEPAGEVVAVGDNAEEVSVGDRVVALLPKDPCDT
                     CPDCTMGDWKYCKFMKFGGINADGFFSEYALVEAKFCVHIPDSMSFEQAAPLGCAGVT
                     VYAGIKKAQLKPGDVIAISGVGALGYLGVQFAKAIGLKVVAIDTRTEALELVRSLDND
                     HRPDLVIDASKSKADDALNAIHGLRPSGYRGWDGVDASVLTSPAIPSYQYAADLTRSH
                     GTLILLAQPTKVEFQYPTFLARDITLRGSLHGNEVDLKDTVELAYKCNIKSEVKTFTI
                     NQHREMLDAVESDTWKGKAVLVF"
     gene            complement(728566..732502)
                     /locus_tag="CNF02520"
                     /db_xref="GeneID:3258324"
     mRNA            complement(join(728566..728779,728837..729016,
                     729069..729155,729223..729342,729396..730285,
                     730339..730741,730795..731305,731359..731392,
                     731443..731513,731566..731690,731746..731828,
                     731907..732024,732105..732502))
                     /locus_tag="CNF02520"
                     /product="alanine-tRNA ligase, putative"
                     /transcript_id="XM_571590.1"
                     /db_xref="GeneID:3258324"
     CDS             complement(join(728669..728779,728837..729016,
                     729069..729155,729223..729342,729396..730285,
                     730339..730741,730795..731305,731359..731392,
                     731443..731513,731566..731690,731746..731828,
                     731907..732024,732105..732410))
                     /locus_tag="CNF02520"
                     /codon_start=1
                     /product="alanine-tRNA ligase, putative"
                     /protein_id="XP_571590.1"
                     /db_xref="GeneID:3258324"
                     /translation="MLFGSVSTRSITSHFKFAPRLLSKTSFTVSAQSSSKKMGVNDKP
                     TIPTTAPHAWPSPEDWPAAKVRQTFIDYFVNQPGFEHTFWPSSGVVPFDDDTLLFANA
                     GMNQYKPLFLGTADPKSELSKLIRAANSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLG
                     NWSFGDYFKVGALTMAWDLLTRVYGLPKDRLYVTYFEGDAKQGLEPDSEAQQIWRDLG
                     VPESHILPGNAKDNFWEMGATGPCGPCSEIHFDRIGGRDAAHLVNADDPNVLEIWNNV
                     FIQYNREPSGELRTLPAKHVDTGMGFERLVSVLHNVSSNYDTDVFTPIFSKIQELTGA
                     RPYEGKLGDEDKDGIDTAYRVIADHIRTLTIAISDGGIPDKDGRGYVLRRVLRRGVRY
                     ASNKFGVKIGTFFSSLVPTVVESLGPIFPEVTKKIPELTEILNEEEASFARTLNRGEA
                     LFNKYATTAIDEKRTVLSGKDIWRLYDTYGFPVDLTQIMAEERGLKIDQEAFEKARLE
                     SLEASKAGGKEKAGALVKLDVHDLAALEANDAVPKTDDSFKYHLDDIKANVKSIYHGS
                     KFLNSTSELPPNTTFGILLDRTNFYAESGGQEYDTGVIAIDGKAEFKVEDVQVYNGYV
                     LHIGRMEEGDIEIGDEVICTYDELRRWPIRNNHTGTHILNFALREVLGDHIDQKGSLV
                     APTKLRFDFSHGKSIAVPELIKIEGICNDWIKRGVPVYAKDMPLAEAYKIPGLRAVFG
                     EAYPDPVRVVSLGYPLEDIAKNVEDSKWRQTSIEFCGGTHVAKTDDIKDFVIIEESSI
                     AKGIRRIVAVTGHDAHDVSRKGVEFERKLQRIKELQGKEKEVAMKPFLVELGQSGISL
                     IKKNSLKEQFEKIQGELVAAAKAKVAADSKIISEAIKTYFQENPNENVFAGSFDVGGN
                     SKTLTAAVAAGKSASKAVYAFSADPETGKVAHVNYLPKPILESKALDAKIWLNEVAKV
                     IGGKGGGRDDSAAGVGSEISKIDEAIVVAKSVYKKRVEGA"
     gene            complement(732583..736460)
                     /locus_tag="CNF02530"
                     /db_xref="GeneID:3258184"
     mRNA            complement(join(732583..732861,732918..733073,
                     733126..733293,733352..733667,733718..734428,
                     734479..734672,734725..734890,734986..735104,
                     735154..735229,735289..735393,735448..735524,
                     735586..735664,735721..735836,735886..736002,
                     736053..736147,736214..736460))
                     /locus_tag="CNF02530"
                     /product="peroxisomal hydratase-dehydrogenase-epimerase
                     (hde), putative"
                     /transcript_id="XM_571589.2"
                     /db_xref="GeneID:3258184"
     CDS             complement(join(732770..732861,732918..733073,
                     733126..733293,733352..733667,733718..734428,
                     734479..734672,734725..734890,734986..735104,
                     735154..735229,735289..735393,735448..735524,
                     735586..735664,735721..735836,735886..736002,
                     736053..736147,736214..736308))
                     /locus_tag="CNF02530"
                     /codon_start=1
                     /product="peroxisomal hydratase-dehydrogenase-epimerase
                     (hde), putative"
                     /protein_id="XP_571589.1"
                     /db_xref="GeneID:3258184"
                     /translation="MAHQQPIPSADSLNFKDLVVLVTGAGSGIGRTYARFFAARGAKV
                     VINDVSAEAAQAVVDEIAKGGGKAIAAPGSVTDGSTIVAQAVKAFGTVHVLINNAGIL
                     RDKSFKNMSDQDWDLVIAVHLKGAYSCTKACWPLFRQQKFGRVVNTASAAGLYGNMGQ
                     ANYSAAKMGLIGFTRTLAREGAKYDIKVNVIAPMAASAMTETIMPPDMLKGLKPEFIA
                     PFVGILTARNGPDVSGRIFELGAGFFSEVRWERSRGAIWKPDDTFTPSAVAEKWAEAQ
                     DFKGAEHPLNTEDGDMLSSPPVEFKGKTVIITGSGAGLGRAYALMFGKLGANLVINDL
                     SKENAEKVVQEVKAAGGQAVAAVCSAEEGETIVKAAVDAFGTVHVLVANAGILRDKAF
                     VNMDEKMWDQVIQVHMRGTFKIIKAVWPIFQKQKYGRIITTASPNGIYGTVGQANYST
                     AKAGIIGLTRTLAIEGSRYGIQVNCIAPRAATAMTATVWPKELMEIFKPETVAPVVGY
                     LAAEGCADTGTFYEVFGGYVAQMRWQRTYGAVFPNDKDISPEDILSKWKEIVTFDDRA
                     TNPSSGVEALQQIVENFNNTSSIVHDEVSYEDPDDTEDIKAAKRQEVDPHEYNFSERD
                     VILYNLGLGAKVDELQWVYENSDGFSAIPTFGVIPQFGASHGVDMGNFVPNFNPAKLL
                     HGEQYLKIKAPIPTSGTLVSHARLLEVLDKGKAAAVTFIIDTKDKKTGESIFENQSTV
                     ILRGSGGFGGKKNGKDRGAATALNVPPKRKPDAVMEEKTTLDQAAIYRLSGDYNPLHI
                     DPDFASMGGFPKPILHGLCSMGIAGKHVLKTFGSYSDIKVRFAGTVIPGETLVTEMWK
                     EGNKVIFSAKVKERDAPALSNAAVTLIGAEGAVKAKL"
     gene            complement(736833..738730)
                     /locus_tag="CNF02540"
                     /db_xref="GeneID:3258285"
     mRNA            complement(join(736833..737857,737908..738116,
                     738175..738582,738636..738730))
                     /locus_tag="CNF02540"
                     /product="GTPase inhibitor, putative"
                     /transcript_id="XM_024657403.1"
                     /db_xref="GeneID:3258285"
     CDS             complement(join(737640..737857,737908..738116,
                     738175..738582,738636..738712))
                     /locus_tag="CNF02540"
                     /codon_start=1
                     /product="GTPase inhibitor, putative"
                     /protein_id="XP_024513108.1"
                     /db_xref="GeneID:3258285"
                     /translation="MILATSTLPSLTFYRKMVNPDEDTEFNDALRRHGILPPKPPSRS
                     PSPDIPHITHTDAVRAVAATADADQLVTLIEGDNLDSDDERMFEEYKRKRLHEMKKEE
                     KKGRFGSMEPLAREDFVREVTEGSKVDPNGEQIEDQGDDDEESSPRLKGTGVVVFLFK
                     DSVPLSQHLQPLLNQAAAAHPSTKFLSIPAGLCIPNYPDKNVPTLLIYRNGEMVGNVV
                     AGMGLKGMKTTVRDLEGLLLYFKAVEKPSAALLRSNGANEHSDSDDDFNDDIGTVNTR
                     GGGLRTGGVGIGAGRGKEDSDDSDFDM"
     gene            738808..741219
                     /locus_tag="CNF02550"
                     /db_xref="GeneID:3258135"
     mRNA            join(738808..738962,739021..739058,739117..739650,
                     739705..739783,739830..740376,740430..741219)
                     /locus_tag="CNF02550"
                     /product="expressed protein"
                     /transcript_id="XM_024657404.1"
                     /db_xref="GeneID:3258135"
     CDS             join(738863..738962,739021..739058,739117..739650,
                     739705..739783,739830..740376,740430..740802)
                     /locus_tag="CNF02550"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513099.1"
                     /db_xref="GeneID:3258135"
                     /translation="MPSESTKDWDKLLAWLEEKHAGFETSLSLRDVPGVVRGLVVTEP
                     AKERSTLLHIPSSAMLNPLTMFAADAASRPPSKGPVYSIPRHLYPRPTHITSSTNSSK
                     RIKTSAASPTTVSTASGESNSHYRQLDTTELLTLHLALSKDPQKRYFSDWQVYLETLP
                     NEFRPWHPLTWVIKPELGAKSPGAADWDWWNTLYEKHISPTMKAKIQDVKRRYEADAA
                     LVLDVLRQEEPFKTHCMSTVLTQEDLLWAWLNVNTRSISIPLGLPGPSERMNHTLVPI
                     LDMINHSSDSSLNAPRVRQMSTPSPAPRSRSAARRTHRQTPSNDWNSQNPTGYSRNGL
                     HLVPGKIDLRLIAPDREMQKGEEVLFEYGGHSNATLFAEYGFCEVPEGVEDDKWLRLK
                     NGELDVGWIVDELWEEKVKSNGNEEDAAEKQKVLEAIACWGQNTIHTCPGPPHPSHSL
                     LMSLRVLHLPADSPKLPGIQQGYSTYISPPNELATITSLEDICQRVIKESNKRWKALK
                     RLHKDIKVGSEREEGKRTVIDMLMGMCVEDKIIAGKVLERIDAGEDFS"
     gene            complement(740907..743330)
                     /locus_tag="CNF02560"
                     /db_xref="GeneID:3258151"
     mRNA            complement(join(740907..741218,741272..741409,
                     741465..741499,741553..741725,741792..741899,
                     741959..741969,742029..742391,742452..742552,
                     742606..742687,742756..742901,742960..743330))
                     /locus_tag="CNF02560"
                     /product="multidrug resistance protein fnx1, putative"
                     /transcript_id="XM_571586.1"
                     /db_xref="GeneID:3258151"
     CDS             complement(join(740940..741218,741272..741409,
                     741465..741499,741553..741725,741792..741899,
                     741959..741969,742029..742391,742452..742552,
                     742606..742687,742756..742901,742960..743260))
                     /locus_tag="CNF02560"
                     /codon_start=1
                     /product="multidrug resistance protein fnx1, putative"
                     /protein_id="XP_571586.1"
                     /db_xref="GeneID:3258151"
                     /translation="MSAIVITTASYPSERTPLLRSGSYSSDSDSPNEPVRSAPLKDSI
                     SLSRFVVVCIGIWSANFVFAFQSTAIPTLAPEIGSWFEHGELSAYLGSMFTLSNTAVI
                     PLYGVLIETLGRKFAMVTACLFFGTGTIMCALAGNMYSLIGARTFAGLGGGGLLTVSS
                     VIVTDLVPLRDRGYYQGLMMTIFGSGSMLGGPVAGWLTDRFGWHWSFWIQLPVVVFCG
                     VIVSVFLPTPPIPPTHKSLLSGLASLDWLGTAFLIGSVTTLIFGFSFHTSYLEPWSSP
                     MVWGTLLASVLSAAAFVLVEMKVKHPLVPLRVFKSNHISAVMLSGFFLSVSNQAFMYQ
                     IPVYFAVIVNTSTAQAGLIMSLCSGLGLAVGSLVAGQYIRSGYPWKWVGPISLLPPVV
                     GALVAATWKPILPWWSYYVTVFPCILGYSTFLCVQLVALVSSVDSKLMPKATALLYTT
                     RSLGATLGVSVGGSVQLGALASQLKVSFEGLEARDQIINSILHSKAAIRLLVPRLQSL
                     ALSAYARSLSTVWIFSAGIAVLTVVSSLFIEAKEVHKEERRVIKGTGGGISEGGPFAE
                     GIGPATIEGERQ"
     gene            743540..745540
                     /locus_tag="CNF02570"
                     /db_xref="GeneID:3258223"
     mRNA            join(743540..743904,743957..744186,744241..744913,
                     744999..745540)
                     /locus_tag="CNF02570"
                     /product="expressed protein"
                     /transcript_id="XM_024657405.1"
                     /db_xref="GeneID:3258223"
     CDS             join(743731..743904,743957..744186,744241..744904)
                     /locus_tag="CNF02570"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513101.1"
                     /db_xref="GeneID:3258223"
                     /translation="MAIPSPRGPSDKENGHDGVANGCKTNRARFQDMPYDVTKVIIEH
                     TNPGDRYNLLFTCKSIAMVAGEMLCEGRMVAWKSHYGLSTSQHRAVGIQELFAGIENT
                     HCTKEKPFGRDLKLRFLRFITYLNLENYSKAKFDEGAVLLIIKALRELRDTGIEPFPN
                     LLSIELGASPLSPPRAPELQREFDLTLVSLCRPKQIIVKSGYGFLELRSDNVPYCDLK
                     FAGGHLPMEVLHQPFSFHIIPMVCYGTRNRVNPPRTVTDSIEKSVEYVLRVLHQVHPE
                     LNDVKRKHYSEDQLEKRDKTTWTFSWELSRMNGLPWAHHDVSKVRDAVLEELPQMRDR
                     ICFLPRKSLTSGWAQIINCGQ"
     gene            745663..746859
                     /locus_tag="CNF02580"
                     /db_xref="GeneID:3258035"
     mRNA            join(745663..745892,745943..746149,746206..746859)
                     /locus_tag="CNF02580"
                     /product="expressed protein"
                     /transcript_id="XM_571572.2"
                     /db_xref="GeneID:3258035"
     CDS             join(745810..745892,745943..746149,746206..746581)
                     /locus_tag="CNF02580"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571572.1"
                     /db_xref="GeneID:3258035"
                     /translation="MSSHSENTDWEMSVVDDPLEEATNLESTFYSEGYDSGHAHGRLH
                     GLFEGRELGKEKAWELWEEVGYYEGWAEMWIELLGTKVALATEGRSRKGKEARTLGHA
                     QTLLELIKTFPITNPTPSDGSDAVPQSAATGEDISSPSSVSANDLGSLLSLIRARYRL
                     LCASLSVRPRLASAVIVEANPGSGAAAAASSGIVDDGQSAEGVVQGIEGPMKGVDTRQ
                     LRF"
     gene            complement(746827..748105)
                     /locus_tag="CNF02590"
                     /db_xref="GeneID:3258045"
     mRNA            complement(join(746827..747049,747104..747219,
                     747275..747386,747459..747539,747599..747835,
                     747882..747938,747987..748105))
                     /locus_tag="CNF02590"
                     /product="HSPC177, putative"
                     /transcript_id="XM_571584.2"
                     /db_xref="GeneID:3258045"
     CDS             complement(join(747014..747049,747104..747219,
                     747275..747386,747459..747539,747599..747835,
                     747882..747938,747987..747995))
                     /locus_tag="CNF02590"
                     /codon_start=1
                     /product="HSPC177, putative"
                     /protein_id="XP_571584.1"
                     /db_xref="GeneID:3258045"
                     /translation="MNRIFGTGKAKPKPSLTDAISSTDSRVASLEVKLKKLDAELSVF
                     KTQMSKMREGPGKAAVQQRALRVLKQKRMYESQLGQLQQQTYNMEQAAMTTENLKNTM
                     ATVDAMRVANKEMKKQYKGIDIDKIESIHYDMEDLIEQANDIQESLGRSYGVPDEVDE
                     TDLQAELDALGLDDEPIGENETPSYLQDAQSLPDFVDSAPLEELQSEQPTAEVAR"
     gene            748294..749314
                     /locus_tag="CNF02600"
                     /db_xref="GeneID:3258072"
     mRNA            join(748294..748461,748531..748614,748672..748712,
                     748774..749103,749156..749314)
                     /locus_tag="CNF02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657406.1"
                     /db_xref="GeneID:3258072"
     CDS             join(748380..748461,748531..748614,748672..748712,
                     748774..749103,749156..749251)
                     /locus_tag="CNF02600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513036.1"
                     /db_xref="GeneID:3258072"
                     /translation="MITMSSSVPEFLLLSATLLDALPSSSPIDDTLLLQLHIVFGPML
                     MSALQLIDRREVVRVILPTGRHVYQVASSAGKSYTLYINTPDSSIHEKTSLVNEPEPG
                     EASENVQLNQLPSDPFAVSSDISGWQRDQSKRSEISISESEESRRRRIHASGKELQRM
                     YCPCAGFSYNSLSGGQNVLCKHLLAVVIARKTSTWVEGSVGMEGVAAIVT"
     gene            749332..751510
                     /locus_tag="CNF02610"
                     /db_xref="GeneID:3258344"
     mRNA            join(749332..749475,749577..750142,750195..751510)
                     /locus_tag="CNF02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_571353.2"
                     /db_xref="GeneID:3258344"
     CDS             join(749620..750142,750195..751273)
                     /locus_tag="CNF02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571353.1"
                     /db_xref="GeneID:3258344"
                     /translation="MPSDPDPSPALTHASLASSHSLQSEDFHVHLPSHLNYDRTLTTA
                     LSHLVDHLVEPLSTSYTPDVLNSLLKQLKQALFVKFQPTWDEGHPQVGSGTRSLICTK
                     YYGLPPSMRSAAVKVGVEEQAWRKAIAKSGGREDSSDKGDEWEVWCDPGQVVWRWGAW
                     EWEDPGFEPVKLVREPLQVIWQAATEADKLSPATPAKFAQPSNATPNRPSYAIPIRAP
                     TVLAIPPTPSQGENRQNEAKPIELDHLLPAFSNLGLGQAPGQTQRNQQASGWSSSDAS
                     SRSTSLAISDHDEPGSPEHERPASRVSHRGSESQSSVSSSTSDSNSGHTQLLTPATRP
                     TTADPFNVPMLSTETIKDGKEKEEKPKTTPTNTTRGRTTSPSALGESTVQPTTPTTEN
                     NITPRVPTPTVTPYDGGNVTVLGGGVKLGGAGSHSRTSSTHSSHRISIDRSRSPSISL
                     ASRALNTAMGPNGEGRKQRTRRRIMPTYLGHLGQPGVGGPAMGVFYGGSVSPGGMGFA
                     PGYQHVGVGVSPPPVGIRGPMPRMG"
     gene            complement(751516..756133)
                     /locus_tag="CNF02620"
                     /db_xref="GeneID:3258134"
     mRNA            complement(join(751516..751848,751912..752033,
                     752098..752236,752287..752574,752628..752765,
                     752843..752906,752956..753177,753244..753377,
                     753433..753665,753724..753882,753935..754385,
                     754442..755020,755063..755197,755244..755789,
                     755845..756007,756054..756133))
                     /locus_tag="CNF02620"
                     /product="Pol II transcription elongation factor,
                     putative"
                     /transcript_id="XM_024657407.1"
                     /db_xref="GeneID:3258134"
     CDS             complement(join(751583..751848,751912..752033,
                     752098..752236,752287..752574,752628..752765,
                     752843..752906,752956..753177,753244..753377,
                     753433..753665,753724..753882,753935..754385,
                     754442..755020,755063..755197,755244..755789,
                     755845..755917))
                     /locus_tag="CNF02620"
                     /codon_start=1
                     /product="Pol II transcription elongation factor,
                     putative"
                     /protein_id="XP_024513037.1"
                     /db_xref="GeneID:3258134"
                     /translation="MLVCMTRNFDVIHEEPLRSEDFGQDKFINVGWGSRSTQFHGSLG
                     KSAARQPADPARPVAHPTDHGLPVISFRGDAAFFAVSSLDPYPDGSGQARRQVRIYAR
                     DASSGFQPKLSATSESLPGLEPALAWRPSGNLISTMVRYGYHGGGEGREGRWDVAMLE
                     RNGLRHGGFELREDKGDWEDGTVRGLGWNSDSEILAVWIERKERDVLQLWSMKNYHYY
                     LKQELYSHDTQKPRFRGFKWHPEDPLSLYIICQDSIQHRTFTWDTFAARLPMPHDTAS
                     VAVIDGTRLLLTPFRTQNTPPPMSSYHLALPSTPVHACLSSWEDTAAAVFANGHVMVW
                     KLNTRLPSPAPGSKLKRGGQVAEPVIVLEKKVDGKRVIRNLALGPRGRVAVLSLAVDA
                     DGPAEQSGRVNVFGGGEGEQDEEFEVESGVESILWTDQGNVLVLNGQKRLYSLASEEP
                     IDLTLPSQPTSVLLSGHLLFTLSPTSKLHMTALTPFAAHPTSLSLSQQPVTSFTLTSS
                     FLIYTTTAHFAHFAPLVTLERLANGDDGAGGSGSEMKWEERRVERGAKIVVASESEMS
                     LVLQATRGNLETVYPRPMVLQVVKRDVLAGAYRAAFLTCRKHRLDLNLLYDLDPEKFM
                     ANLETFVENVHEVDYLNLFISSLNSEDSAKAVYGDQARDQARDTPPTIPAAKDKVNTI
                     CDSLRILLEARGLETYVESILTTHVCKIPADYESGLRVLLQLQADHPEIVEDAIKYII
                     FLSDVNKLYDVALGMYNFQLVLMIAQYSQKDPKEYLPFLRELRALGKWDQRFKIDDHL
                     ERRESALANLKQAGPERFEDAASYLAKYELYDTAFKLYNDDQEKLTVIRDLYGDYLYD
                     RREYTDSALSYLIANKPQKALKAYERAHAWRELFALAKKEGLSKQSLDEMIERVTDYL
                     GSRGRHLEASQIFIEYSSDVDSAVDTCCRGAEFSEAYRLTSIHDRSDLVEAMIHPGLE
                     EAHEALIEVFEEMDGQLDKETRRLKELNEIREKDYDAFYIVEREIDIEGVDVATNATT
                     VASAFTRYTVAPSTMFSQTTRMTGQTAKSKRGKKRATGRRGTVDEWEYLVMSIGRLLA
                     RVDEKSAEALILLRHLLLASSDHVALAQSLQNTIISFRTKLSNALDEAWQDRDAVLKE
                     VVESGGSGLEGALEKSLGEIKPQVGEWKGMGLLLSN"
     gene            756420..757335
                     /locus_tag="CNF02630"
                     /db_xref="GeneID:3258147"
     mRNA            join(756420..756642,756681..757033,757086..757335)
                     /locus_tag="CNF02630"
                     /product="6,7-dimethyl-8-ribityllumazine synthase,
                     putative"
                     /transcript_id="XM_571357.2"
                     /db_xref="GeneID:3258147"
     CDS             join(756428..756642,756681..757033,757086..757162)
                     /locus_tag="CNF02630"
                     /codon_start=1
                     /product="6,7-dimethyl-8-ribityllumazine synthase,
                     putative"
                     /protein_id="XP_571357.1"
                     /db_xref="GeneID:3258147"
                     /translation="MLNTVKGLPAAPTAYDGSGLRIAIVHARWNDTIIHALLAGARAT
                     LRQQGVRDENIVVKTVAGSYELPLACKKLIEAGKTQSANAAPSMLASSTNLLSLIDGA
                     SQPQAAGQPQTAPPAASTAPFDAVIAIGCLIKGSTMHFEYICEAVSQGLMNVQLQTGT
                     PVVFGVLTVLNDEQALLRAGIGSGEDKGHNHGEDWGLAAVELAAQYKEWEKGFL"
     gene            757426..758347
                     /locus_tag="CNF02640"
                     /db_xref="GeneID:3258499"
     mRNA            join(757426..757477,757528..757611,757672..757728,
                     757800..757865,757921..758347)
                     /locus_tag="CNF02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657408.1"
                     /db_xref="GeneID:3258499"
     CDS             join(757472..757477,757528..757611,757672..757728,
                     757800..757865,757921..758241)
                     /locus_tag="CNF02640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513039.1"
                     /db_xref="GeneID:3258499"
                     /translation="MVKLRVLISMELDGVTNVQPADDYYEYFFTVMCGSCREVHSKTV
                     SLNQKDEHEISGSKGTASFVWRCSNCKKEHSANFLPSAPPPSKSKSTAPIPYTSSSSG
                     QFSPFIALDCRGLEFTEFHFAGKWKAEGEESGAVFDIDWDQLRKEQGGEERWDDYDEQ
                     GGVPLAVSELKSKIERV"
     gene            complement(757931..759550)
                     /locus_tag="CNF02650"
                     /db_xref="GeneID:3258112"
     mRNA            complement(join(757931..758400,758455..758584,
                     758649..758774,758841..758951,759021..759112,
                     759217..759426,759473..759550))
                     /locus_tag="CNF02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657409.1"
                     /db_xref="GeneID:3258112"
     CDS             complement(join(758369..758400,758455..758584,
                     758649..758774,758841..758951,759021..759112,
                     759217..759426,759473..759494))
                     /locus_tag="CNF02650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513113.1"
                     /db_xref="GeneID:3258112"
                     /translation="MSAYPQDTYFNSNPYQQQPYAYQPPPQPQPQQPPYQQQPYQQQA
                     YQYNAQQPYQTTDPYAYQQSPPQSSTVPPQSPPVQVTHSPFIRTDSSQAVSFTDMARM
                     AGRPQTFDEMYSVPESFLEIEIRNPMTHGIGRKMYTDYEIVCMTNIPAFKLRHSAVRR
                     RYSDFEAFRDILERESTRVNIPPLPGKVFTNRFSDEVIEQRREGLQRFLEIVAGHPLL
                     QTGSKVLCAFLQDPAWDKSQWI"
     gene            759683..762608
                     /locus_tag="CNF02660"
                     /db_xref="GeneID:3258101"
     mRNA            join(759683..759779,759834..759864,759924..760073,
                     760130..760403,760464..760652,760708..761581,
                     761652..761986,762043..762170,762234..762608)
                     /locus_tag="CNF02660"
                     /product="ubiquitin carboxyl-terminal hydrolase 14,
                     putative"
                     /transcript_id="XM_571361.2"
                     /db_xref="GeneID:3258101"
     CDS             join(759709..759779,759834..759864,759924..760073,
                     760130..760403,760464..760652,760708..761581,
                     761652..761986,762043..762170,762234..762572)
                     /locus_tag="CNF02660"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 14,
                     putative"
                     /protein_id="XP_571361.1"
                     /db_xref="GeneID:3258101"
                     /translation="MSCTHLQPSLHSLKPPSPSQQVHREECTLCFDGQDDPRGVVVCL
                     SCFNGACLSPDRQHAHLHYQRTGHPLGMVIKRSRKEIRKRDSSEPPMKKLAISAPKDE
                     EIWDYHTAFVCLACSSAGQEITAQEPKLEEMKTGIMTALSSAQQSEIKAWEEEILPCE
                     HTLTLQQESVVVPGNVPSQCSSCDLTCNLWLCLTCGLANCGRQQFGGIGGNGHALKHF
                     HETGHMLGVKLGTITPEGTADIYCYACDDAKIDPELATHLSTFGIEVMSQTKTEKSMT
                     ELQLEHNLKFDFSMVGDDGKELEPVFGKGLTGLRNLGNSCYMASVLQTLFSLPAFRSR
                     YTTPEAFNHFQTCPNLLPASCIECQMLKLGDGLLSGRYSHVARLPPPTTHFEEQEAPK
                     FQQGIKPTQFKALIGRGHEEFSTMRQQDSEEFLQHLLTRLRDEAKRQGRDEAAEPTEI
                     LKFAMEQRLQCGKCKRVGLQVEGVDLASLPVEAVEAGVSEDGKKLYEGVELETCLEQL
                     CAEEAVAEYQCDHCKEKTTAYKSTKFKTFPDLLVLHMKKFQLVNWLPTKLDIPVSVPD
                     MLTLDHLVAHGLQPGEEELTVSSSSPSLPEFNATAMAQLEAMGFPTVRCQKALLATGN
                     SDAEIAMGWLFEHMEDPDIDAPIELGGSKAASNEPSQEQIGMIADMGFSHNQARKALR
                     ESDGNPERAIEWLFSNPGDPGEDAAPAGSAEPSIGGSSSLPAKYRLKAFISHKGPSVH
                     SGHYVATIRQPQAGIEGEREEEGEWVLYNDEKVVRAASGGGEEMRGLAYLYVYERV"
     gene            762691..764390
                     /locus_tag="CNF02670"
                     /db_xref="GeneID:3258366"
     mRNA            join(762691..763406,763466..763706,763755..764390)
                     /locus_tag="CNF02670"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657410.1"
                     /db_xref="GeneID:3258366"
     CDS             join(762737..763406,763466..763706,763755..764301)
                     /locus_tag="CNF02670"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513102.1"
                     /db_xref="GeneID:3258366"
                     /translation="MPGMPPAAPSSPTASAKHKSSYAAAATTSATSTGPVLSYHAHPL
                     NPRSSITISREGSPSPRTSTSALHRPTFVHATTSYAVAAAAGSSAAGSSSASGHGSRG
                     ESRGGSAKPYNEDEGYRKEVSAYYPPEFPHSHGPYPYPHHQYTPFSQPDRLDAETSVL
                     DRLRTAVKKMFGGNDNRESKLACLQCSNSEEGGELGRAMMFGWVITTVGFFLAIAFWR
                     GELFRALDKLSHYLAEQGIYGHLTFYVLIFITTIPPLPLYSTFIILSGYTFGVWQGFV
                     VSYLASLSGAIVVFLVSRKMLRDTIVKSLASSSISMSLLHILPTHPHLLLLIRIAPYP
                     YNLLNVILASSPTLTLQTYVGCTAVSLCKLVLHTWIGSGIHDLSESYGHSQSKGQEGS
                     KEGDGADGQWPQDPNGVTGQPAQEGDTQAAKTWTTWAGIVLCIALFFYLMHFAKRAIK
                     KAQAEQAEMEEREREEREGLTAVSARRESEREEMV"
     gene            764459..766944
                     /locus_tag="CNF02680"
                     /db_xref="GeneID:3258427"
     mRNA            join(764459..766068,766124..766799,766859..766944)
                     /locus_tag="CNF02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657411.1"
                     /db_xref="GeneID:3258427"
     CDS             join(764521..766068,766124..766654)
                     /locus_tag="CNF02680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513103.1"
                     /db_xref="GeneID:3258427"
                     /translation="MSIVHPVHSPTSTSGQLPLHPYPSFPAQQPYSSLPPSSPMNPPD
                     PQLSPTASTSRLSPGKGQSRSAPVSPGGRLALYGIAPLSSISPIHLAQQPENMRQWAS
                     SSTHSPPLDSASFRETDSSHTATGANGNGSKQKPRPRRLAHLRRSSIPSSSATGSANI
                     GETSSGGYLSEEGFDSDATVRPAGSKYKRSLSQPDLTTLYEGRAKGLEAKEGMGRKDV
                     KGWVGEVGRGHVAPPAVPQQMGHQQRQQERRRPSFGRTRSSGEAFGKRPGVSDDSWLP
                     AAPSRSPHSRSQSSLYGMRKSPSPRSQTLSIPTMSPINPPTVPLPDQSPKVHRHSLAV
                     VSSLEGNMSSEGDDSSESGESLTFAPKRTKSLPLGSELRQRLQDPRLSISKGSSSSRS
                     DDGGLGLLLGSPSSVPNTTSTSAGSLSGLETTPKTVPQPLPNELERMIRRSSLLYLRL
                     LAIVPAVWGICVLAQALATGGLWVDVWPYGVDLSKEALERLVAGGVMMEGEWIRVDRG
                     DMLLCIAWAICTGHFCFCLTTGLTHRWLSYYSLPSTITRLASLQCLCWPATYLTLWVL
                     GARNARPLLAWVVIGVTTGWSRTVQMWVTSNVVPADLVSPLVATNLIITPTASNPGVM
                     AARRGSKQTTMLLGPPPDHLRQWEKFVWGRKWDWDAVANEVGWKVGGLLLVTAAWLFW
                     GIECGSVIRG"
     gene            complement(766312..767909)
                     /locus_tag="CNF02690"
                     /db_xref="GeneID:3258049"
     mRNA            complement(join(766312..766674,766748..767684,
                     767735..767909))
                     /locus_tag="CNF02690"
                     /product="expressed protein"
                     /transcript_id="XM_571605.2"
                     /db_xref="GeneID:3258049"
     CDS             complement(join(766893..767684,767735..767878))
                     /locus_tag="CNF02690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571605.1"
                     /db_xref="GeneID:3258049"
                     /translation="MRPIAVPTPYRIPRRPAQSILRRFHHPESPNPPDPANLLRQVMR
                     NVAQPVAVAVASVPPTSPLAPLAKYHGATLTSFTSLTLHPRPLVAFSLRLPSRMADCL
                     RPWRTGGSIEEPDAHVEPQTTVQASNTLRLPPKSELPWPLSTLPMPEDPPPWAQSLVS
                     RIPNPLAPPADPIISSSASKLPPASSPATLIPPTPLTISLLSPCNEAIADALSQPRTD
                     HSSIFALPNTWEESPTTSTDEAPHPPALLGCVGSLQCQVVGSVMLKDLCLPGEVQEGE
                     GSEMFICRVVAVKMGDMDEPLLHWRRRYAGVKEFD"
     gene            768008..769759
                     /locus_tag="CNF02700"
                     /db_xref="GeneID:3258312"
     mRNA            join(768008..769043,769104..769759)
                     /locus_tag="CNF02700"
                     /product="negative regulation of transcription by
                     glucose-related protein, putative"
                     /transcript_id="XM_024657412.1"
                     /db_xref="GeneID:3258312"
     CDS             768080..768907
                     /locus_tag="CNF02700"
                     /codon_start=1
                     /product="negative regulation of transcription by
                     glucose-related protein, putative"
                     /protein_id="XP_024513122.1"
                     /db_xref="GeneID:3258312"
                     /translation="MRKGAGISGLARHTATASSYSTLSSNITASQLSNLASSLQSFRT
                     ALINFASAHRADIRKDPAFRHQFQKMCSAIGVDPLAVGPGAGGGGRGWWSEVLGIGEW
                     EYELAVQVVDICVSTRPENGGIIEMGDLIRRVERLRSGGISSLRSIPSSNQPSTYTNP
                     EDVGQITSQDILRTLKLLRPLNAGYTLHRPSPSTTYIRTIPRSLDTDQSTLLAIAATT
                     RGRLRPAIVREQTGWTEVRVRTAMEDCVMREGLGWVDEQAGEYNEVWIIAATGFATG"
     gene            complement(769396..774873)
                     /locus_tag="CNF02710"
                     /db_xref="GeneID:3258202"
     mRNA            complement(join(769396..770397,770457..770663,
                     770716..770844,770900..771532,771588..772080,
                     772133..772623,772683..773097,773145..773281,
                     773357..773449,773520..773670,773809..774873))
                     /locus_tag="CNF02710"
                     /product="Rho GTPase activator, putative"
                     /transcript_id="XM_024657413.1"
                     /db_xref="GeneID:3258202"
     CDS             complement(join(769823..770397,770457..770663,
                     770716..770844,770900..771532,771588..772080,
                     772133..772623,772683..773097,773145..773281,
                     773357..773449,773520..773670,773809..774675))
                     /locus_tag="CNF02710"
                     /codon_start=1
                     /product="Rho GTPase activator, putative"
                     /protein_id="XP_024513112.1"
                     /db_xref="GeneID:3258202"
                     /translation="MSSPTYPKSTVPPPGAWPSRPSLDASTPRRSIDQRQGPFLHLSQ
                     PNSSAHHADSSESSRRNSMASGSIHNSPSSLGSSSKNLGRFDEHAPLQTAGEMPTRGE
                     PGFVGSARLPWITTSAMDSESGPRSAPVASGRLRSSGAGSAPLRSSSSPDPWMNQTSQ
                     RSSPSNSPIDHRPNFTAGHGQVYFQGNLVPPYLHGQERRPSPASSLTGGRPLPPRKAS
                     DQSTSSQTPSTATVHSDNIGMIDGQPLLQWPQPRTRKDGGGTTCGQCGQTVHGQFVRA
                     MGQVYHLNCFRCKDCNKVVAQKFFPVEDGDGMYPLCERDYFARLDLICAKCDQALRAS
                     YITACGAKYHVEHFTCSECDVLFGPNDSYYEHDGRVYCHYHYSTRFAVKCVGCETAIL
                     KQFVEMNRNGRNECWHPECYMISKFWNVRLASKTFNTPASSAVASTISLLEMSSITAP
                     GAPVTSASQLIQMPFDSPNPDSHIAPAELKERQKVMEMKVQQIWHVLSGYEESSAALI
                     GDMLRAVNERNLLDIILLAERFILHVETLFAVIDDIEAQFAMAGAKCIPHAREAKQLC
                     RKLVNLFSNMSQISPAGGPSPSSNELFTLITQLAHYLKILIRIALTGSIKLEREYNNQ
                     TAMTNCLARLNLLAMDSGDPNIKKRGDWPDVNPQNGNGMQSQNGHGEGFSVEEGEGGV
                     QGDEEQLKKSMDALTRRPTGYLSSTRDIAYGYRSLAPEVTGETTLRGPQDEDFIPLEG
                     CAQCGAPIEEDCVRLGMFLRWHCACIACNVCGETALQSVKDDTTDEGSSHSHTDTGSN
                     SGIVSRQNSARNMPAKVDYFWFAPEHFPGMVKPPEKIWCGIHKNPNGSWKGFQGVSRL
                     EQYAFLLHIALRRLYVHFRLHHSLQSVRDHGMSGRAESEVKRMKSVTLDRKLSSTARL
                     PQRSMVVESPAGRMADGNGQIISARNAESPTPTPTPKEPQTEIIITTEDASNNATTVN
                     VLRPPFARNNTSVKIIKENSEESPQRGFRRVSAPKEDDAITLGDISLLADKDRRSDNR
                     PLLSNLSPLQSIILRHFALLQLQKTSLGPLIDLDDMLDLLDARKGQWWNKIFKGNAKK
                     DTKKKGLFGVPIEVLVERTGSDSSFGVPNSQVRVPEFIEDIISTMRQMDMAVEGVFRK
                     NGNIRKLQTLVEALDKDSTAVNLSEENVIQLAALLKRFLRELPDPLLTFRLHKLFCAA
                     ATLPNLEERSRCLHLLVSLLPKYNRDTMEVLFIFLKWVSSFSYREEETGSKMDLANLA
                     TVICPSILYAKGSNAVKDDSFTAIAAVQELLENQDEYYRVPSELLFVIQEGIYQIFAK
                     DLDLPPKEIFRHCSKYTQARSAAQPQQQRLGIPHSNSSSQISQTSVSRSVESATRISQ
                     VSITAPDSTSGNYRPPLP"
     STS             771070..771897
                     /standard_name="Pst2"
                     /db_xref="UniSTS:470841"
     gene            775059..776536
                     /locus_tag="CNF02715"
                     /db_xref="GeneID:36392908"
     mRNA            join(775059..775193,775254..775357,775409..775431,
                     775495..775759,775814..775895,775944..776065,
                     776117..776197,776247..776536)
                     /locus_tag="CNF02715"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658577.1"
                     /db_xref="GeneID:36392908"
     CDS             join(775114..775193,775254..775357,775409..775431,
                     775495..775759,775814..775895,775944..776065,
                     776117..776197,776247..776329)
                     /locus_tag="CNF02715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514504.1"
                     /db_xref="GeneID:36392908"
                     /translation="MPEPLPVPVDLIGQSGLYNVPDPLLRRLRLEDAQGLPIKNLDKY
                     FAEKEVLVLYAGSEYGENNLRAFHRELTSFAQCYKSAAVIYVSVDTDAQAPLRVLQGK
                     PWLRMTFNDNSDFATIGKDKGQEVEMEEVARGEDFVQAGEMEIGMENVVFGVEEYQNE
                     YVRPLSRAAVTHIMRVFSTPSVAVYHLPSHTLIARNLKPSAFNPSGIDKTYDTWRKGG
                     NPSLRFIDVVRALKLPLIGLLFALIYQIAIIFGGDQYHVIPRIMDGIAWNQNMRFPSG
                     IQG"
     gene            complement(776458..777394)
                     /locus_tag="CNF02720"
                     /db_xref="GeneID:3258176"
     mRNA            complement(join(776458..776572,776622..776781,
                     776834..777063,777114..777188,777239..777253,
                     777304..777394))
                     /locus_tag="CNF02720"
                     /product="actin lateral binding protein, putative"
                     /transcript_id="XM_571601.2"
                     /db_xref="GeneID:3258176"
     CDS             complement(join(776570..776572,776622..776781,
                     776834..777063,777114..777188,777239..777253,
                     777304..777306))
                     /locus_tag="CNF02720"
                     /codon_start=1
                     /product="actin lateral binding protein, putative"
                     /protein_id="XP_571601.1"
                     /db_xref="GeneID:3258176"
                     /translation="MDKIKERFAILGQKIEAAEARAEAAESENKKLNQTLLERDQELA
                     SLQHKLQLAEEELEASESKVKELKAASDEGETHRTTGENLARKVQLLEEELDKAEKDL
                     KETTEKLRQVDVKAEHFERQVQRLEQERDEWERKHGEAVEKYQQSKRELDEVVMQMES
                     L"
     gene            778246..779665
                     /locus_tag="CNF02730"
                     /db_xref="GeneID:3258497"
     mRNA            join(778246..778350,778406..778464,778517..778716,
                     778784..779143,779204..779665)
                     /locus_tag="CNF02730"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_571578.2"
                     /db_xref="GeneID:3258497"
     CDS             join(778292..778350,778406..778464,778517..778716,
                     778784..779143,779204..779635)
                     /locus_tag="CNF02730"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_571578.1"
                     /db_xref="GeneID:3258497"
                     /translation="MRLSFALILVFLSFLTAVCAWTKEDYEIFDLVSDLEAAEGKGTT
                     FYSHLNVDPGATTQQITKAYRKKSLELHPDKNIGVKDIEKRFARLGVIAQILRSPEQR
                     ERYNFFYKNGVPRWRGTGYYYNRFRPTLFHTLLFLILLTNLFHRLVLSLNYNKHLRRI
                     AYFENAAKSAAGVLGPGGVSAQNEKIVLNTNVTQPGRRRKVKVPMVEGNESVGTLELI
                     VSGNEVYLPHEGGALTPISSLARPPSFAQTWFPSLILSSARRLAANLPSNIQSSLPAV
                     LRSLDEEMVVVESSSEEDGEEGSALDTPTQVRNTSRKALQKGRNSRSVSKDSPAVSEL
                     ESDADFLERTSNGKKKKPGPGKASAMRKRKMALKK"
     gene            complement(779654..783109)
                     /locus_tag="CNF02735"
                     /db_xref="GeneID:36392909"
     mRNA            complement(join(779654..781302,781353..782259,
                     782314..782670,782728..782758,782822..782900,
                     782963..783109))
                     /locus_tag="CNF02735"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658578.1"
                     /db_xref="GeneID:36392909"
     CDS             complement(join(779817..781302,781353..782259,
                     782314..782670,782728..782758,782822..782900,
                     782963..782985))
                     /locus_tag="CNF02735"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514505.1"
                     /db_xref="GeneID:36392909"
                     /translation="MSDDILRNCAALTALKRHQLVSLSKKYGLKASGKNVDMIDRLQK
                     YGQKHAGNLDFYIPDPVPTPVQDLTIFSSVPATNQRKLEDEMPDLRTPVPLSSPSSLS
                     HEPSDRSLISRASDSWEVLSESAASIVSKMEDTERPESISHFHNLGSWKSSNNGEVLT
                     GSEGNAVHCDTHNSRSMRALTSSISKRGSIILFGRDRLTSSAFSDHHNWEAVAKAITT
                     GHHEKSEEHQEIVANIPPSPASTVGIPRRHSRHTLQERPSTIRLCSSTPSSFDQHVKS
                     LSDEENELPCVGRIKNASLLKERRSMAPVGSRDHSGDAGSLIRKSMPALSISSAASIS
                     SVYPPLPTISLHYMDIDQTCKKQEECPKVPGGFPPLPSPPSKTQILFGNSAPPALSNT
                     QFSETAQNILEEMNARLPEGSARFGAELLKGKHAEVEKLVHTNQQLGVGGWGLIEGTT
                     RVNDRYAESHRKEFAKMKSISKTSLASLQNTSKSASIACAHQQVSAPFSERSNAAKRK
                     LGQSSSAANDIPSDLDSMSLDVLESNDGRLAKRSRLSTHPFGTLREAKKNIGIMLSEE
                     KSIPQTSMLRKLKDRREQRRSGLYAKHSPKRFGFLKKKKSTEPAVTLASSSSASKPII
                     SNPRPLSSKVSTEVSHASRSSVQLSQSESHRVRNLKSGGRSTSAQTVKSQSSSKTPRR
                     AAIPDFVPPSTTKQEASDKTTLASTNSLSLPKPPSPFRPSGNSSSNSGSSTTRAMKSQ
                     TQAELIRNARSAPPPPKHEMIDKADSALAVTQTMSKASLGSTTTPPTSIIHRHSTLFR
                     PTISSLARMQATVRPKADISLPTVPLTPSALVTPATQQKQVKLEREGDPVEMVASSLP
                     IKTIQPFGNASLRDNAFETNFMSKPAATPCKGGASHGKGIMKKQSSAGLAAAARARAK
                     ASGLRAVKSRGDLREKEKEMKRKKEEMRVLSGRRKEERELREMLGM"
     gene            783292..784376
                     /locus_tag="CNF02740"
                     /db_xref="GeneID:3258502"
     mRNA            join(783292..783424,783503..783534,783586..784067,
                     784180..784242,784297..784376)
                     /locus_tag="CNF02740"
                     /product="expressed protein"
                     /transcript_id="XM_024657414.1"
                     /db_xref="GeneID:3258502"
     CDS             join(783390..783424,783503..783534,783586..783734)
                     /locus_tag="CNF02740"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513105.1"
                     /db_xref="GeneID:3258502"
                     /translation="MPPLGVKDLTMPAAAFTMAIVLGAHVYSSINQARQEAEFKRAQA
                     LESEYEKKMRRLSGSQNSALMDNQKEN"
     gene            complement(783689..786653)
                     /locus_tag="CNF02750"
                     /db_xref="GeneID:3258276"
     mRNA            complement(join(783689..784232,784283..784353,
                     784407..784649,784709..784846,785042..785268,
                     785726..785819,785871..785907,786022..786653))
                     /locus_tag="CNF02750"
                     /product="expressed protein"
                     /transcript_id="XM_571587.2"
                     /db_xref="GeneID:3258276"
     CDS             complement(join(784162..784232,784283..784353,
                     784407..784649,784709..784846,785042..785082))
                     /locus_tag="CNF02750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571587.1"
                     /db_xref="GeneID:3258276"
                     /translation="MADPSNHVSRNLHRTYRITPIQQPLRSAAFEKAYLSRLPLSPPL
                     IIQLDCWDARGEQIIPYDELPFLVCHLSLETQNGQDAAIVTSPHTAPVSMLYGTLVAT
                     PAEMDDQTGAQGVYFVFPDVSVRHVGRFRLKALLMRITGGPAVHVSVTRTFEIVHTKD
                     YIAPPVTTLTKHFDSQGIVRFGLPRYQ"
     gene            789771..791047
                     /locus_tag="CNF02760"
                     /db_xref="GeneID:3258352"
     mRNA            join(789771..789855,789989..790040,790118..790213,
                     790285..790319,790372..790391,790441..790569,
                     790626..790696,790747..790802,790885..791047)
                     /locus_tag="CNF02760"
                     /product="ubiquitin-conjugating enzyme e2-16 kda,
                     putative"
                     /transcript_id="XM_571364.2"
                     /db_xref="GeneID:3258352"
     CDS             join(790017..790040,790118..790213,790285..790319,
                     790372..790391,790441..790569,790626..790696,
                     790747..790802,790885..790897)
                     /locus_tag="CNF02760"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme e2-16 kda,
                     putative"
                     /protein_id="XP_571364.1"
                     /db_xref="GeneID:3258352"
                     /translation="MALKRINKELIDLGRDPPSSCSAGPINDNLFQWQATIMGPADSP
                     YSGGVFFLSLTFPTDYPFKPPKVQFTTKIYHPNINANGSICLDILRDQWSPALTISKV
                     LLSICSMLTDPNPDDPLVPEIANTYKTDRARYEATAREWTRKYAT"
     gene            complement(791972..796480)
                     /locus_tag="CNF02770"
                     /db_xref="GeneID:3258299"
     mRNA            complement(join(791972..792639,792691..792734,
                     792786..793155,793211..793576,793642..793680,
                     793733..793800,793857..793875,793930..794072,
                     794128..794199,794251..794524,794573..794649,
                     794709..794939,795009..795630,795679..795735,
                     795792..795939,796011..796091,796143..796189,
                     796299..796480))
                     /locus_tag="CNF02770"
                     /product="glucosamine 6-phosphate N-acetyltransferase,
                     putative"
                     /transcript_id="XM_024657415.1"
                     /db_xref="GeneID:3258299"
     CDS             complement(join(792043..792639,792691..792734,
                     792786..793155,793211..793576,793642..793680,
                     793733..793800,793857..793875,793930..794072,
                     794128..794199,794251..794524,794573..794649,
                     794709..794939,795009..795630,795679..795735,
                     795792..795939,796011..796091,796143..796189,
                     796299..796427))
                     /locus_tag="CNF02770"
                     /codon_start=1
                     /product="glucosamine 6-phosphate N-acetyltransferase,
                     putative"
                     /protein_id="XP_024513107.1"
                     /db_xref="GeneID:3258299"
                     /translation="MAYAYPSVDPLPEASSASLEIRPSKDPSRKNSDTLTDVFSEFKR
                     KISEDEIYINFLQERVRLENDYIEGLQRLYDRTVAIDSLHDEDPPPKRSEKPTSRKAW
                     SEVRDYTLREIQAREAMKGALEEDVIKELTKLKDLQLKIRNYLKQNIKLAEHMYEDHA
                     KHQLPKLKKAYFQKSQVLEDHRRQENAIATQARLLSSAPPPSPTSTPLQEHPFSVGTG
                     ASYALPSTIISPLPPVNNPAASSVSKVSSQETTSGMFVPSPNKDREKEMKFGNRLRAE
                     SGSGLENKSRDVLNDIATHGKKGFSAFMQRLGGDKDREREKDDVQITSHGVEGEGLQR
                     RGTTGSANIKAQMAVRGAKAKREADEADRAYRMGIFHLESLRLRTEKLHSSAITHLEE
                     FNDELSNKLRRAMVAYVDIMHSTAMTSAQATEVARIAIDTIDADHDMMLFRKRLLVAT
                     SNTTKAPVPYENFYVGPCRSLIFGVSLTDYDFARGDGNDHGSPPMIVEKCIAAIDARG
                     LEAEGIYRVNGRHTGVQKMVQDIEKDETQFEFGEKDDVFSIASVLKQYLRELPEPVFN
                     LPHAERVKYSKHRELHISNNFSAIRGRLRRLPPIHQTTFQSIIEHLGRVHEKRGMNKM
                     GAKNLAVLFSSVLFGQEQAPSDGNVLMMNQEADTVLEDLITFSNLLFGGIGSPKTSHI
                     LPSSLAFSSGVNAEVSVIDDPQPGSSHTKIKILQQETTPQRLVDHSAQISDKDQRATD
                     ETDDYRPNTLQDTETVQTLLEDFPSNKDLDLLFDAKLLPSSMRENLPKDIEVRPLAST
                     DLLRQHFELLSNLRPSPALAPSLYQAIFTHFKSCPLTYYTVVMVDTKIDRLVASGTLL
                     VERKHINGGSAAGHLEDIVVAEEMRGKKLGVKLVTGLRDLAVSLGCYKVVLDCKEAKI
                     PFYENCGFHKRSAGMAYYTPSDQGTAHVSFSTQSNQQSLLPYAPNDSLAPPVSTMGTL
                     TPGTELNITPQMNQSLHDPLSQSDVTSDDQKGILLTIPDGTAASDGESPGSPRTFTSA
                     SSEAGMGVTYDFPTAVDESVLPAWAAEGLGGNTSHVSDRRASDKTESTLPAFSILEGV
                     GVAKSKDSEAADDSKEGRSRTPFPSRVASSDSTTETSSK"
     gene            complement(796714..799788)
                     /locus_tag="CNF02790"
                     /pseudo
                     /db_xref="GeneID:3258124"
     mRNA            complement(join(796714..797243,797305..797985,
                     798042..799788))
                     /locus_tag="CNF02790"
                     /pseudo
                     /db_xref="GeneID:3258124"
     gene            796780..799787
                     /locus_tag="CNF02780"
                     /pseudo
                     /db_xref="GeneID:3258480"
     gene            complement(800080..802416)
                     /locus_tag="CNF02800"
                     /db_xref="GeneID:3258311"
     mRNA            complement(join(800080..800786,800837..801039,
                     801093..801187,801241..801405,801459..801617,
                     801694..801888,801949..802025,802087..802141,
                     802213..802416))
                     /locus_tag="CNF02800"
                     /product="protein kinase CK2, putative"
                     /transcript_id="XM_571600.2"
                     /db_xref="GeneID:3258311"
     CDS             complement(join(800746..800786,800837..801039,
                     801093..801187,801241..801405,801459..801617,
                     801694..801888,801949..802025,802087..802141,
                     802213..802233))
                     /locus_tag="CNF02800"
                     /codon_start=1
                     /product="protein kinase CK2, putative"
                     /protein_id="XP_571600.1"
                     /db_xref="GeneID:3258311"
                     /translation="MSGGRSVARVYANVNEKLGRSWWDYDNLVVQWGVQDNYEIVRKV
                     GRGKYSEVFESIHLPTDSKCIVKVLKPVKKKKIKREIKILQNLAGGPNVVGLLDVVRD
                     SQSKTPSIVTEYVNNTEFKTLYPKFSDFDVRYYIFELLKALDFCHSKGIMHRDVKPHN
                     VMIDHEKRTLRLIDWGLAEFYHPGTEYNVRVASRYFKGPELLVDFQEYDYSLDMWSLG
                     CMFASMIFRKEPFFHGHDNADQLVKIAKVLGTDELYTYLERYDIDLDAQFDDILGRYP
                     RKPWSRFVSSENQRYISSEAIDFLDKLLRYDHQERLTAEEAKGHPYFEPVRQAAAQAS
                     AS"
     gene            complement(802853..805944)
                     /locus_tag="CNF02810"
                     /db_xref="GeneID:3258127"
     mRNA            complement(join(802853..803164,803222..803299,
                     803359..803571,803627..803724,803784..803792,
                     803865..803958,804024..804176,804226..804373,
                     804430..804482,804567..805661,805712..805944))
                     /locus_tag="CNF02810"
                     /product="expressed protein"
                     /transcript_id="XM_024657416.1"
                     /db_xref="GeneID:3258127"
     CDS             complement(join(803018..803164,803222..803299,
                     803359..803571,803627..803724,803784..803792,
                     803865..803958,804024..804176,804226..804373,
                     804430..804482,804567..804653))
                     /locus_tag="CNF02810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513111.1"
                     /db_xref="GeneID:3258127"
                     /translation="MSHYQYLQIRIGAAAPTEEEAAALFAPERTFSLGCMFAQPIVDT
                     FMAGIMFMQVVTYFTYQRNDKWWTKCIVIFASIISIIMTVYLWFFGQYLFVQNFGRFS
                     PFVETDKLAWFPVLDAICSSGIQSYFAYRAYLLNRRNILIPITILLLILTSFAATIAV
                     KVIFGNANSLMEADKVRIPELIWLASIMAADIIITILILNGLLRSKTGWAHTDKAIVR
                     LIRITFESQIPPTILAITFMIEFVQTPASLLGSTLQGIQSKLYTVGLMYSLNSRVSFK
                     SANESGFNSGQVFAMTGRRDNATNDIHVDVETYVHHNQDIHTSDDDVRDKKNREDDES
                     LSDIQGHKSPGFDSQSHLTEPRHIA"
     gene            complement(<805950..808374)
                     /locus_tag="CNF02820"
                     /db_xref="GeneID:3258195"
     mRNA            complement(join(<805950..806047,806112..806407,
                     806472..806604,806658..806894,806949..807050,
                     807111..807173,807225..807338,807392..807418,
                     807473..807570,807620..807686,807771..808374))
                     /locus_tag="CNF02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_571366.2"
                     /db_xref="GeneID:3258195"
     CDS             complement(join(805950..806047,806112..806407,
                     806472..806604,806658..806894,806949..807050,
                     807111..807173,807225..807338,807392..807418,
                     807473..807570,807620..807686,807771..808047))
                     /locus_tag="CNF02820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571366.1"
                     /db_xref="GeneID:3258195"
                     /translation="MRSSPVIEISPASSGTAIFQHNPKGDATLRREWEPGCQPDELYD
                     AFLPAWRASLRRLLVRRLRNESTQMADWQKRVRSEARDKYFYWTAVFGTHTFFMMFLP
                     ILFFFGHPLEGRGLLHVVGLGIYISSFAKDLVCTPRPYSPPVIRLSMSTHHHEYGFPS
                     SHSTNSVSIALYLGQWIFKLQDRLGWPTVLLSWLMLAVYMTSVIGGRVYTGMHSIADI
                     VGGSIMGVACWLFWIAIGDRNEAWVNSGSWTVPAIIAPLAFTLIHRHPEPFEACPCFE
                     DAIAVLAVMLGSTLGQWFTVAIWPSIKVQNPTAFYSYNLATIILSIMFRLVFGLGTLF
                     AWRLLAKYTLRQVLPPVFRSCSLLLHSSLPARRFYISTAEHNKEPSQLALRAVPSLLD
                     LQTGEDTGTLPAPSCPSPLLASHALSSRNDITIGPPSNPREGLIKRKKSSCEGGAEWR
                     TATPREEQAQMSVSALTYDIEVATKVGVYSGIGFIATILVPYWFELIENIVLG"
     gene            complement(809957..812378)
                     /locus_tag="CNF02830"
                     /db_xref="GeneID:3258020"
     mRNA            complement(join(809957..811328,811380..811566,
                     811634..811846,811905..812378))
                     /locus_tag="CNF02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657417.1"
                     /db_xref="GeneID:3258020"
     CDS             complement(join(811739..811846,811905..812312))
                     /locus_tag="CNF02830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513145.1"
                     /db_xref="GeneID:3258020"
                     /translation="MDPNCSLTNQMALKKALVDFNHQAVASSEQQKEVSVSLADEIAH
                     IRRVQSDPQAVVRLVKERPDAMGSFMDALAESPSTMDKFIDVFSENEKVVDHVQKVIQ
                     AFVGENKRSSNGAGLNGSGNEPKKTEKDRVPQVEILVHYTFHKMVDKRFPGLEDEKFY
                     MKVREHSLCAQ"
     gene            complement(812450..815031)
                     /locus_tag="CNF02840"
                     /db_xref="GeneID:3258243"
     mRNA            complement(join(812450..812833,812891..813136,
                     813196..813512,813570..813737,813799..813829,
                     813886..813993,814053..814127,814203..814320,
                     814378..814460,814609..814654,814836..815031))
                     /locus_tag="CNF02840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571598.1"
                     /db_xref="GeneID:3258243"
     CDS             complement(join(812670..812833,812891..813136,
                     813196..813512,813570..813737,813799..813829,
                     813886..813993,814053..814127,814203..814320,
                     814378..814460,814609..814654,814836..814880))
                     /locus_tag="CNF02840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571598.1"
                     /db_xref="GeneID:3258243"
                     /translation="MGSMEPILGESKRRVCYFFDSDIGNYHYGPGHPMKPTRIRMCHS
                     LVMNYGLYKKMEIFRAKPATKREMSQFHTDEYVDFLYRINPDNAAQFAKEQVKYNVGD
                     DCPIFDGLFEYCSISAGGSMEGAARLSRDKCDIAVNWAGGLHHAKKAEASGFCYVNDI
                     VLGILELLRYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGEVRDN
                     GIGKGKGYAINVPLRDGISDDNYKSIFQPVIKRVIEWYQPGAVVLQCGSDSLSGDRLG
                     SFNLSMKGHAACVQFVKSFNLPLLLLGGGGYTVKSVSRTWAYETGLAAGMELGRDLPN
                     NEYWEYYGPDYELDVRSSNMTDQNTPEYLQKVTEAVFEVLRDKNAAPSVPLQSIPKMM
                     HDDEDEDEGEDNEDRDVRRPARLWAREKQHETSLSDSEDEGTGGRRHRRSYKESAQKN
                     TMVEDQCNFRVNAGFT"
     gene            815176..816230
                     /locus_tag="CNF02850"
                     /db_xref="GeneID:3258145"
     mRNA            join(815176..815396,815448..815551,815602..815768,
                     815826..816230)
                     /locus_tag="CNF02850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571593.2"
                     /db_xref="GeneID:3258145"
     CDS             join(815336..815396,815448..815551,815602..815768,
                     815826..816150)
                     /locus_tag="CNF02850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571593.1"
                     /db_xref="GeneID:3258145"
                     /translation="MSSISYLDALPYVDKQVEDPVNKAAAQALVEAELRHTPQIAEDD
                     HRLAASVGVFPRSTHLEELLADYPNKPIKGIDPSKYQPPIVETNATLEELEAAEKQGR
                     IGEGYMGLRLENTSILSSYGPNAWLVRNYQLNSQLTELQATLAALKEHVTDINRTRRI
                     FQEETGQHLSRLEGRWQDLVGSTVQLELACTAMEGEVKGLEAKKIILKDEIAELEAKY
                     "
     gene            complement(816050..816951)
                     /locus_tag="CNF02860"
                     /db_xref="GeneID:3258107"
     mRNA            complement(join(816050..816111,816193..816280,
                     816376..816463,816527..816609,816670..816751,
                     816805..816951))
                     /locus_tag="CNF02860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657418.1"
                     /db_xref="GeneID:3258107"
     CDS             complement(join(816228..816280,816376..816463,
                     816527..816609,816670..816751,816805..816864))
                     /locus_tag="CNF02860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513110.1"
                     /db_xref="GeneID:3258107"
                     /translation="MASNTPNPKDRNLIAVIGDEDSVTGLLLAGIGHINQHQKKNFLI
                     VDGKTQTSVIESAFQDFTERKDVAILLINQHIAERIRPTVDRYQAAFPALLEIPSKEH
                     PYDPAKDSVLKRVQKLRGD"
     gene            817089..820645
                     /locus_tag="CNF02870"
                     /db_xref="GeneID:3258206"
     mRNA            join(817089..817240,817291..817357,817409..818373,
                     818440..818591,818646..818775,818840..818941,
                     818989..819339,819393..819616,819673..819881,
                     819932..820645)
                     /locus_tag="CNF02870"
                     /product="expressed protein"
                     /transcript_id="XM_024657419.1"
                     /db_xref="GeneID:3258206"
     CDS             join(817172..817240,817291..817357,817409..818373,
                     818440..818591,818646..818775,818840..818941,
                     818989..819339,819393..819616,819673..819881,
                     819932..820575)
                     /locus_tag="CNF02870"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513123.1"
                     /db_xref="GeneID:3258206"
                     /translation="MLSSPSIPQLIATAYAQALPPSRLLKTLQEVHLHNLSPSVQYDL
                     IRAFLDHLLPVPPSIMLAYLAHALSTSVITTQDFTIGLLFYMSGHEIPPIESLVSIVN
                     VLMENPTCFEDGTILPSMLSDPALVQSDTNGELSKYRDNNQTSTLSLLLPLLRVSATP
                     FPPPTLTAFIARLLNCLSPFPVPPLDVGLEAGQLLPSLTDEISIPLRNCLGGLMADAT
                     TNDPQQVEQVVFQQDSQLAQGDSPSQVEMPTNSSLPLKATVAFLLEQAHRASQWDPSE
                     LALEMEHYQTPAPSYVRMLKAGQHICSNPEEFIVVLFEVSIERLISEDGRSLIAKAEG
                     IRDWGWVTESLPNLLRWWRSQREEDGFVGWQLPSVVAEPLTKAVQVFLPAMQSYSEKV
                     LETYEVMVQSAEIEEESSGFTPPESWQLVSLQEYLIGKLIEMELITRTEACKMIPTIS
                     VPQTVQGQSLLERMESESRAHVKPLVFIITYAFGAAKSFAYEIVNIIKSSPQVPPPEN
                     LFLHVSYQPSIFSALVTFISPLSLYTLMSDRLLEAYSELDEFARSDDPQGYLTRFGEG
                     VILLESFAREFNLDLPELLANGRRATGYGLLDAEQKDCLNGWVKAIFGSDGIEDQILL
                     ATPPQTLCCLVPTLIQQAIAAVACNQIDLDTLHSGLSYFSQPLLSWCLGGVIEWLCDE
                     ILRQGALSALHLVVLQALAMGHACPEQLLKVNDRALRKLFNPLSGLDEVIGTSNFDMF
                     AFKAKLESLGITTSHHYGPLNQPSVKSSIQSISSLPFATAFWANPLLDSLWASAGTSN
                     WMTVVLKNIFSQLDTFPVSPVGSACQRSGVYANFVPFLLMVDIKGNEPLLSGLAAWLR
                     NSTEDLIHYTRGSRVLAGIFTQCILLADLIWGRVMAKRVIKELVVELHSVTTLGVRSG
                     GQSEETTQLHSRKMKHRDGRRLTSEQRSMCEDIVKMLTYDDGLRARWGNHWVDLAV"
     gene            complement(819866..821498)
                     /locus_tag="CNF02875"
                     /db_xref="GeneID:36392910"
     mRNA            complement(join(819866..821002,821070..821134,
                     821208..821498))
                     /locus_tag="CNF02875"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658580.1"
                     /db_xref="GeneID:36392910"
     CDS             complement(join(820907..821002,821070..821134,
                     821208..821367))
                     /locus_tag="CNF02875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514506.1"
                     /db_xref="GeneID:36392910"
                     /translation="MSSQAPQQHTVDPPAVTQISDPNDPNAVPPPSVVAAGTGLPAAP
                     RGAADSSQEAATAPGSGNMTEHSEKLSFKEQVNGYAKKFAGATFRNREEKEWGEKKLA
                     GDSV"
     gene            complement(822930..825228)
                     /locus_tag="CNF02890"
                     /db_xref="GeneID:3258198"
     mRNA            complement(join(822930..823353,823407..823504,
                     823565..824088,824152..824291,824351..824461,
                     824526..824549,824609..824685,824731..825228))
                     /locus_tag="CNF02890"
                     /product="neutral amino acid transporter, putative"
                     /transcript_id="XM_024657420.1"
                     /db_xref="GeneID:3258198"
     CDS             complement(join(823070..823353,823407..823504,
                     823565..824088,824152..824291,824351..824461,
                     824526..824549,824609..824685,824731..824912))
                     /locus_tag="CNF02890"
                     /codon_start=1
                     /product="neutral amino acid transporter, putative"
                     /protein_id="XP_024513147.1"
                     /db_xref="GeneID:3258198"
                     /translation="MGNDIEMCGKDSISTAVVEPTTFPVLGTKLDDDIPKFSDPERDA
                     VFGEHKEGQVNYKSVGMLKSVVLMIKLTIALGVLAMPQALLDVGAVPGVIIIIAVALL
                     TTWSGLVVGQFKRNHPEVYSMDGVGYVLAGKWGREFFSFIYPLFMVFVCGSGYVTLSI
                     AFNAITNHATCTVVWTVIGMVVTLALASLQTLSKVSVLGWIGFFSIMSAILIITVAVG
                     VEERPEAAPSTGPWDKDIHAFRSDGTFLKGMGAVSTVVFAYCGTPAFFNVIGEMRDPT
                     QFNLALYSAQSICSAVYLTIGIVVYYYCGQYLSNPALGSAGILIKKIAYGVALPGLFV
                     GCILFTHVGAKMVFVRVLRGSDHLTAPSFIHWAVWLGTVGTCVLIAFVLAESIPFFGD
                     FVSLIGATLGTFLCFITEGWMWLHDNWGHRKIDKSLRFKSLVALNVFLIVMGIFIIIT
                     GTWASVVSIRDSYKNGMITSPFSCADNSS"
     gene            827644..830578
                     /locus_tag="CNF02900"
                     /db_xref="GeneID:3258237"
     mRNA            join(827644..828123,828202..828635,828682..828864,
                     828907..829058,829128..829227,829273..829388,
                     829441..830578)
                     /locus_tag="CNF02900"
                     /product="expressed protein"
                     /transcript_id="XM_571594.2"
                     /db_xref="GeneID:3258237"
     CDS             join(827843..828123,828202..828635,828682..828864,
                     828907..829058,829128..829227,829273..829388,
                     829441..829638)
                     /locus_tag="CNF02900"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571594.1"
                     /db_xref="GeneID:3258237"
                     /translation="MSNSPQNHLAQHIPRKMSSPLSSPSSSVGRGMPIAPSAHEGPSG
                     SPATSSTLPLTDDESELTEEEEPEITLVKDNDPDDEAEEDNDTDDLADNRMNRSESQA
                     TTTSLTPPPSDPVAASPVNTSQIISSDIPASNTHILNGSMIPENYSHKRDVGQIISFS
                     HTNKGSNGDGDMTMRPAEDDGEDSDQGTVNGMMNGAGEDILQRPIKRLGEPTDIADTG
                     KVAVPAFADAEAHMEEYGWIEPPAPEAIPPILLKQNSHAPPLPPSALRQLLLVEVKLA
                     ELRNCLYLERMEEAAAEEEMILEGTYPALKCLYKTLDERRERLHEGASRRFEAQLAEF
                     RRMRDAERHLIWSTWTEERDKLHWDEFQTTWSKRRKLAREKGLIETTRLTKPVPSLDH
                     PHSIHRFDWYQDAVPAPLGADIAQMEALAMSRRPPPMLPLARRASTAALPSSYTATGT
                     VQHSSTVSDGPNIYTAFGRTSRPTNSSLEFTAGTAAM"
     gene            complement(829647..830601)
                     /locus_tag="CNF02910"
                     /db_xref="GeneID:3258334"
     mRNA            complement(join(829647..829725,829799..830010,
                     830066..830147,830201..830601))
                     /locus_tag="CNF02910"
                     /product="expressed protein"
                     /transcript_id="XM_024657421.1"
                     /db_xref="GeneID:3258334"
     CDS             complement(join(829847..830010,830066..830147,
                     830201..830329))
                     /locus_tag="CNF02910"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513040.1"
                     /db_xref="GeneID:3258334"
                     /translation="MSVVRFMATRVPRVPFSRASRPLSTSALSQKSLTDSVKETAENL
                     NKKVGQTLASGIDSTEKATQSAKNTIDTKTPSEGEAKSAADNLGSKAAETAESARQGA
                     NRTLGKAAGAARDAKDEVKKNI"
     gene            831581..832450
                     /locus_tag="CNF02920"
                     /db_xref="GeneID:3258052"
     mRNA            join(831581..831796,831864..832190,832246..832450)
                     /locus_tag="CNF02920"
                     /product="expressed protein"
                     /transcript_id="XM_571368.1"
                     /db_xref="GeneID:3258052"
     CDS             join(831698..831796,831864..832190,832246..832365)
                     /locus_tag="CNF02920"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571368.1"
                     /db_xref="GeneID:3258052"
                     /translation="MAVLQQALAPFTLKGFYLLTWGTALGSNVYKTLSSYRIFKALPR
                     QTFGTLQSYLTPLYFSFSSITTSALLLTHLYFHPSLISSPRVEPHWLTSEEGRQGLLI
                     VAGLVPQVLNWLVVGPLANSVVFERHRLERVEGKEYDEANPSDAMNKVNKKFTTLHTI
                     SSVLDTAALLALAGLGLVVSM"
     gene            complement(832469..834566)
                     /locus_tag="CNF02930"
                     /db_xref="GeneID:3258122"
     mRNA            complement(join(832469..832785,832847..833221,
                     833279..833410,833470..833585,833640..833727,
                     833806..833878,833931..833972,834061..834566))
                     /locus_tag="CNF02930"
                     /product="expressed protein"
                     /transcript_id="XM_571369.1"
                     /db_xref="GeneID:3258122"
     CDS             complement(join(832673..832785,832847..833221,
                     833279..833410,833470..833585,833640..833727,
                     833806..833878,833931..833972,834061..834219))
                     /locus_tag="CNF02930"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571369.1"
                     /db_xref="GeneID:3258122"
                     /translation="MIDKLKSTLAFSSIGNKLSKIFKSNLDRNVLKRSNECGLNMENP
                     FADKHDYAEPSLQRSHIILHSAAMFFTFIAVCTMGAVAGFQAKWFSVSGGTGFVLFLL
                     LLSFSLTVILMVVPIVYDRWDKLKRPAQFLAQTRSTLILHAFGTFLMLLAAFIVTISA
                     WTEKGCKNSSNDPHSDLGDSYKSGLQNWCKTKKASAIFDWFSSIAWSILLVLTIITFR
                     RQQKTNHRDLIVLPPASEGISYSNIQAADEEQLGDKSESARDYASDAYRRTDKTYDHP
                     VSARTAYSSQPSVDHHPMLSRPSIDVYGAFDGDGMPRVDEPSRTMQLAYTDPYAQIRQ
                     SLMNASSNSTQSTHIPGIPSGLPAYAGYRQH"
     gene            835380..838380
                     /locus_tag="CNF02940"
                     /db_xref="GeneID:3258163"
     mRNA            join(835380..835709,835760..836120,836194..837215,
                     837267..837599,837658..837775,837838..838380)
                     /locus_tag="CNF02940"
                     /product="serine/threonine protein kinase FSK, putative"
                     /transcript_id="XM_571370.2"
                     /db_xref="GeneID:3258163"
     CDS             join(835623..835709,835760..836120,836194..837215,
                     837267..837599,837658..837775,837838..838211)
                     /locus_tag="CNF02940"
                     /codon_start=1
                     /product="serine/threonine protein kinase FSK, putative"
                     /protein_id="XP_571370.1"
                     /db_xref="GeneID:3258163"
                     /translation="MSSLPEDGISGASADDAGEDVQPANTVGNAVNMRDLSHVFDTSL
                     QMPSESQPGSTVATPSLSPSLISTAEWEQELASSPPANSAVHTSRPFPSASVTSRQNE
                     QPSILNSHYLSPIPSSPSQKSVTAPLNAPDYLSQRTLPPEPAFPFPSIKHITPNEKLT
                     PSNPPVAGSGQASAALSRPNSSASNDGTSASLAGKNEDSSAAMKSVSRPESIAATTNG
                     HDIISHASGEKRPGTAIKSGRSSSSAVKPPAELISKKSFFHKMFHPNQDKHDGKNAVG
                     QSRLHLELPRDAPSNGLASGRVSPSVMGPNTTESPPLTPSGNISDIDSRPPSRAPSRP
                     PSVRRQNSAPGHDISVQTFVDPKNAVTPPVGVLAPQPQRRLSQRSAGSPSRRSASAGQ
                     GVTAKKDESAGNSGTKFTLKDLVGLGDNKVKKASAAGSAKGSDRGSTRGSEIGDNNST
                     ASLLKKYGVCDRAAIGKGATAVVRLAHKWDRREEKLYAVKEFRKRRKNETEKDYVKKL
                     TSEFCISSTLHHINVVETVDLVQDEAHHWCEVMEYCPGGDLYAAIKKGGMSSQEVECS
                     FKQIMQGIAYLHSMGVAHRDIKPENLLLDGRGHVKITDFGVSDVFRMCWEKKTHMSKG
                     LCGSEPYIAPELFEQKEYDARLVDVWAAAIVFYCMQFQELPWRIAKPSDPTFAAYMQQ
                     YKPQHVVDASGGTHHPTPPPINNLIPRECRSVIKHMLDPDPKTRWTVDEALKDKWLGN
                     VEVCQEGQENSHRHITAGMDIVRV"
     gene            839200..840420
                     /locus_tag="CNF02950"
                     /db_xref="GeneID:3258433"
     mRNA            join(839200..839345,839402..839450,839506..839542,
                     839654..839715,839812..839853,839907..839983,
                     840115..840161,840224..840420)
                     /locus_tag="CNF02950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571595.2"
                     /db_xref="GeneID:3258433"
     CDS             join(839343..839345,839402..839450,839506..839542,
                     839654..839715,839812..839853,839907..839983,
                     840115..840161,840224..840257)
                     /locus_tag="CNF02950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571595.1"
                     /db_xref="GeneID:3258433"
                     /translation="MSKHHPDLLMCRRQPGIAIGRMCEKCDGKCPVCDSYVRPMTLVR
                     ICDECSFGTTAGKCIVCSSPAISDAYYCTECTRLEKDRDGCPRIINMGASRVDAFYER
                     KKLGLEKGGGFKKG"
     gene            complement(840479..841823)
                     /locus_tag="CNF02960"
                     /db_xref="GeneID:3258398"
     mRNA            complement(join(840479..840738,840796..840856,
                     840911..841094,841148..841193,841263..841416,
                     841477..841823))
                     /locus_tag="CNF02960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571371.1"
                     /db_xref="GeneID:3258398"
     CDS             complement(join(840637..840738,840796..840856,
                     840911..841094,841148..841193,841263..841416,
                     841477..841703))
                     /locus_tag="CNF02960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571371.1"
                     /db_xref="GeneID:3258398"
                     /translation="MSETKLSSGHDDVVERHLTNDNASFAPSNGATGYHGTGGPMTRF
                     ITPGGHPMDTSQPAFPVFHRKFGNPAPLGLISFAATTFLLSLFNISTRGITVHNVILG
                     MALGYGGLCQIIVGIEEWACGNTFGATAFCSYGGFWLSFAALYIPQFEVLASYDDPAM
                     LDNALGLYLVAWALVTFILLLACLRSSVALICVFVFLDITFWLLAAGYLAPSTNATKA
                     GGAFGILTAAVAAYTGLAGMLTKDTSYFILPVGDLSHST"
     gene            845473..849403
                     /locus_tag="CNF02970"
                     /db_xref="GeneID:3258346"
     mRNA            join(845473..846076,846140..846300,846355..846373,
                     846437..846576,846627..847050,847105..847165,
                     847218..847257,847309..847341,847382..847436,
                     847490..847590,847662..847695,847757..847906,
                     847973..848183,848231..848250,848309..848349,
                     848402..848437,848510..848720,848774..848897,
                     848962..849403)
                     /locus_tag="CNF02970"
                     /product="phospholipase, putative"
                     /transcript_id="XM_024657422.1"
                     /db_xref="GeneID:3258346"
     CDS             join(845540..846076,846140..846300,846355..846373,
                     846437..846576,846627..847050,847105..847165,
                     847218..847257,847309..847341,847382..847436,
                     847490..847590,847662..847695,847757..847906,
                     847973..848183,848231..848250,848309..848349,
                     848402..848437,848510..848720,848774..848897,
                     848962..849110)
                     /locus_tag="CNF02970"
                     /codon_start=1
                     /product="phospholipase, putative"
                     /protein_id="XP_024513041.1"
                     /db_xref="GeneID:3258346"
                     /translation="MSVPSPDALLPECPLLLAVPALDVRWVHAGAQQLNLLPIPITSA
                     SNSFKAFSKNESSRIELRWQSTSESERSKAIKSWGRNDGEGAFQSQEEIVKQGEEIGH
                     DDEPAKGSKGCDAIDRPDAHTVDSKMKREDAEEHLDLDVDDMPSGQDQINKQYHTLLL
                     EARRKNDDLDLVQGIPVSQDSLFEVSLSTLSLHPVFWAHTGPRVAVLRGTWFVNDESR
                     PCCWELAEELEKAFLEIQPWQRSYSHELATALSLGSSGEEKIKYTLPSKFGEGLGIIF
                     EDSAKGRIVTSGTLTYITRLFWSSLKARPTGTYVYRGYSAACSAKVEVAADTTATLVD
                     SEGTTHVNTKSHSYEKDDTQDGRLNLPGNQRHDQALTALDTAFKDVKETAGQAIEGVK
                     EGFKDYDLREERRQTPAPGSNDDERKALEEENAPLVHDTEDVNPCTDLILVVHGIGQQ
                     LAAQHEAYNFVYAGNQLRQMLRKQTSNPAVASIIRDRRCQVLPVQWRTSLNLDERKTE
                     EELLHGIENRFTISGNSIPYVRELTNSVLLDIPLFMSHHRQKMIEAVCTQANKLYRLW
                     IARNPHFEEYGRVHIIAHSLGSALVAHILSNQSTKMPRLSQLPKQVISETMDRFLFNT
                     SNLFLVGSPLGIFLHLEQAQLMPRKGRERTMHSPADEALDRAGRFGCLAVDSLYNVFY
                     HTDPIAYQLNAAVDSQLASQRPPLAIMSMTAPFYAPVADSISSISKYLPVILGGGGGN
                     DTRSGNRPGIFRLPSGIEMAGPNGEEKLQGSRGERRFSALNPHGNVDFFLPSAGVNEY
                     LDMLTAHLSYWTDSSFAAFLLTEIFSTRLDQMRTGMGLANQPPSENGVNI"
     gene            852121..853968
                     /locus_tag="CNF02980"
                     /db_xref="GeneID:3258373"
     mRNA            join(852121..852470,852509..852593,852667..852827,
                     852874..852991,853062..853158,853218..853712,
                     853773..853968)
                     /locus_tag="CNF02980"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_571373.1"
                     /db_xref="GeneID:3258373"
     CDS             join(852250..852470,852509..852593,852667..852827,
                     852874..852991,853062..853158,853218..853712,
                     853773..853939)
                     /locus_tag="CNF02980"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_571373.1"
                     /db_xref="GeneID:3258373"
                     /translation="MSIARIFGMGLRNKRVSTTAFRYNANRNSKVQLRSIVRYRHSSP
                     SQEFETNSAEIRVNSTTITIKQPDEDDLQYDHFYLFDHCRCPQCFHPRTKQRLKTLSQ
                     IPSDIHPTAVALSRSGLHITWSTPSAHTSFFPAGFLRRAAYETQLSEHVDCRDDRTLW
                     NSEISKSPPYVAYDDIMSQQVHQHEQAVLQVLNKVHQFGFCFVTGVPIDAKETETLIK
                     SIGPIRQTHYGGFWSFTADLSHGDLAYSAQSLPAHTDTTYFTDPAGLQIFHLLSHPSP
                     GQGGKTLLADGFHAASQLSAVDPASYSVLSRLPIPAHASGTKGTLLRPLISFPVLRHD
                     ECGRLAQVRWNNEDRGIIGHGWSATEVRQWYQAAQRFESLVKSEQNEYWVQLNPGTML
                     IIDNWRVMHGRSEFTGSRTMCGAYIGADDWYSRRAVLTERHGDVGGMDDVWRFGW"
     gene            complement(853950..855995)
                     /locus_tag="CNF02990"
                     /db_xref="GeneID:3258367"
     mRNA            complement(join(853950..855210,855248..855995))
                     /locus_tag="CNF02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_571374.2"
                     /db_xref="GeneID:3258367"
     CDS             complement(join(854134..855210,855248..855934))
                     /locus_tag="CNF02990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571374.1"
                     /db_xref="GeneID:3258367"
                     /translation="MLSADQRQRAPFAHKSSCANLTATQPSALRSPFPPQSHWPTPPS
                     AEGHQLQLTSDRSKWAQYPSPRKISNETCQAGFSDHPYAFGGIGATYSLDTPTSRRHS
                     LPSLFNPNTHRRAFTFPSMSLPNPATVRFISLCFLWYACSAISNNTGKVILNHFKYPV
                     TLTIVQFFFVAFYCAISSQKMLGWTGRLRQPTKNILKGTLPLAAFQVGGHIFGSMAIS
                     RVPVSTVHTIKALSPLFTVMAYALLFGVSYSPATYLSLLPLTLGVMLACSFDISFSNI
                     FGLVCALGSTIVFVSQNIFFKKIMPTTSTNEVNSSSKLDKINLLYFSSSMAFILMIPL
                     WIYSDARRLIDLWINPAASESGTSVLFYFFLNGTVHFAQSIIAFALLASTSPVTYSIA
                     SLVKRIAVICLAIIWFKQPVHTVQALGIVLTGAGLWMYNNAKRDVDRGEIKMRHVEAL
                     REGVLPSTKMDQCILEGSGIELSYKSAHNSPKPTYPNNYIDLPSSTTTAVNKTTFQVP
                     PILDHTSHIEAPYPSPPASISSSTPADITYLGISKGRQHWLSGEGERFRPPVLNSIRS
                     SVMEEARETGVNEGMAAVVTT"
     gene            complement(856451..860128)
                     /locus_tag="CNF03000"
                     /db_xref="GeneID:3258228"
     mRNA            complement(join(856451..856997,857051..857247,
                     857286..857439,857493..857784,857826..858158,
                     858203..858316,858364..859308,859361..859514,
                     859580..860128))
                     /locus_tag="CNF03000"
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /transcript_id="XM_024657423.1"
                     /db_xref="GeneID:3258228"
     CDS             complement(join(856865..856997,857051..857247,
                     857286..857439,857493..857784,857826..858158,
                     858203..858316,858364..859308,859361..859514,
                     859580..859891))
                     /locus_tag="CNF03000"
                     /codon_start=1
                     /product="ER-associated protein catabolism-related
                     protein, putative"
                     /protein_id="XP_024513109.1"
                     /db_xref="GeneID:3258228"
                     /translation="MPAWPRFMSLRRQYLYKALDKNHQKHPIKHPHTRFLSRLFCALA
                     VLFSYSIYQSFRTDLKQSGSWGCEMSWMSPSYRRLEWTEFISTRYALYLYREQGLDSE
                     DTLSGHPVLFVPGNAGSYQQVRSIASSASKQYYEQVKARERNVVTGKKIDFFTADLKE
                     EFSAFHARTVREQAVFIQHCIKGILQEYTHLPQEKRPTQVTLLAHSMGGVVARLAMDP
                     ITSISVDIIVTLSTPHILPPLALERDMDSIYSLIRWRRQHISTHPPLISICGGISDTQ
                     IVSDSCALPFFQAGNNSDIAVFTTGIPGVWTAVEHQAIIWCHQIRWRIARMLLDMSSR
                     ANTTAKLVTAKEWLLDYQEDETLKEPRSERQHDYSVSSRNMTFIGLHQPSKAFVAQQC
                     NGLERCRTVPSVMSLLPFPNNPSDPFPLPGEGIKPSEVMLVAEISLSSTNTVVKINAS
                     QYGQTIAGSREHHLVKGNSWKVNSSLPSLTTHHLFHFENAFLSSLVTHSLDITLGHCK
                     DFKPLIKHISQPALELQSATFESNYYFASGRPIHLHSHSTAGPFLPYQDRAGIYLEIF
                     QSPLCPVQQVSLRKNYYNVLAKSVTRYRMVVLAWPVGWATVVLLFQLSDFINTGEILP
                     WNSALERIARRRMPICIVLLLLGATIQSQLPDFPMLHTFFLGVNQLEMVPLVGILGVW
                     TFGLLCVVSFVITACLWLLGCIIQQPHGHERLEDETKSKHDWLGVVMIGAAAVLVNQV
                     IPHQLIFLLCVILLWLSAARSKALNDRYHLISTCAIFTTLLIPFKILHVAIWSRNIWT
                     GSAALVSTDNNFYYAIPPVLLVKCASCGGTIQKRHVCLKACRIALIILIMSSFSVGAR
                     WTWILSPIANAVLILFVASII"
     gene            complement(860524..861587)
                     /locus_tag="CNF03010"
                     /db_xref="GeneID:3258047"
     mRNA            complement(join(860524..860874,860925..861130,
                     861186..861587))
                     /locus_tag="CNF03010"
                     /product="nucleolus protein, putative"
                     /transcript_id="XM_571702.2"
                     /db_xref="GeneID:3258047"
     CDS             complement(join(860570..860874,860925..861130,
                     861186..861541))
                     /locus_tag="CNF03010"
                     /codon_start=1
                     /product="nucleolus protein, putative"
                     /protein_id="XP_571702.1"
                     /db_xref="GeneID:3258047"
                     /translation="MGGTRKKTRKESIVSGSSTARTSSVSHKVTRSTITAFHVLLRKK
                     ANITKKLQHATTDSERSLGQKELDVINNNISELGGLDAYQRASQLGQSKDRGGDSSRI
                     LVNWLLGMGMKKDRPLKMLEIGALRPDNYASERWLKNTPIDLHSQHPSILEQDFFLRP
                     LPISEEESFDLISCSLVLNFVDDPARRGKMLQLIHKHLRPSSESLLFLVLPLPCVNNS
                     RYLTLPVLVEIMEAIGFILVKERWKTGGKVGYWLWRWNNKRDSGKEGGLLQRKVLQRS
                     GAKMNNFAIVLP"
     gene            861842..864013
                     /locus_tag="CNF03020"
                     /db_xref="GeneID:3258387"
     mRNA            join(861842..862154,862217..862927,862978..863161,
                     863357..863464,863533..864013)
                     /locus_tag="CNF03020"
                     /product="expressed protein"
                     /transcript_id="XM_571375.2"
                     /db_xref="GeneID:3258387"
     CDS             join(861923..862154,862217..862927,862978..863161,
                     863357..863464,863533..863695)
                     /locus_tag="CNF03020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571375.1"
                     /db_xref="GeneID:3258387"
                     /translation="MPHHHSLPTSSADFGDFNSAPASSIQTSSLSQDDLLGSYDETIR
                     HSPSVKSHPSPDPRASNLDLLFLDHNAEEHRRPEPTYSPRSRPTGVLPESVPHARSPR
                     RLSTFSSSTSPTSPPSITDAGCDIIFHPFYDHMDVNATRAMQKMQGHGERGASKRSDK
                     MQLRGQASHSRIAPSSSPPHSRLLDTLATTTKLASKWRSVITHPTSPNTADQTHNGQP
                     KPQIRHAETSPMDITHDTPFASAEQIAGSYIPPTGAPGFTQASVLGMKHHGDGPFEPL
                     TLIGRKDSTSNVLTPEDAIGLKACLPPRQRLTNQWTLLFSLDQHGASLSTLYRLIDIY
                     SVSHQSSGNILVIRDGHGNRFGTYMNEPIVKREGTYYGSGESFLFKLTHSCQTIPYRW
                     TGKNKYFALCEAGFMSFGGGAGAYGLILDSTFTHNSSATCPAYNNDILCELEPLKSQH
                     AQSFQCLGLEVWSTL"
     gene            868180..875334
                     /locus_tag="CNF03030"
                     /pseudo
                     /db_xref="GeneID:3258210"
     STS             870531..871319
                     /locus_tag="CNF03030"
                     /standard_name="Xho1"
                     /db_xref="UniSTS:470842"
     gene            881305..887910
                     /locus_tag="CNF03040"
                     /pseudo
                     /db_xref="GeneID:3258211"
     gene            complement(889984..892383)
                     /locus_tag="CNF03050"
                     /pseudo
                     /db_xref="GeneID:3258215"
     gene            complement(893838..898550)
                     /locus_tag="CNF03060"
                     /pseudo
                     /db_xref="GeneID:3258214"
     gene            complement(899190..903887)
                     /locus_tag="CNF03070"
                     /pseudo
                     /db_xref="GeneID:3258213"
     gene            904049..910594
                     /locus_tag="CNF03080"
                     /pseudo
                     /db_xref="GeneID:3258212"
     gene            complement(910613..911191)
                     /locus_tag="CNF03090"
                     /pseudo
                     /db_xref="GeneID:3258381"
     gene            911191..916827
                     /locus_tag="CNF03100"
                     /pseudo
                     /db_xref="GeneID:3258314"
     gene            complement(919269..920093)
                     /locus_tag="CNF03110"
                     /pseudo
                     /db_xref="GeneID:3258380"
     gene            complement(921874..924560)
                     /locus_tag="CNF03120"
                     /pseudo
                     /db_xref="GeneID:3258315"
     gene            924828..926564
                     /locus_tag="CNF03130"
                     /db_xref="GeneID:3258407"
     mRNA            join(924828..925401,925454..925635,925693..925885,
                     925943..926564)
                     /locus_tag="CNF03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_571376.2"
                     /db_xref="GeneID:3258407"
     CDS             join(925147..925401,925454..925635,925693..925885,
                     925943..926248)
                     /locus_tag="CNF03130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571376.1"
                     /db_xref="GeneID:3258407"
                     /translation="MRALGKHLPRTLGDVAEHQNKLDWLTSSLISSLTLIKCYQQSLT
                     DLRSEILYLKEKISVIQEAQPHDGENRPRKKSKGTHLPEVVALVHRNVRILLGLPPCG
                     GKTLYSPEDWPDYDPVLAPNGYFHDGETNAVIWRPNWENLKCSFFSNLINAAVDACLQ
                     DSSVSTMPSREQLSRRVKEYLEGISKMKKKTKEEREANQLLKTICARVNPLSTWISAN
                     FENTPLAHCHESELIQTAFKRGILKSLLLVDHTETSVHGLSITQNTTNSQDDEVLTTD
                     SNNYDEFKVLCDLYEQERIDVLNWSLLSTFVQTVS"
     gene            complement(<928874..>933660)
                     /locus_tag="CNF03140"
                     /db_xref="GeneID:3258200"
     mRNA            complement(join(<928874..932190,932523..>933660))
                     /locus_tag="CNF03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_571377.1"
                     /db_xref="GeneID:3258200"
     CDS             complement(join(928874..932190,932523..933660))
                     /locus_tag="CNF03140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571377.1"
                     /db_xref="GeneID:3258200"
                     /translation="MSGPSTRSGRAVEKVEKGKEVEHTLDDDHNPAGSFNTNPQSDPF
                     TADNTSNDTQTQLEMMRNHIARLEQQKEELTHKLEESKVERQMFDNSEDNEGKNEQEL
                     DEEDEEPRSSRDLSAQTPYPEVKREYSRQRTSVPSSRPQEPKVSQPEYYHGQYTKLST
                     FITQVTMVITLQPSRFPTETSKVLYAGSFLRDTPFLWFQPFVTIDPQPKFMLDFKKFC
                     AELRKNFGDPDEEQTAERQLNTVRQQGSVSSYLATFMRYATLVQWNDEAKKACFYRGL
                     KDDIKDELARLPKAKSFKNLQDMAIRIDSRRYERVLAKRDQQPKAPFNATRSDYTRTS
                     YNNNRPNNFRRFSAANSMPIRSTTANTTFNKEVTPAVNLRAAFVPTLIDSGASTNFID
                     KRFVQTFNLKTTKIEDSIPLYLFNAAGQRTIIEEEANILVNFQKPFGHTLLRLLITDI
                     GSYPIVLGITWLQEHNPSISWETLSIHPPVSQTTSANLAMVITNDKPPKENTDAEIVP
                     KEYHQYLDVFDKKSADTLPEHRSFDHHIPLEEGKNPPFGPIYNLSETELEALREYLDE
                     NLKKGFIRPSESPAGAPILFVKKKDGSLRMCVDYRGINKITIKNRYPLPLIAELLDRL
                     KSAKVFTKIDLRGAYNLLRIKAGEEWKTAFRTRYGHFEYLVMPFGLTNAPASFQHLMN
                     HNFRDLLDIFVIIYLDDILIYSPDLETHQSHVIQVLDRLRQTQLYVKASKCEFHQTSV
                     EFLGFVVSDQGLSMDTKKVKSITEWPTPRNLRDTQSFLGFCNFYRRFIKDYSSIAKPL
                     IDLTKKDLPFVWEEPQRTSFEALKKSFTSVDLLRHYDPTKQLILETDASDYAIAGILS
                     HEIDKKLEPVAFFSHKMLPAELNYPIHDKEMLAIVSAFKEWRHYFEGARETIRVYTDH
                     RSLEYFMTTKQLNRRQARWSEFLADFDFNIIYRPGVQGTKPDALTRRHDYHPLEKGSS
                     LTTAANPQNFQTLLRPGQYLGTATTGLDRLEISSPIKSLLKTGLETDESAKPFLDKAN
                     HPSEAHPYTRDDEGLLRYGESFYVPANNELRTLVTKECHDALTSGHPGRRKTIQLIRR
                     HYWWPGLKGFVNHYIDSCDLCCRTKTRRHQPYGELKSLPIPPYPWSSVSMDLIEQLPP
                     SHGYNTILVIVDRLTKMALFIPTTTSLNAEELAQLYVTHVFSKHGIPTSIVSDRGSEF
                     TSRFWRAFTQLLHIELELSTAFHPETDGQTERVNQVLEQYLRLYTDYKQKEWAPLLPV
                     AEFTYNNTPHSSTTMSPFFANKGYHPRASFTPDDNVPIFSPPARASITDLSKLHEHLK
                     IEMSKAQESAALQFDKHRAPLPEYTIGDKVWLSARNIKTKRPTKKLDHRYLGPYTIIA
                     RVSSHAYRLELPKSMRIHDVFHVQLLEKYIENEIPGRTQVAPSPIEVEGDLEYEVECI
                     LDHRFYRKRRQFLIKWLGYSAEHNSWEPETALENASEIVDQYKSTHRL"
     gene            complement(936177..937572)
                     /locus_tag="CNF03150"
                     /db_xref="GeneID:3258207"
     mRNA            complement(join(936177..936705,936768..937021,
                     937074..937396,937453..937572))
                     /locus_tag="CNF03150"
                     /product="expressed protein"
                     /transcript_id="XM_571628.2"
                     /db_xref="GeneID:3258207"
     CDS             complement(936334..936681)
                     /locus_tag="CNF03150"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571628.1"
                     /db_xref="GeneID:3258207"
                     /translation="MHYQRRDIEFEERMCFGQLLDIITVILPHHPTSNADSGEITIAL
                     AHVNPIMDRKVTLGSKDWVCYDRFAKEELVDLASVNQSMDRVESIIKGKKKKNFIIDC
                     GAPASRVMFTAAE"
     gene            complement(938913..940785)
                     /locus_tag="CNF03160"
                     /db_xref="GeneID:3258302"
     mRNA            complement(join(938913..939098,939150..939264,
                     939322..939503,939550..939614,939673..939751,
                     939814..939925,939987..940222,940278..940301,
                     940352..940376,940430..940474,940531..940555,
                     940664..940785))
                     /locus_tag="CNF03160"
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /transcript_id="XM_571627.1"
                     /db_xref="GeneID:3258302"
     CDS             complement(join(939018..939098,939150..939264,
                     939322..939503,939550..939614,939673..939751,
                     939814..939925,939987..940222,940278..940301,
                     940352..940376,940430..940474,940531..940555,
                     940664..940694))
                     /locus_tag="CNF03160"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="XP_571627.1"
                     /db_xref="GeneID:3258302"
                     /translation="MVVKVGINGFGRIGRIVLRNAIEHGDLEVVAVNDPFIDLDYMVY
                     MFKYDSTHGRFKGSVEVKDGKLYINNKAIAVFGEKDPANIKWGEAGAEYVVESTGVFT
                     TTEKAGVHLKGGAKKVVISAPSADAPMFVCGVNLDAYKPEYQIVSNASCTTNCLAPLA
                     KVIHDNFTIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGAAANIIPSSTGAAKAVGK
                     VIPSLNGKLTGMSFRVPTSDVSVVDLVCRIEKGASYEEIKNVIKKASESPELKGILGY
                     TEDAVVSTDFIGSTESSIFDAQAGIALNANFVKLVSWYDNEYGYSRRVCDLISYIAGV
                     DAKAQ"
     gene            940872..943384
                     /locus_tag="CNF03170"
                     /db_xref="GeneID:3258239"
     mRNA            join(940872..942185,942249..942504,942557..943213,
                     943275..943384)
                     /locus_tag="CNF03170"
                     /product="expressed protein"
                     /transcript_id="XM_571602.2"
                     /db_xref="GeneID:3258239"
     CDS             join(941347..942185,942249..942504,942557..943186)
                     /locus_tag="CNF03170"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571602.1"
                     /db_xref="GeneID:3258239"
                     /translation="MHLPSILRLHSRSSFVIIVTGLRRYLFNKFPRQPCINFPYIYDP
                     YLLSQIQLEAIMQASSHHFIPLADQTNHGSSQPSQSPTIASTSHRPSRNHLWVSSYRS
                     PTQPDAAARPLHFGGTSYHCTDDNVRSPPTSISSLNESCPLSQMSAYEVAHHNPLFQL
                     DPNLPARQQQRNVPMDERFEYSIVSTPTSTTPEAQPSQQLETVASRYDWQPPLGPNGP
                     KNTGRATKGKGKGKGYRGKRKQRGTTGGSQTQHTISQGNSMTFAHIHALDEFVVDNII
                     DYQSCTNEKFKITDKAACSDLQEQINDDPDMQKLIQKRLTGDYLYHHINYLMKNYINP
                     ISDVLEKSGMNWNEVEHKIEAGDEQWDEWQASGIFVDRIRNHPFPLYFKFKEALNFKS
                     ANSDNAVNFFLEEAESNFPSQQETVEVTSSLSRKRRHEGNAKYRREEEEEEEEEDEED
                     EEDEEDEEDEEDEEDEEGIRSRPVPRRDAEQSFLDRDQAIIGILDKLANIIAIRNDKM
                     TESRRRADDVNIVARFLEVDGQISDVQRDKILSKCLESRSVLNDMVVLAKDPNGRVRR
                     IILDKVLK"
     gene            945262..946769
                     /locus_tag="CNF03180"
                     /db_xref="GeneID:3258061"
     mRNA            join(945262..945560,945615..945792,945842..946247,
                     946305..946769)
                     /locus_tag="CNF03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_571604.2"
                     /db_xref="GeneID:3258061"
     CDS             join(945477..945560,945615..945792,945842..946247,
                     946305..946614)
                     /locus_tag="CNF03180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571604.1"
                     /db_xref="GeneID:3258061"
                     /translation="MARETLSSAGTRYNKTAVFTADGVLFDMDGTLTDSIAAVEAAWT
                     AKAEEFGLEPEAVIKATHGRRASDNLQDLIPNLRKEHIDREVEKFEQSILAFADTPPR
                     SRRSSSASSTRTSRSDSRSMSGSMGPLAPFTPMRSCTPAATKPFSTDEALNLTSFKLS
                     ESRGLEPQSDDSVFEDEADDLIDMSVRILPGVRSLINSLPQDKYAIATSGAKTYCHGC
                     LNRTGITIPKVCVTADDPRLLRGKPFPDPFLLAAADLGIDPTRAVIFEDSPSGIKAAV
                     AAGATVIAVCTSHQRHQIEHLDAHFVVDTMDQIEVVQGKDGQLEFTIRH"
     gene            947434..949363
                     /locus_tag="CNF03185"
                     /db_xref="GeneID:36392911"
     mRNA            join(947434..947902,947962..948049,948107..949363)
                     /locus_tag="CNF03185"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658581.1"
                     /db_xref="GeneID:36392911"
     CDS             join(947843..947902,947962..948049,948107..948624)
                     /locus_tag="CNF03185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514507.1"
                     /db_xref="GeneID:36392911"
                     /translation="MPSKLHILSRRGCAYHSGDTSGKTFDSTGKVCSALTSEERVLLA
                     IVLSLCAFVLVILAGIYARQYIKGKFEAKASTLSTKRPPMSAMRAPLIIAIDPQSTTS
                     LSLSPYSSESDATSSCPSSPYSGYCQSSHTFHFPLLSADGHLLPAPPASVRQSVKELL
                     PVDERPLPSPPQAKLHLYSPPLGSPPHWTYEPLPDYLSSMGDEQGIQPIGLYPGIEME
                     HAN"
     gene            complement(948832..952134)
                     /locus_tag="CNF03190"
                     /db_xref="GeneID:3258150"
     mRNA            complement(join(948832..949117,949160..949278,
                     949317..949650,949703..949768,949809..949967,
                     950009..950104,950155..950421,950478..951091,
                     951142..951439,951503..952134))
                     /locus_tag="CNF03190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657424.1"
                     /db_xref="GeneID:3258150"
     CDS             complement(join(949073..949117,949160..949278,
                     949317..949650,949703..949768,949809..949967,
                     950009..950104,950155..950421,950478..951091,
                     951142..951439,951503..952033))
                     /locus_tag="CNF03190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513125.1"
                     /db_xref="GeneID:3258150"
                     /translation="MSSPENDRVLDNLWTTEDESFEVQMPDFHFDWGLEKGKTADQGI
                     KAPTASLRSLSINEITPPLPSGSSSTSTPPHSTISARSSISSAQILPKRDISNASSSP
                     HIPTPPGSIANPGHRSLSAQNFANSGGSSGGESSGERGKTYGGRKFQRVVSAPISPEN
                     GTDTEGVEFQVSGNVCSRSESITNPHTATIRPPHTQLPSAPLVDASTVASRSNLVTPA
                     LPERTLPFARSTVRRLGGLSKFGGPARRVILPQGSEDVQVQESGDVNELQGRHSSAPI
                     NPPPQGPPDVYCSSDQAIVSPTATAGCESRLTNISHPDDRPVKPARKPVNQSVHEINE
                     SIHEPMALATQSQAEHGVSRTSAAVPSEGEDRLFRPFGKLEETLRPVAGPSKASGLMY
                     MDSLPETGPEVRGIQINNPRSSDVGKPASPPYRNLRAARPPPVAESRRNAPMVSTATV
                     VNAPASHPAMPSEILQPQPTQSAPQGKTLFHVNGVPYERLQRLGKGGSSTVYSVLYSG
                     PKKRIIYALKVVQLDRADSETYQSYTNEIELLKRLRGHDRVIQLIDHQITFNQHNRPH
                     RLLMVMECGEIDFAALLDEQRGKAINMNFVGLYWEQMLEAVQAVHRENVVHTDLKPAN
                     FVLVKGRLKIIDFGIAKAIANDTVNIQRDQQIGTVNYMSPEAIQRMNNQKVLKLSYPS
                     DVWSLGCILYQMIYGSPPFQHVSGGPLAKMGVIADPNHVVTYPEVAVPKAAVGFSLDG
                     HPTDPASLSVPVSPSAIDSMKRCLAYRKEHRLTIPELLQHEFLKPRIRAPAVPPGSTP
                     ITQYQMERLVNFILSENGLPELSEGNHTAEDLFSQLEAQNALSR"
     gene            complement(953005..955543)
                     /locus_tag="CNF03200"
                     /db_xref="GeneID:3258308"
     mRNA            complement(join(953005..953432,953485..953504,
                     953557..953595,953660..953843,953901..954162,
                     954204..954368,954418..954708,954775..954892,
                     954941..954973,955024..955121,955192..955367,
                     955426..955543))
                     /locus_tag="CNF03200"
                     /product="protein phosphatase 2A regulatory B subunit,
                     putative"
                     /transcript_id="XM_571391.1"
                     /db_xref="GeneID:3258308"
     mRNA            complement(join(953005..953432,953485..953504,
                     953557..953595,953660..953843,953901..954162,
                     954204..954368,954418..954708,954775..954892,
                     954941..954973,955024..955121,955192..955543))
                     /locus_tag="CNF03200"
                     /product="protein phosphatase 2A regulatory B subunit,
                     putative"
                     /transcript_id="XM_024658582.1"
                     /db_xref="GeneID:3258308"
     CDS             complement(join(953408..953432,953485..953504,
                     953557..953595,953660..953843,953901..954162,
                     954204..954368,954418..954708,954775..954892,
                     954941..954973,955024..955121,955192..955270))
                     /locus_tag="CNF03200"
                     /codon_start=1
                     /product="protein phosphatase 2A regulatory B subunit,
                     putative"
                     /protein_id="XP_024514508.1"
                     /db_xref="GeneID:3258308"
                     /translation="MDVEPTNQWRFAQCFGDKGEVEDITEADIISTVEFDHTGDYLAT
                     GDKGGRVVLFERNEQKRGCEYKFYTEFQSHEPEFDYLKSLEIEEKINRIKWCKRQNAA
                     HFLLSTNDKTIKLWKVFDKQIRVVAENNHTDGYGSGTGPSQPPLRLPRMTTHDSITAA
                     VPRKVYANAHAYHINSISVNSDGETYISADDLRINLWNLDISDQSFNIVDIKPVNMEE
                     LTEVITAAEFHPIHCNLFMYSSSKGTIKLADMRDSALCDQHAKLFEEEEDPSQKSFFS
                     EIISSISDVKFSQDGRYILSRDYLTLKIWDINMDSKPVKTINIHDHLRQKLCDLYEND
                     CIFDKFECTFSGDGSQVLTGSYHNYFRIYDVNGDNDVVLQADKSAFKAKKIGGSRGKV
                     PGKKEGLQTEGIDFAKKILHASWHPRENTIAIAATNNLFLYSTLS"
     CDS             complement(join(953408..953432,953485..953504,
                     953557..953595,953660..953843,953901..954162,
                     954204..954368,954418..954708,954775..954892,
                     954941..954973,955024..955121,955192..955270))
                     /locus_tag="CNF03200"
                     /codon_start=1
                     /product="protein phosphatase 2A regulatory B subunit,
                     putative"
                     /protein_id="XP_571391.1"
                     /db_xref="GeneID:3258308"
                     /translation="MDVEPTNQWRFAQCFGDKGEVEDITEADIISTVEFDHTGDYLAT
                     GDKGGRVVLFERNEQKRGCEYKFYTEFQSHEPEFDYLKSLEIEEKINRIKWCKRQNAA
                     HFLLSTNDKTIKLWKVFDKQIRVVAENNHTDGYGSGTGPSQPPLRLPRMTTHDSITAA
                     VPRKVYANAHAYHINSISVNSDGETYISADDLRINLWNLDISDQSFNIVDIKPVNMEE
                     LTEVITAAEFHPIHCNLFMYSSSKGTIKLADMRDSALCDQHAKLFEEEEDPSQKSFFS
                     EIISSISDVKFSQDGRYILSRDYLTLKIWDINMDSKPVKTINIHDHLRQKLCDLYEND
                     CIFDKFECTFSGDGSQVLTGSYHNYFRIYDVNGDNDVVLQADKSAFKAKKIGGSRGKV
                     PGKKEGLQTEGIDFAKKILHASWHPRENTIAIAATNNLFLYSTLS"
     STS             955511..956399
                     /standard_name="Pvu3"
                     /db_xref="UniSTS:470843"
     gene            955743..957326
                     /locus_tag="CNF03205"
                     /db_xref="GeneID:36392912"
     mRNA            join(955743..956367,956410..956520,956580..956681,
                     956740..956915,956986..957326)
                     /locus_tag="CNF03205"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658583.1"
                     /db_xref="GeneID:36392912"
     CDS             join(956146..956367,956410..956520,956580..956681,
                     956740..956915,956986..957259)
                     /locus_tag="CNF03205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514509.1"
                     /db_xref="GeneID:36392912"
                     /translation="MAAFSLFFRVIDRFVDGDVAIVQGQKHKYTIPACFKDLYWPRYD
                     AQTHGKYETYRDVEHLVAQARCAMEHEDIRPFFRIYCLFAELNKQNGQNTSFALCGIS
                     ADGKHLDYESNLTSSKRLVRSDKKAMMYMKTYAWFMEGIVPIPIGRFKLGASSLAEII
                     PFMGALGVFIVSFLMYSRTCQSITAPSWLWKEMLGPLQWAILFAFFIPEVGDIAASSI
                     SPSRRAARKVKHWLKLRSLLSRDQQYEDGSWQSRGLARVFPDPNTGGDPYEWRYTDHF
                     RKQLYGEGLVHLRKENEV"
     gene            complement(957537..958366)
                     /locus_tag="CNF03210"
                     /db_xref="GeneID:3258167"
     mRNA            complement(join(957537..957749,957798..957936,
                     958000..958111,958180..958366))
                     /locus_tag="CNF03210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657425.1"
                     /db_xref="GeneID:3258167"
     CDS             complement(join(957660..957749,957798..957936,
                     958000..958111,958180..958207))
                     /locus_tag="CNF03210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513149.1"
                     /db_xref="GeneID:3258167"
                     /translation="MSRSPITCHVLDSSQGKPASGVKVSLQILKAELSGPNDAKDKIL
                     ADGTTDIDGRCSTLLSPNVKLSPGIYKMVFFTGDYFKATGTETFYPVVEITFNYADPS
                     QHYHIPLLLSPFSYTTYRGS"
     gene            958512..959968
                     /locus_tag="CNF03215"
                     /db_xref="GeneID:36392913"
     mRNA            join(958512..958794,958850..958894,958950..959001,
                     959052..959206,959282..959968)
                     /locus_tag="CNF03215"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658584.1"
                     /db_xref="GeneID:36392913"
     CDS             join(958649..958794,958850..958894,958950..959001,
                     959052..959206,959282..959825)
                     /locus_tag="CNF03215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514510.1"
                     /db_xref="GeneID:36392913"
                     /translation="MDRDGNASPPTKDRPLLLSTPTTRVIRTFEEIRIPVKTEEVYPE
                     LECAICSHILGAAQSLVPCGHSFCGPCAWKWIKTNNSRATCPHCRIEISMTDPIVPNI
                     VVDQIVDRKLQKLEHGLEKEAMLLDRQEKLREWKDLQPQLEHFRRHIRTSRIVRGVDT
                     VLPNIGEDSGEPQINPRRASRNFAELGAPIDLGVSAPTIEELIGQSPSRRSQSSAEFH
                     SEMRERQRRALSQFLQTGTVGEVESNGIQEPPRTRTSRAGAMAAETRSRHRERPYPDS
                     HPPVPPYSTSPSMRRQPRGRGDGGTREDPQIVPSDSE"
     gene            complement(959931..960954)
                     /locus_tag="CNF03220"
                     /db_xref="GeneID:3258025"
     mRNA            complement(join(959931..960186,960242..960260,
                     960325..960523,960588..960758,960811..960954))
                     /locus_tag="CNF03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657426.1"
                     /db_xref="GeneID:3258025"
     CDS             complement(join(960102..960186,960242..960260,
                     960325..960523,960588..960758,960811..960897))
                     /locus_tag="CNF03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513046.1"
                     /db_xref="GeneID:3258025"
                     /translation="MTPDSSLDLLFDPSILPASAQDELGPDLYLRPLSSTDVLRGHIE
                     LLSVLTSAPPQSVSTYETIFQEMKASAGIYFTVVVVHRLSNQVVACGSVIIERKFVRN
                     AGLVGHIEDIAVSQSMQGRKLGMKIINTLVDIGLARGCYKIILDCSEKNIPFYEKCGF
                     KQKEFQMVRYLLDPSDVVKVPTPSKL"
     gene            961146..964804
                     /locus_tag="CNF03230"
                     /db_xref="GeneID:3258188"
     mRNA            join(961146..961468,961522..962563,962617..962842,
                     962898..963088,963135..963385,963435..963762,
                     963823..964085,964141..964804)
                     /locus_tag="CNF03230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657427.1"
                     /db_xref="GeneID:3258188"
     CDS             join(961176..961468,961522..962563,962617..962842,
                     962898..963088,963135..963385,963435..963762,
                     963823..964085,964141..964606)
                     /locus_tag="CNF03230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513047.1"
                     /db_xref="GeneID:3258188"
                     /translation="MPRRKNDYLSDGSDSDASNSARSQDGYNSQEDPDARDERRLFEF
                     KGNKRRKTDGRSGKDAAWEGIFGEEDGVGGVPRRGGIGGRGRPGPSSLRADWTKAPAF
                     VSNGSKTLQEEEEEGQVRQANTEEPERDEDENGSESSTSSDSDSGSENDDNGSSPAPS
                     PRIRDADDYNGEKQTTGGLGLGFRNASAQGATDEPTGEAGKREEGDATELASRSKAGI
                     GAGLSAGKKTLPDETIYSVGNEPHARSSTNDTIDHGPKPTGIPSSFGRPPPSLTAHSG
                     HHTQRRFLPRAQSPAASTTKAQLTASEKAHFSKIQSSFGARLLAKQGWEVGKGLGVQE
                     NGRAVPIEVGKVLRGQGIQRGIRTEDSKREARRQGVTFSDDEDDEAPRRRRHREKGPK
                     VHKEKNEEDQGWKRQKKVKVKVQHKTYEQLLAEAGDAVPAAGIGLVLDARGGELKEVQ
                     SLSSLSLSTWTPSSDSTRLPELRHNLHLIVDAAKQDVSGLVREGKKVNERRRWALREE
                     EISRAKAEEASTKISRLKEIQEIVDTISHVATEQTVSSTSSLAPLSNSFELLIHKFQE
                     EYQSLKLDDVIVGAIGQILRNAFTEWRPFDVSSNVLLSSLKTWKKAYNLPEIIDNDTA
                     VATLSLRGKNAAVDRIDAGGERVMTAWESLIWHLWVPKVRSAINNEWDPLSPNDAVHL
                     VESWEPILPLFVKDNILDQLVLPKVKVAIEQWDPKRNKRERRSKSLASIVFPWLPLLG
                     ERVDEVMDLAKRRIRHVMRSWAVKDGVPEELSRWRKDVYSSNEWDKLIIQFVLPKLGL
                     CLREDFTINPRKQDMVPLQDWVLPWHRLIRQSMFSHLLEVEFFPKWLDVLYIWLIQPS
                     YKANEVATWYQWWSERFPEEVRDMPGVKQGFESGLNLMQEAMDLGPDAPAKLHKPKFE
                     PRSTKKVLQTSTTPKLRKPEPPGIVATDITFRSIAEDYAAQHDLIFLPLGRSHDKTGK
                     PLFKVCRNVDGKGGVTVYIGEYAVFAKMDDGEFRAISLEDMVKKASA"
     gene            complement(964744..967102)
                     /locus_tag="CNF03240"
                     /db_xref="GeneID:3258350"
     mRNA            complement(join(964744..965298,965353..966397,
                     966452..967102))
                     /locus_tag="CNF03240"
                     /product="expressed protein"
                     /transcript_id="XM_571625.1"
                     /db_xref="GeneID:3258350"
     CDS             complement(join(964942..965298,965353..966397,
                     966452..967059))
                     /locus_tag="CNF03240"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571625.1"
                     /db_xref="GeneID:3258350"
                     /translation="MPTFHPSIDHIKSVHLSPLARDGYVHLNFFATFDRQDLSSDLVP
                     EHGRWEIWTDIPFFDSKGNPPAYPGEWRSQQFTPFKTFSDELNGHAASTDRGSGLTLK
                     PVSLPEPAKLLTTLHLVLVIPAEANRSYSYTFRYVYPDGQINWQSGVGGNGIVNLKEA
                     DTSPDQTKIRSGSNWPPVHNAFEDSDSWDWRGIGVTLQRSGERAVKPQIQPLPPQKEV
                     KQTFALLHGPPTPHLSSFSHLSPTRLPIPIKAPTSYLAVIGHPDNPLFQRGLSPMGSC
                     NGIPASYALGVESFPSEVLREAVKASKGDQSHLIVAEVKEKDNLSKDVGALIYHSGKE
                     EPEKSYLIVDAVHSHHPRDITVIIPESFVTAAPLAVISDYSPVPPLYIPNSTDMSKPR
                     KIPIYIQPGAAAEVLRLVEFIQLRSSETDNSSVWICAPDGIDYEVGEEETEAEPTNPM
                     ENKSYFSLPRDASAPVVVVPAVDGAHTPQTELAGPDDISSVANHNSKPDDGRWWIFKA
                     ITKFFSTIWNFILSPFRSRPTPLIKGAGDDVKSANNERTPLLDPGLSHSISDTPSASQ
                     TASSFSDPITPLPQTVTITSYVCFTFDHPAPFQFLLPPASNTLLGNLTFTSKQKAAAS
                     WTGLNLRVTDTNGGTVRAEAYADEDGKNVGTGSRDKWLVKIQQSM"
     gene            967289..969422
                     /locus_tag="CNF03250"
                     /db_xref="GeneID:3258103"
     mRNA            join(967289..967420,967489..967503,967556..967565,
                     967616..967649,967709..967715,967766..967846,
                     967896..968005,968063..968207,968264..968388,
                     968437..968506,968554..968780,968834..968850,
                     968911..969030,969090..969176,969245..969422)
                     /locus_tag="CNF03250"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_571606.2"
                     /db_xref="GeneID:3258103"
     CDS             join(967387..967420,967489..967503,967556..967565,
                     967616..967649,967709..967715,967766..967846,
                     967896..968005,968063..968207,968264..968388,
                     968437..968506,968554..968780,968834..968850,
                     968911..969030,969090..969176,969245..969266)
                     /locus_tag="CNF03250"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_571606.1"
                     /db_xref="GeneID:3258103"
                     /translation="MGILEKIDDIEKEMARTQKNKATEYHLGLLKAKLAKYRAQLLEP
                     EKKSAKGEGFDVLKSGDARVCMIGFPSVGKSTLLSKTTKTESVVGAYEFTTLTAIPGV
                     LEYEGARIQLLDLPGIVQDAAKGRGRGRQVVSVAKTADLILLLIDATKSAEQKRLLEI
                     ELEAVGIRLNTRPPDVVFKQKQAGGITLNCTVKLTKTDERTIRSILQTYKIHNCDVMI
                     REDITTDEFIDVLLGTRKYIPSLTVINKIDGVSMETLDSMAREGDGRTIMISCEIDLG
                     IDWLLEAIWKELGLVKVYTKRRGEQPDLNDPICLRQGATIETVCHGIHRSLASHFKYA
                     LVWGKSSKFNPQPQKVGLNHLVQDEDVVSIFTK"
     gene            complement(969395..972540)
                     /locus_tag="CNF03260"
                     /db_xref="GeneID:3258371"
     mRNA            complement(join(969395..972008,972062..972183,
                     972243..972540))
                     /locus_tag="CNF03260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571622.1"
                     /db_xref="GeneID:3258371"
     CDS             complement(join(969649..972008,972062..972183,
                     972243..972424))
                     /locus_tag="CNF03260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571622.1"
                     /db_xref="GeneID:3258371"
                     /translation="MQPFHPHTPQPTHHLYAPSTPDSPSFEKESHFSSSSADAQARQK
                     REAADGVVRDYEDKRDRLAKAIESSVYLLADLKNFNGQQWTVRYPHLRSSEPVEPGSS
                     SPRPGMSRRTLTFADEPSQLTEVVLSSTPTARHSLKRSLSVAPAPSLSPSTSDNSATL
                     VAEPTSIDQSEDDFSILRLDLNMGVTRHAKHLISHLEKSSISALLDNRITASLDHLTN
                     LQKRIYDAHSRVLVTGDLNAGKSTLINTLLRREEVMPTDQQPLTTRFVEVVSARENDN
                     KEEIHVLDKAAQYNPLDDSTYSVLDISKLEELVTDPDSDASSPPLRVFLREADIDVAN
                     PSILHNGVVDISLIDAPGLNRDSIKTTANFARQEEIDVVVFVVSAANHFTLSAKEFIW
                     QAGHEKAHLFIVVNRFDQIKDKARCRRLVLEQIKQLSPKTYEDADSLVHFVDSAKAAM
                     GYAEGETDELDDAFSHLEHSLRSFVLVNRSKSKLGPAQNYVTHLLADVELLAAANSLV
                     ASKERDNARDELARVKPVLEKMKKGREGLEDGLVHEEENVTEQVAERTKKGMTTALER
                     VGRGELAAPAPGLHLPSYPGLLGVWDYAAEVKRVILASLDFAVGLAEDDARKLTAEGV
                     DRVIALGDAHLPEDVERSNRRFNPQAMFTARPRARRQSGVSSVGLGLAAQSHLKEVNV
                     ADIFDLQHHIFIARSSLPSSSSSSHSSLDLIPVSAEGFGAASLAFGAFSMVSGKTVGL
                     RAAIEGLAHFSDFVSNPSTRRWIGPVLGVVTAGAIAYIIYDLPNSIPRNVGRHLQSTL
                     LSSSGNPASDDATVAFPDAQAARVSKEVRKVMRLAAWDLRERFRAAVDARGELVKESE
                     EQEKKANKALKWFEEVEKRVDGIREEVGIKV"
     STS             970424..971361
                     /standard_name="Hind34"
                     /db_xref="UniSTS:470844"
     gene            972751..978274
                     /locus_tag="CNF03270"
                     /db_xref="GeneID:3258087"
     mRNA            join(972751..972995,973042..973461,973515..976343,
                     976397..976668,976722..976995,977050..977600,
                     977661..977834,977888..978004,978060..978274)
                     /locus_tag="CNF03270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657428.1"
                     /db_xref="GeneID:3258087"
     CDS             join(972798..972995,973042..973461,973515..976343,
                     976397..976668,976722..976995,977050..977600,
                     977661..977834,977888..978004,978060..978153)
                     /locus_tag="CNF03270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513049.1"
                     /db_xref="GeneID:3258087"
                     /translation="MAAAYPLDTPSRVLKRVQQMEDMELPSLPSFHHDDLDYDSMSAA
                     ESSREYGQDTHSEHQSDQEDEQVMTTPHPLRQAVVSSTITTAKSNRSPADSFSNASGS
                     PFPPFIDGSREETPSPYEPTTALTSTPLSRSLFDNTTSNTITSTQMTRHERTISGAGS
                     IASSSATKRDRWQTPGEMSRSFSGDEIPPSDGLGSERSVPLNDTSEYDHSREVPDLPS
                     LTAPEETPTTRRLSSSNIQFERPRRRAFSTTPFEAIEEAQTESSAPSTPQHLEAPAQI
                     DETQPAQQERIPSLSRSEVTGTDHSVTSTPEGPIRNVSMMTPRADAPGEYELTEEHHY
                     NPESQSEGENPTLDYNQEYEYTPQQENAFDPSGDYGTPSKPFSPAKHAFTPSDDVSTP
                     GTIRAMPATISSLSSTASSPEALQDVRDTRQNTPFTPSPNGTPKISDFETPRAPLDDA
                     QRRKSHVLAVLNSAAPPSRTLRRSVRGTPHPLRRVSTAPASESIAEENSDIQEHESTP
                     TTNGLMSRLTDVSGNESFVSVASSADLTTDGRASRYQRLSRGNISFPLLPVNPSTSSG
                     SLKGFTDRGGPNIKIHKHLNEMNKQLLETNAELAREAEAWRDEVERLQDILHRAGIDA
                     DEDASQTGARSNRSVSQSHSRQLPAPPRRSPSRTPGSRDHSEIISQLSMRSGQSASPS
                     KNAQDLLDGLSPEERAAVIQEMAERLESLEEEMNTREEVIAELQDKLEYAHQSQSPDV
                     QSLHAQIEELARQLEETEQARVDLQSEFSKKTEDHAAKFTEICSGFESQVKSLEKDLA
                     SAREEADRLRAERTRLEGLAEKEGSSEREEELRKQVREMEVELEAIKGQAKDMHEETE
                     ELRGKIQLLNKEKEEATKKFEDAERRVEEHQKLHQDSEHRAERAENDLETLSAELKEA
                     SNAQLAADEKLAQYEKELEQLDQLHEEKEKQLDQQQNEIQELNRLVQQLEAAQEKAAE
                     NEWVKEELERVQKELEDVHKLLEDKEIQLGDLRGKLEVAEASKDLTSSQRRSPSGTSS
                     TSDRGEDGHVAQNSFVIALEDRLDEAYREIGRLKREINTTPHRKSAIEVRDARIQALE
                     REKAALSDRLTQQRSPSGTPMSGSGRSAMIDAGSPFKRPTPFVHKTIASLRAPKTPGS
                     LQEPSWLQTTIQSANEPLLQAQMEYLQQELKEANEQLDQNFNRLEAAGLGAVQLAEKL
                     AAAEERISELEDEVRTLGQRNKASLALVGAQREEQEQEAESRLKKALDEVHRQMDRLK
                     SDINAERARLQRDNSRLQDLVSEMRLKSNAEVESFKTEMERMAEESEREVEQAREEVK
                     RVEKERDELKRGIQISKSQVTQLERELADERRAYDSLSRRNAQIACDSTTAGQLQAEL
                     SQKSEAIRLLESSLRDAESISNHLRESLARRDQEIRESEAQVNKYRREREIIAQELRE
                     FENDLQKHKIESEDFGQQLQALKREQINKSSKHAAELLALEREMEEAKERERRLRHEV
                     QDVKTKYEKVEKWRELHECDAGLSDTLAEQKSRFKSQSRELATQIRYLKAKYTREATF
                     RNALALQKRYLLLLVGGKSLNEQATIKAIAKMGFPIPEQPRPARTFKAVALAVLSTIR
                     ARNDAARWRTEVDLKISAAAARNERRRVSGRI"
     gene            complement(978408..980029)
                     /locus_tag="CNF03280"
                     /db_xref="GeneID:3258300"
     mRNA            complement(join(978408..978681,978790..980029))
                     /locus_tag="CNF03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657429.1"
                     /db_xref="GeneID:3258300"
     CDS             complement(join(978650..978681,978790..979885))
                     /locus_tag="CNF03280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513050.1"
                     /db_xref="GeneID:3258300"
                     /translation="MPPKRQTPKDTPLPEEVNSLPVDGDLNSQIAAAILYLSKLVGQQ
                     NSSAAAQGNYAPRGISIPEASDIPTFTGPIRDVPAVILHTDRLYKLLRTYSLFSPGND
                     DVREENRRVTILELANNSIECKALQAWVRTTGRMMEEDGESGWEECIVAFKDAAMPLE
                     WAQKEFRSLFRLQFNQVSDWPTFDQQAIQHRHNLMGTELYPSDTFMANLYRAACPEIL
                     FLRLMTKPEFKNGSLSEVCTQLQLEVRKYLEEKKEQFTPTRAKAQNSATPQTQPHLAH
                     PVSHYYQAQNPLPYYLSPAGKHIRKLFAKENRCNDCRKVGHNFKTCPSRRPSMRSNPH
                     PVDNHEDLIQELTSQLDDYLKLETFLDLDETSWQLAPRRLL"
     gene            980363..980460
                     /locus_tag="CNF03290"
                     /db_xref="GeneID:3258423"
     tRNA            980363..980460
                     /locus_tag="CNF03290"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3258423"
     gene            complement(980831..982075)
                     /locus_tag="CNF03300"
                     /db_xref="GeneID:3258116"
     mRNA            complement(join(980831..981350,981418..981581,
                     981655..981736,981790..982075))
                     /locus_tag="CNF03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_571403.2"
                     /db_xref="GeneID:3258116"
     CDS             complement(join(981002..981350,981418..981581,
                     981655..981736,981790..981911))
                     /locus_tag="CNF03300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571403.1"
                     /db_xref="GeneID:3258116"
                     /translation="MDPNSIMTPATGAISSRFESQSAIDEARENRKKEWAEAYARIGQ
                     EPPPEEPETDYDARTLYERLQAQKELKKEEWDSKMKLSNQWRGLNADEQRFLAEKEAE
                     KRAEQKKLEEREAEEMRAYRERLAARNTSQTDASPPTVAAVAKSAPPKKIPSKDVKKK
                     DVKSLMKGVVVKKKAKLPAAPSADKPSTAPEAAEKPDSSSSKPLELEANNKTGTKREA
                     PSDVADAEDEKRQKLEENKA"
     gene            982146..985140
                     /locus_tag="CNF03310"
                     /db_xref="GeneID:3258186"
     mRNA            join(982146..982280,982345..982460,982517..982721,
                     982770..982873,982938..983011,983083..983117,
                     983174..983191,983248..983335,983398..983580,
                     983652..983953,984008..984549,984617..985140)
                     /locus_tag="CNF03310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571608.2"
                     /db_xref="GeneID:3258186"
     CDS             join(982212..982280,982345..982460,982517..982721,
                     982770..982873,982938..983011,983083..983117,
                     983174..983191,983248..983335,983398..983580,
                     983652..983953,984008..984549,984617..985007)
                     /locus_tag="CNF03310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571608.1"
                     /db_xref="GeneID:3258186"
                     /translation="MSRRLDLSKFAGSDSEGEEDVPKHQLELTALKSKTFSQGITKKT
                     KRDLEKEAEERKRIEEEKAAALVMAEIEREFEGSAEGSSSGHTGMRGFRGRPIGPGGG
                     FVRAGGAPMGAPTSFAPPRGPAAMGYGRPKPMPVRAPSPPPPPSGPKPRGKRAMDSFL
                     EEIKHNQNAREQKFSQIAKKEGSSVTALAAWETGGSGFDHESTNLFISNLPQEITEEI
                     LGLHFAKQGPVATVKIMWPRGDEAFSQASARRGLTGFVSYMERKDAERAVKELDGSEW
                     MGNSIRVGWSKPVAKPLKALFDITSDSHKRRRSRSRSRGRSPPRKKSHRARSYSYSSS
                     SSYSRSPSPERTCKQKWLDSIPEEHGRFIKTVANRVKEHGKGFEDVLMEKERENPKFA
                     FLYDDKLPDYHLYQSTLSSHYRIPSPPPEAFNDDGYASIYSSDSAEDSERERTSKGKL
                     GRLAKRRFEAMLRVMTGKRAEIARGMEFALRRAEAADEIADIICQSVQVDSTPVPRKI
                     ARLHLISDILHNSASPLPNVWRYRLAFEHRLPPVLAHLNTVEKSLMVYSGKISADVFR
                     GQVGNVLDIWERWIVFNTDTAELFRAVLVGDKPLSALVKTPQGAWVDKAKLEAEEAER
                     KKRENEQQKAEEEEDRFEQSGFKSSFKRINPQAGPAPAPESVPSAVRSAFEDEDLDGE
                     VMEDLDGEAMEDLDGEAMEDLDGEAM"
     gene            complement(985026..986612)
                     /locus_tag="CNF03320"
                     /db_xref="GeneID:3258278"
     mRNA            complement(join(985026..985896,985943..986341,
                     986386..986612))
                     /locus_tag="CNF03320"
                     /product="ribosomal large subunit assembly and
                     maintenance-related protein, putative"
                     /transcript_id="XM_571405.2"
                     /db_xref="GeneID:3258278"
     CDS             complement(join(985075..985896,985943..986341,
                     986386..986604))
                     /locus_tag="CNF03320"
                     /codon_start=1
                     /product="ribosomal large subunit assembly and
                     maintenance-related protein, putative"
                     /protein_id="XP_571405.2"
                     /db_xref="GeneID:3258278"
                     /translation="MAPQELVLSAPSSAPAAAIHLHDLLTSASVHAFKPCATAPCSLA
                     HVPTYNNQGGAVFAVQEDKALLHVWAWQKDQMHLKLHLPEKMACFTVSPNGYWAAAGS
                     PNGHIYLWELSSGLLVSSHTAHYRALTSLTFTPDSRLLISTSLDSSAHVYLVSQLIDP
                     EDPAKAGKPYATLRDHNLAVRCVGLGRVAGSQGGRLWTASDDGTVKMWSLYPPFDLLC
                     TFVLPVTCTPTTLAVDPSERFFYVGTTQGDVYHFPLFRKRAVLGDHDQSAAAAAASQD
                     EWEAVGGDGNASAPIKPQGAVISLKDANDSITSLALSLSSTHLLVGTSAGNIQIHSLP
                     SHQHLRTLSPHAGPVTHLTTLLRPADLVGSVGVGAGAGAKGEEIPIMEIKPLERLKGR
                     PPQESHEPTVLLRPPTSHAASLLSDLRPPPAPAVTRRQAMGDAGTTSDQVGQLLAENK
                     RLKAAFERAEKINEKLWNKVMDVNPGTNA"
     STS             985648..985847
                     /standard_name="GGC3"
                     /db_xref="UniSTS:470845"
     gene            986773..991317
                     /locus_tag="CNF03330"
                     /db_xref="GeneID:3258376"
     mRNA            join(986773..987899,987970..988167,988247..991317)
                     /locus_tag="CNF03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_571610.2"
                     /db_xref="GeneID:3258376"
     CDS             join(986816..987899,987970..988167,988247..991230)
                     /locus_tag="CNF03330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571610.2"
                     /db_xref="GeneID:3258376"
                     /translation="MHAWLDGLQRKIAHGIHPPSPPAVSEEDNVEAVEADGAAYATDE
                     QSSHGDESDGIEYIGQSNSPQPPLPNLYPPLPDAPTPYADPGAPRTAASPAVPPLGGG
                     HDLVVEQDAMQIDPNLLQDGYQIDAGFLQDLVHHVSQGMAPPPQEGDAEDYEGEEEVV
                     DGAYDEDFMMSGDEREQARDVEEYSEEEEEEDELVDEPSGMSPTKPVISYPNDTNKET
                     DEEQESPIKVQAATVREVIEIGSSSEEEASEDGSEAGRREEDEEEVEYEEEEEDELAR
                     DEPRHPSWFVDEAAAEEEEEEEEEEEEEEEEEEEGEEEEEEEEEDEQDTTHSQTPVDL
                     LDQDNELERQQEKESLQEDVQGQVQLPRSSPAPTGIPVETVEIVEIVETVETSETTTR
                     TTEVIEVEEMDDEDELADDDDDKVDIERNEQVEFPSTTPAPDAAVEQRQQEHQQQQQE
                     ADTGLEVTEIVETRETGETKTTNLPTGKEEAVQVEDDVVVTITTIQEKGQAEAEAEAE
                     GSGSRVHPEPPIDLLRPALEDGPVWEIPQGSNDSTLRAASAPFETLPETAADADADAD
                     ADVDANGDLPDPAAPPPPTSQIAPLSPHSLRPHPPATASVIVQLPPDEPPSRIEDISS
                     TPPSINEREQTPVEFPDPKGAPPDTNTQAPIDPHDLKPRASFSPSLIVEPPADPRPVG
                     EISAVVSRAATPVQFPDPRLPPVDSYLEAPITPHRLEPRSRAPTESLMVEDGQEEGSV
                     AGRTVDGATEIERAPITEPLHVSEVEVEVPVPQNGNGTAGPMTFDEDMPMAALDDYDV
                     EWVQALERGTVAHRDEAEMAESEPVELPKDAEYVEEEQEQRQETEFSVGEQAGEDQGE
                     PAEEKIELEEPTEDAGVKAPQQDEEDVDDDDDDKSGRKDKGKGKAFSTTPIDEEQVLN
                     DDQPSVPVLVDASPERPPLIMSTSAIERLRHHHTLASGAAPGAASQSGQSNQTPSQIH
                     THKRTRSRARAESSPPPPPVTRSNCYYEKLKVADYGGLEAVILAPHCSLANTEQIEED
                     EAVVQGVPTEEEEQEARKCQLSHDNEVLHPVLCTKIRRIVGLQIFDEGCCYLLYANKD
                     ARLPEPEESSSKKTETPTGTISSRGHRKRKSTSAQLGEQSTTASPLKPRASPLGRSAL
                     KRSGASLEPPESLTPRKKSKEPSLEPAGSYTTEVGDDHSAAGSPGPSSTRRLQTPRRS
                     TRLSSVRREEALEGKAEHEKELEAVQEGEVEMEEAGQEGEGDKREKTVEDKAPQTPRR
                     SARFLPAEEIDNDSSDHLLGSVTVSQSETSQHSPADSALRKTPSPIREQNNAAYLPDV
                     EDEDTDSEQEEEEETAKEDEESTSEASSKTVSKKRKARDESEEEDDQEDEGEEGTIES
                     RVVKRRALEDEETGTPVSENETGEAAGDGDTQRRGWGKWFRWW"
     gene            complement(991543..991640)
                     /locus_tag="CNF03340"
                     /db_xref="GeneID:3258494"
     tRNA            complement(991543..991640)
                     /locus_tag="CNF03340"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3258494"
     gene            complement(992961..>994175)
                     /locus_tag="CNF03360"
                     /db_xref="GeneID:3258457"
     mRNA            complement(join(992961..993397,993458..993521,
                     993574..993743,993792..>994175))
                     /locus_tag="CNF03360"
                     /product="NADH-ubiquinone oxidoreductase 30.4 kDa subunit,
                     putative"
                     /transcript_id="XM_571409.2"
                     /db_xref="GeneID:3258457"
     CDS             complement(join(993203..993397,993458..993521,
                     993574..993743,993792..994175))
                     /locus_tag="CNF03360"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 30.4 kDa subunit,
                     putative"
                     /protein_id="XP_571409.2"
                     /db_xref="GeneID:3258457"
                     /translation="MASRTPLLALRAARTARPARAPARALALSARRQQEPSVSPFKEP
                     AGVNPAEKLAPAQTPLHQYGQYLLASLPKYVQQFSVYKDELTIYIPPQAVLPVFTFLR
                     DHTQCQYRQIVDITAVDFPTKPNRFEVVYHLLSHAHQSRIRVKTYADEVTPVPSVVGL
                     FNGANWYEREVWDMYGIFFEGHPDLRRILTDYGFEGFPLRKDFPLTGYTEVRYDDEKK
                     RVVYEPLQLTQAFRNFNDAASPWEQVGGGDPAAKPQEYNIPPPPEPKKEEKK"
     gene            994342..999130
                     /locus_tag="CNF03370"
                     /db_xref="GeneID:3258271"
     mRNA            join(994342..994647,994690..995046,995116..995237,
                     995291..997822,997876..999130)
                     /locus_tag="CNF03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657430.1"
                     /db_xref="GeneID:3258271"
     CDS             join(994755..995046,995116..995237,995291..997822,
                     997876..998877)
                     /locus_tag="CNF03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513124.1"
                     /db_xref="GeneID:3258271"
                     /translation="MPISKPSASPNPPPSSTHSSPWAKPAVPTPSPAPSTLHQPAPTR
                     PGISASIPTSAAASLSGTSLGTGTAGRNVWRMGGLGSRSGMTTEFPTAKEAADGQKAA
                     AQAAALAAQVQAAHNQAIIQELDTFTRLEPHSHRWDEEDEEDDMIDFPDVPHTSPPPQ
                     PAQLPSADEQSVPKSDRFAEDFDRSWPRRSGDDGRSNDERVLFNASSNRLESRPEQTR
                     LDPGRSSDRDRAWGPRLLGRDTGDMGHAAAPASGLGARSLPPHLSAADPSSATEGPSA
                     GTAGTGTASGSWRSSAAARPAWGGSSRPTPSSGAGGGMGEQRQPWESRSDVRERVVGS
                     GTSVQPGRRSFNAGQPPHSTYTHPHPHGPSTAAPLPPASTTSTDPDPQSLEMHTAAEK
                     ARLRRLEEEKEREAAKERARMKAKALEEKLKAESESQNANKPEPSISASAAPAATAAQ
                     PPPKEKQVKWAEPAPQLTIAQRPPRDAPLIPRPTSSEMEKPSKAEREPSWRARAQQPL
                     PSSQETQVPAEGKEEEKITSPLYDSAGLGAASSSPETVQQPTASSSTAHMSATATATA
                     TATAQQSALSSSSFDGMLARVKAAMLEMQQTREKEVREKELEKEREKEAVKEVQAVKE
                     EVEEKQAFKASRAEQVKEEKTRPVTTTTNLAWKHASSSTGASSQTSQPPISKPAAAAV
                     SSAPAEYEPPQFFDITCPQPPRSPPPAWRTYNIRLPKPSSLPRPRCFDLPPISSSQQQ
                     QWEKGVEAPRGWARTFEPPLESEETAEDVLDRAKMLLPQSRVVTKVGQVVVSISPRVL
                     ERVKERTTGVDGEVREKRERRKVEDVGGSVEEEGVRTGVEKAELLGPSTKPVQTLPPV
                     PPATTSSTAQQQQQQQQPPPRRKSPVKSAAQAEKDPSTFILQGVGLAIAPPPHISLSS
                     LPTSSIPGSTPRDGKDGSFSVLSEDGKPGVRFMVSSELEGDSLLEEVNKMSLESVEEA
                     KGEKNDDKKEVPTTPPLAHQSPKSNGPSTPWSKTSLAYPSQPHDAIKSVWGADTSATT
                     SDTPMYPTLNAPASAESTQPLSAGLKSGFPSHGHSSSSAPQFSPNLGAANVPFTRHPS
                     QSHSISQSQIQSPYFGSPHTLSSPPGDPSMGMTMPLGGYSRQAVNAMGVAGVNGFQQG
                     VWGGFGVAPGYGYTAQPQHAAHQAQHQANQGQQKFQQYSNVPPYSRVNPNVAYSYAPT
                     PSPSYNHASPQVRPQGRFAQAATNGDYRHHPHQAQGTSSGLQPQPGGFRMSMDGSSQG
                     YYGGIGVYSPQVQHGHAVNQGGQGQLGQGQAQAQGQQGYGRGTMRGGMGRKMW"
     STS             994968..995210
                     /locus_tag="CNF03370"
                     /standard_name="CG2"
                     /db_xref="UniSTS:470851"
     STS             997356..997621
                     /locus_tag="CNF03370"
                     /standard_name="GTT5"
                     /db_xref="UniSTS:470850"
     STS             997382..997579
                     /locus_tag="CNF03370"
                     /standard_name="AAC12"
                     /db_xref="UniSTS:470849"
     gene            complement(999343..999439)
                     /locus_tag="CNF03380"
                     /db_xref="GeneID:3258495"
     tRNA            complement(999343..999439)
                     /locus_tag="CNF03380"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:3258495"
     gene            complement(999559..1003112)
                     /locus_tag="CNF03390"
                     /db_xref="GeneID:3258412"
     mRNA            complement(join(999559..999748,999799..1000132,
                     1000189..1000542,1000598..1000733,1000786..1000816,
                     1000872..1001045,1001098..1001160,1001217..1002011,
                     1002064..1002859,1002904..1003112))
                     /locus_tag="CNF03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657431.1"
                     /db_xref="GeneID:3258412"
     CDS             complement(join(999639..999748,999799..1000132,
                     1000189..1000542,1000598..1000733,1000786..1000816,
                     1000872..1001045,1001098..1001160,1001217..1002011,
                     1002064..1002859,1002904..1003041))
                     /locus_tag="CNF03390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513117.1"
                     /db_xref="GeneID:3258412"
                     /translation="MSRVANGAIPDRPNRPLVVRCSYEGSSRRVNFPSAATCRLESLR
                     NRVEECFSLSAAPYSLIYTDDDGEEFSIRNENDLTEAISYFISGDDDAATSNYSGSVS
                     GVLPYSLSTSKITLRLDVVVEYDGPSLSDTSSISSFQTGSGSEHDSTYRSSAYESSYR
                     GSISSMMQEAIEEEYTDEEDPERSTATQSIAGRMSRMSLDDARLTSSQYSDSTPRRIS
                     QRNYTPSNHSAIPTQPPIAQQSLTGPDSAIAPSLLTHSELGTRWLREQSNLAARKIGP
                     GTKSRKSTRYDSDDESMASDDERSGDFALVRDARGRYYYSYQTDISSATASDIDLTDN
                     EIASHRHSVRSSVLSNRSPPSPPHAHLHAPSPRTIEPAGPPILAPDCSACGVRLDYLR
                     YVCQTCGEGEMWMENAPGKAAFMPPKVPSDSSQSDASSEATEFAARGTSSSDSRTVYN
                     TASRSRSGSISTNASRGSVQALAGSSSSPTNATYHFDFGFTPPHSPISAFGGNTPSLA
                     RGDQSHRKTGYELCAGCIEIHGIRHTKAAARTAKNELRGTERRRREKAGEMRHTFKER
                     IWGPEGWDDVEYNEDSECTICLTALFSNRFKCVSCPKFDLCRSCYQKVDEIHPAHAFL
                     SLPDKPLLPIETSRNVLNENGQPNPEVAGPQLVRHPGAFCHNCLQDIVGPRFHCAVCP
                     SWDLCIQCEGIHMAGGDGSGHLSDHIMMKIPVPLPTSEVEAVSRRARDRWFQQDRTVA
                     TSGGDPLTSSLSQPYHSRSSSPIGDNSTLYAPTAIRARDTSPLPPSQIVNVSQRDALD
                     HGVRCGNCNEWIMGRRYQCANCPSDPVGFNLCSICELRSYRVHDPTHFFFKFDRPVHI
                     PIRSYRPVLPPLYRHPVGKVPASALATINPRDPTAYLKHVMHRDTLCDVHGDQIRGVW
                     LRCAHCAGGFDICLEAERIADHDATHVFVVFKARVDMAAFRQLADLAATHSKPLLRQS
                     VYVS"
     gene            1003277..1004862
                     /locus_tag="CNF03400"
                     /db_xref="GeneID:3258359"
     mRNA            join(1003277..1003402,1003453..1003532,1003588..1003764,
                     1003817..1004137,1004190..1004282,1004332..1004432,
                     1004478..1004546,1004633..1004862)
                     /locus_tag="CNF03400"
                     /product="COP9 complex subunit 6, putative"
                     /transcript_id="XM_024657432.1"
                     /db_xref="GeneID:3258359"
     CDS             join(1003335..1003402,1003453..1003532,1003588..1003764,
                     1003817..1004137,1004190..1004282,1004332..1004432,
                     1004478..1004546,1004633..1004758)
                     /locus_tag="CNF03400"
                     /codon_start=1
                     /product="COP9 complex subunit 6, putative"
                     /protein_id="XP_024513051.1"
                     /db_xref="GeneID:3258359"
                     /translation="MSGPSSSPHVMQSGATSGVNIKLHPLAILNISDVYTRAQCTSTG
                     SEVPKLIGALLGTESNREIAIVNSFELIYHPSVMSGEDVDMSDSGSSGGKYVLNTDFL
                     ETRKDQFKQVFPTLDVIGWYSVGKEPSSDDISLHAQFASSVETPIFLLFDPDPASGTQ
                     ALPLKIYESATVTDTTGEISGEGKFVELEYGIETGEAERIAVDGVAKGGAGEEDTAVA
                     HLTTQRNAIKMLYDRIEILLKYVTGVVNKSAKPDYSILRRISSLVATLPTMDAGEFRE
                     ELITEYSDVQISSYLTTLTKQLNVLSEYAEKHSLVYGQKEDEFMGGPSMGLRGGRQMN
                     FDMGGGRRRR"
     gene            complement(1005032..1007292)
                     /locus_tag="CNF03410"
                     /db_xref="GeneID:3258378"
     mRNA            complement(join(1005032..1005192,1005264..1005331,
                     1005396..1005703,1005756..1005963,1006016..1006759,
                     1006811..1007108,1007159..1007292))
                     /locus_tag="CNF03410"
                     /product="anthranilate synthase, putative"
                     /transcript_id="XM_024657433.1"
                     /db_xref="GeneID:3258378"
     CDS             complement(join(1005297..1005331,1005396..1005703,
                     1005756..1005963,1006016..1006759,1006811..1007108,
                     1007159..1007170))
                     /locus_tag="CNF03410"
                     /codon_start=1
                     /product="anthranilate synthase, putative"
                     /protein_id="XP_024513130.1"
                     /db_xref="GeneID:3258378"
                     /translation="MDPSVSKPTPSLEELTNLFATASSSTTTLTSRSATLFPTPNAEP
                     SKPVEPAKPNLIPIYVEIPADLLTPVSAYLKIAKDEKYSYLLESVVGGESLARYSFVG
                     SNPFKTIKTGAGEEVEGDPLEALEKELEPYRFAKIPEISAFTGGAVGFITYDAINHFE
                     PVTTPATPLHNPIPGMPEACFMLFSTNIIFDHIYQTVKIVSHVYLRDGTPASQIPSLY
                     DEASARIESARRKLMNPETPMPHQGPITLGNQSESNVGKAGYEGFVTKLKEHIVKGDI
                     IQAVPSQRLTRETALHPFNVYRHLRRLNPSPYMFYLDCGDVRLVGASPETLCKVEGRK
                     VYNHAIAGTVKRGKTAEEDAVLGAGLLASDKDRAEHIMLVDLARNDVNRICKPETVNV
                     DNLMQVEKFSHVIHLTSQISGMLRDDQSRFDAFRSIFPAGTVSGAPKIKAVQLISGLE
                     KERRGVYAGAVGRFDFDRDNLDTCIAIRTMTFKDGKVFLQAGGGIVFDSVEEDEFVET
                     INKLGANVKCIEEAEKYYARLQGQNV"
     gene            1007527..1010241
                     /locus_tag="CNF03420"
                     /db_xref="GeneID:3258396"
     mRNA            join(1007527..1007697,1007836..1009575,1009625..1009717,
                     1009766..1009837,1009913..1010241)
                     /locus_tag="CNF03420"
                     /product="enzyme activator, putative"
                     /transcript_id="XM_571612.2"
                     /db_xref="GeneID:3258396"
     CDS             join(1007559..1007697,1007836..1009575,1009625..1009717,
                     1009766..1009837,1009913..1010031)
                     /locus_tag="CNF03420"
                     /codon_start=1
                     /product="enzyme activator, putative"
                     /protein_id="XP_571612.2"
                     /db_xref="GeneID:3258396"
                     /translation="MSANPLPQRRSATYDSYLPTNSSSQNQMYAGDESETAGRSRSSR
                     NDAVPEPEIDPNDPPLPSYQALMASENAGIPLSPTTISESDHSNRSQLPPVLHTRTPS
                     LEHAPYAPVDYGLPNSAYPASHHGHSNEPPPSQSNCFSGSSLGRRPVSDPNSIDFNQL
                     QITPNIPAVPGAPANPVARHKTAPSHPQQYHPRNQYPRQRSVTGGYPTDMDGTASVYS
                     LDSGMGAYGQGARQGQQYPTGQAYGGYAAPVQTDYSNPYYSAANDVLGLPPVPPPPSE
                     SSYATSSFTPVPTRQRSVPSLARSNTAATNMSTASSRSMPPVPVMPRVTEQVGASSTR
                     RRGTQAAVDLNKPPYTKQYVDDYRKRMKDDPDPEAQFAFAKYLIEAAKKLGDEISHSD
                     PKLGRKYRDSLLQESLRNIKKLAEGKEPYPDAQFFLANLYGTGQLGLSVDHERAYYLY
                     MMASKHNHPAATYRSAVCNEIGAGTRKDPGRAVLFYRKAAALGDTAAMYKLGMILLGG
                     LLAQPRNIREAIVWLRRAASQADEDNPHALHELALLHERPNGVGGVLPHDPNMARELF
                     TQAAQLNYPPAQFKLGQCHEFGHLGCPIDPRRSIAWYTRAAEKGDSEAELALSGWYLT
                     GSEGVLKQSDTEAYLWGRKAANKGLAKAEYAVGYYTEIGIGVKQDMDLAKRWYMRAAA
                     QQHKRAMQRLTELNNQKNPKGKGSRPTRHDAQSECVVM"
     gene            complement(1010583..1012514)
                     /locus_tag="CNF03425"
                     /db_xref="GeneID:36392914"
     mRNA            complement(join(1010583..1010907,1010962..1011003,
                     1011077..1011212,1011280..1011431,1011486..1011693,
                     1011755..1011784,1011849..1011962,1012013..1012099,
                     1012151..1012514))
                     /locus_tag="CNF03425"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658585.1"
                     /db_xref="GeneID:36392914"
     CDS             complement(join(1010838..1010907,1010962..1011003,
                     1011077..1011212,1011280..1011431,1011486..1011693,
                     1011755..1011784,1011849..1011962,1012013..1012058))
                     /locus_tag="CNF03425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514511.1"
                     /db_xref="GeneID:36392914"
                     /translation="MLSLIKITCLTAFLVSEQLWAKPLMLPTHISTTAYGPALYDPST
                     GPTCADIKQTTAPDCWLASVMCALAKCNGGFITSLIVAKTQVHPATSLSVTGATFKIW
                     DPDTLVETDQAVVLADTVTGDGNDDSSIYVWWPSALQAAVKKHGGSGITDGKFDINGG
                     FGFKALSYLTGLEASCEMNSSTWWGNLVAHVDSTPIVMCTNSDTDVLVNSHCYTAMTI
                     IDNGDSDDTRTVQLHNPWGNTKNYKFSDIKDDVNYLAHLTQWNAYTG"
     STS             1012979..1013780
                     /standard_name="Pst11"
                     /db_xref="UniSTS:470847"
     gene            1013074..1014262
                     /locus_tag="CNF03430"
                     /db_xref="GeneID:3258075"
     mRNA            join(1013074..1013280,1013350..1013390,1013447..1013752,
                     1013805..1013907,1013965..1014054,1014100..1014262)
                     /locus_tag="CNF03430"
                     /product="expressed protein"
                     /transcript_id="XM_024657434.1"
                     /db_xref="GeneID:3258075"
     CDS             join(1013176..1013280,1013350..1013390,1013447..1013752,
                     1013805..1013907,1013965..1014054,1014100..1014183)
                     /locus_tag="CNF03430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513115.1"
                     /db_xref="GeneID:3258075"
                     /translation="MSTISFASEDQFEAASSWLISTPPAAGLPNEIKLELYGLFKFIT
                     TGAGPTSSRPSLFYPTNRAKHDAWDSVSRKYLHLNSVPNQTKAMAQGRYVEIAKQIGW
                     DGVIQEENEIDLERLSDSGSEDGKDGNEGAKDGWRKVSVMQGEDGLDNEGTSPIHDAV
                     VADSLQAAKELAESDSSLINSRDEFGYTPLHLAADRGYPEMTKLLLELGADKSLKDQD
                     DQTPSMLAQISGRDDIIAILDSTP"
     gene            complement(1014220..1019477)
                     /locus_tag="CNF03440"
                     /db_xref="GeneID:3258036"
     mRNA            complement(join(1014220..1016857,1016905..1017105,
                     1017158..1017951,1017990..1018502,1018542..1019477))
                     /locus_tag="CNF03440"
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /transcript_id="XM_024657435.1"
                     /db_xref="GeneID:3258036"
     CDS             complement(join(1014290..1016857,1016905..1017105,
                     1017158..1017951,1017990..1018502,1018542..1019433))
                     /locus_tag="CNF03440"
                     /codon_start=1
                     /product="late endosome to vacuole transport-related
                     protein, putative"
                     /protein_id="XP_024513053.1"
                     /db_xref="GeneID:3258036"
                     /translation="MAQPSIPDHLHDGEELDEDLADITSQTRLSLSSASSGNRTARQS
                     RSSSSATIRNLSAGGLFGRIRRRGKEDDYSDEDEEAIAGEELADTASPIPARGWRTHL
                     TDDQDNEVEAGPSDYHERETATPSTPTSSSLPPSGWRQPSTQPFDPDALEEGPSDYWG
                     AGTPPVVPAYLHESTPSTTIDSPVINEYDDDEYERRIRDVMAHNAQSTPGTNSPNLSV
                     SESFPYHPSQIHGNRLHGRAHLDEKADSGIGEEEFGRRKVLIDDVSEATPSVASATPS
                     KLQERYAPGSALSPSKRTSFIHPSVSRLRSHMRSSSSATQQSVQHPQLLQLRAPSHFS
                     QIDVAKSETMSTTSAPLQPSNLPVQPPNIPRNKAELNQGPAFQFHPLRKLSAHLFARQ
                     TNGTSSPRPDINKRAGSVLKLPLGSPTTKEIPEAQNLGKPTVMDIRGMIAVGTDRGYI
                     VVYGFGQEIKYILGPEEPTSAITAVAISSDETYIAVGFSSGSIYLYDLSSPSSPARTA
                     HFLTLKQIQSGRREGHLEGSRILHIGFVGARHTSIVSGDEHGRAFWWSLGKVMGVEST
                     DVIRMLGSYPSGLIPTTAPPYPAKRPTTLFSASPLPLGDSPHPTDKFSLSALLTPSKL
                     VIVGMKPQAKTWFRKMRDGAGGDQGAYTGCTSWLRSGEVGKGFEKEVAKKKKVLEEVS
                     DPVIAYSWGKAVRFVRVRVQEIGDDVSPDFVEGRKWEAGESVKFLDWYDSNHLLVITV
                     SQLTLLDVRSMKAVEETPLQTQLLTSQDFYSGLSVKGIMENVPKSFAGSVRTHRGKLF
                     LLTKSNLQVGTLLHWNDRILSQVHRGDFLSAINVALSYYNGTATGNTINLPFEASFRK
                     EVVGKRIKELMKASLEWAFSPDRMSDDTHYSADGRGVDLTDLFEGLAASCIEACLDIG
                     DTDFLFNDSYEHFSQMGIQGIFLHILEPFIFSGRLREVPPDIIKALITMHSEKGELDQ
                     AESMIWHVEPMSLDINQAITLCEAHGLWDAMIHVYTRAMRDYVAPIVKLIGVVRDIQQ
                     HRSNRPSLVRDERDGTEEMAPNAYKLYSYIETVLSGLSYPSGEALPEIEAHQAQTEVY
                     TFIFQGRTVAWPQGGHDLVLTMDSKHSEPPYPYLSLLLHFDTEAFLHAMDIAFEDSYL
                     NDPTGAINRQSIVNLMLDVMDPEYFHPGDITLLHIFVARNLPKYPQFLFIPPSTLHRI
                     LVSLASDPDQSTREDRQLAAEYLLSAYTPHDGEAMLSLFETAGFFRILSEAYRREGKW
                     GKLISTLLRDPESDDEVFTALEEIIKTATPSAEVNQAVVDALPHLFDLGVRETAILLD
                     KELSNIHPQAIQALGHAPHKQMAYLRCLLEPDPEETHNAPSSNIDLPSRHLYITLLAQ
                     HDPGHIVSFLDERGPSSFDLPRLVDQLDEAGLYEAELWALDRQGKVKETFVKVGDVLR
                     TKGGELGEALVNDDVGSVHLALETIQGVAKMAVRLCREHSSPKVEGRNESGRGAMEVE
                     DMWLGVLHEIIELVHTSSALTSISSDTVVLDTLRSLVQETLSSLVSSSSPSLSFPRLF
                     KRLVDASTTTTKQSSKGRAYSEFRTILMGMLDSYRAEGEMLNMTTKLVEADLGEVTAE
                     FVEKSMRGWRAEGGQCGECGKNLKKDQSWVVLGSGSVLHKSCFQV"
     STS             1018020..1018857
                     /standard_name="Bgl3"
                     /db_xref="UniSTS:470848"
     gene            1019657..1024610
                     /locus_tag="CNF03450"
                     /db_xref="GeneID:3258362"
     mRNA            join(1019657..1019925,1019983..1020248,1020298..1020489,
                     1020540..1020656,1020710..1020809,1020860..1021014,
                     1021064..1022042,1022078..1023519,1023571..1023729,
                     1023780..1023992,1024040..1024153,1024206..1024378,
                     1024428..1024610)
                     /locus_tag="CNF03450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571415.2"
                     /db_xref="GeneID:3258362"
     CDS             join(1019733..1019925,1019983..1020248,1020298..1020489,
                     1020540..1020656,1020710..1020809,1020860..1021014,
                     1021064..1022042,1022078..1023519,1023571..1023729,
                     1023780..1023992,1024040..1024153,1024206..1024378,
                     1024428..1024467)
                     /locus_tag="CNF03450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571415.1"
                     /db_xref="GeneID:3258362"
                     /translation="MGPLLSPTKPRPLSRHRSAEPFPPAPPPKAIDLNSSTRSTDKDT
                     GRKITRRAFLCDVIIEREGEETANLLAHLGEPLKPLSTLPPPAQTTNGRPTTPSRLSQ
                     PPDSDDDARGNTGPVWTAVKSDEMKKKLANVIEELVRTERSYLSRVHALKTAYADRLR
                     LYSKDPNQQLIPPYEAKAMFANIELIVPASMTFLGDLEEMMQSGHAEDLVGDVCLKHF
                     KILRTFDPYRTYLSKQDESQKLFQDSLKKFIGFGTFIESTKYQTTGIGNIGLRELLME
                     PVQRIPRYTLLWQTMIKCMSPLSTQRAKLLEAIEIASGIARCEPDAQTVRATVMYNLE
                     RNIDNFPAKLFSNNRDFIDAIDVEDIPAEYPTAQCPNGRPTSINSRIAVSTASTPSLP
                     AFGSLPSTGSHIPQSPQSATSAMPTLHCTLFLFDDKLMIVKRQSSSISGRKITGTDDV
                     QKLVKSGGGIAVKEKNNAKRDKLSYRGEVDILDVMASDVGNGDFHLFFERPPADQCGR
                     WGNRSFRSYSTVHPPYSVSLDPVATRKDKLRFIQNLWAAQALARAKVLPSSESKAVPR
                     VLQSETEVDFEGGDLERATCFWDVWNRNEWCGQRKGKVVIHVDEDGMAPALPIDTRST
                     KLSVYLQPMAGGLCRYAHSVAGKEEAERIVVDMSEVKEKIASTINHYGIFKFRTGTIS
                     CPTTPSSGTHRIRPSMLNLDTISRNLFGAGSVSGRSGTSNDMFSTAGSKRGSKYAMSR
                     SSSMETSLYSTDGHEEKEASKKKFSKISLSPDPHSLIAGAPYAAETDNIRQSEIDLNQ
                     RLDAAKKNGQSTTLSSGTAPKLNKLGNRSVTELRRSNEGIAERHISCRTTGTNSPIPP
                     SSPSKSSSPLRIRNATPPKHPASPDTDTTPQARLPPPIITSPVTAPLNIRKTPSRAQT
                     ISSEHVVTSPSRATSPAPSVAIAPTYYLPSDPSLTSKPSLSHKPSTSRPGGPRGPVPR
                     SPLPTIKTQLPSTAITSSSTAGSRHTGLRIVSGNGRRISLNRETVPLKGEEENDPFAT
                     NTPSIPSTAKRQHSVESLSPRKRSPSLGKSPLGEVGNNPPLVIKPHRRTSAKAGTPRR
                     TSGPLMSARTVSASRSSINSVASADTINTVNTAGTCGGGEDVEMKEYEDVVGAMDATL
                     NKIRDARGSAKRLKSEVSGLRKQIIRESGKAKQSLAVKIDRAGSLPRSPQKRHISRMV
                     EQDVYDLTPSLSRQSSQSKKDIEIDVMDECARGIVQITQRMDLHLRQAEMDAEQAVVL
                     GRCAIAENDEKSQEISMLKGQLERSREHHELLQRQLGDAQIELDVVYEAFNTELDGMF
                     NDAQLPEDEAFQALRNDLQVTKANRNVLQLENQKLKRELEEANLKRDQWARILRTQGH
                     IV"
     gene            complement(1024630..1026319)
                     /locus_tag="CNF03460"
                     /db_xref="GeneID:3258272"
     mRNA            complement(join(1024630..1024857,1024907..1025559,
                     1025611..1026319))
                     /locus_tag="CNF03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_571417.2"
                     /db_xref="GeneID:3258272"
     CDS             complement(join(1024732..1024857,1024907..1025559,
                     1025611..1026259))
                     /locus_tag="CNF03460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571417.1"
                     /db_xref="GeneID:3258272"
                     /translation="MPPKGKKTKAEEALDFLSNLDNLDAPDTSSPPPTGEATRDSTDS
                     TRKSLSASRELPSKAAAKPTTEDEEAESALAFLNAQINQKRAKPLSDSRAGTPLSAAG
                     SSAATASASTSAPKPKAPATEPINMPTETPSPAQSSGGWGSFWSTATSALQSAQRVAD
                     EQYQKVKSEGVNGVTGQLENLRVNVKSVPGVDLSKLRKGAEERLGGFVRGVDLDKLRK
                     DLVNTTSSTLTTILDTVAPPISEHETLELWLSHPMIGYAGVEGVIYRAWARILEQTES
                     GELIIIWSPSPTPDDVSGEPRSINPVEGWDAAWELGKKEVAAIKAREEEKPRGRAEAK
                     RNVHVTTVPIFLHLQPLLVRLPYAEPPIHSSTSTQDKPFTPPNHLYFLFTLEDPSHSL
                     KFTTVSQPTPSDWMDVEYENSEWVEERLVEVLRTGVEVIAQDYVATRMGLKPSAPQAA
                     AVAALVEQANQEEEDKAAADEKKSD"
     gene            complement(1026821..1028798)
                     /locus_tag="CNF03470"
                     /db_xref="GeneID:3258094"
     mRNA            complement(join(1026821..1026981,1027045..1027163,
                     1027220..1027300,1027353..1027361,1027423..1027585,
                     1027640..1027716,1027768..1027997,1028066..1028146,
                     1028205..1028311,1028365..1028425,1028498..1028579,
                     1028639..1028669,1028727..1028798))
                     /locus_tag="CNF03470"
                     /product="formate dehydrogenase, putative"
                     /transcript_id="XM_571419.1"
                     /db_xref="GeneID:3258094"
     CDS             complement(join(1026910..1026981,1027045..1027163,
                     1027220..1027300,1027353..1027361,1027423..1027585,
                     1027640..1027716,1027768..1027997,1028066..1028146,
                     1028205..1028311,1028365..1028425,1028498..1028579,
                     1028639..1028669,1028727..1028735))
                     /locus_tag="CNF03470"
                     /codon_start=1
                     /product="formate dehydrogenase, putative"
                     /protein_id="XP_571419.1"
                     /db_xref="GeneID:3258094"
                     /translation="MVKVLAVLYSGGKAAEDESRLLGTVENRLGFADWLKKEGHEFIV
                     TADKEGPDSEFQKHLPDTEILITTPFHPGYLTAELMEKASKLKLCVTAGVGSDHIDLE
                     AANKRKITVAEVSGSNVVSVAEHVIMSILLLVRNFVPAHEQIQADDWNVAKIARNAFD
                     LEGKVVGTVGCGRIGYRVLQRLQPFDCKELLWFDYAGLPAEAAKAIKARRVEKLEDMV
                     AQCDIVTINCPLHEKTRGLFNEELISKMKPGSWLVNTARGAICDRNAVKKALESGHLL
                     GYAGDVWDVQPAPKDHPWRHMANPLGGGNGMVPHYSGTTLDAQTRYAEGTKEIIRRYF
                     AGEEQNPVNLIVTNGDYASKSYGNRDEKKKEQSQVNAAK"
     gene            complement(1029891..1033705)
                     /locus_tag="CNF03480"
                     /db_xref="GeneID:3258054"
     mRNA            complement(join(1029891..1030301,1030357..1030695,
                     1030744..1030833,1030882..1030940,1030988..1031055,
                     1031108..1031490,1031545..1032711,1032763..1032947,
                     1032998..1033705))
                     /locus_tag="CNF03480"
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_024657436.1"
                     /db_xref="GeneID:3258054"
     CDS             complement(join(1030092..1030301,1030357..1030695,
                     1030744..1030833,1030882..1030940,1030988..1031055,
                     1031108..1031490,1031545..1032711,1032763..1032947,
                     1032998..1033445))
                     /locus_tag="CNF03480"
                     /codon_start=1
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_024513054.1"
                     /db_xref="GeneID:3258054"
                     /translation="MDRLQRTRSQHFVSSPRKTASPLIARHTLYPRHPPKKRRLGVTT
                     FVASHNEAGQNYSNELEDDLEKAIMKTGESSSAPARRTSRSRSQSRPVRRKSNDKVWA
                     DSLPNGQDGEDAASPKKRKRSRAGSLSTEDSWVETSGDEWEPDFIAESDRNMIHYAPS
                     TALHRLRKAELVRLWRVAGMWDSEDIPDDMNEDETIGDMGKKELVDGLISARKHQTGR
                     LISPLPSSPNRLIRRQSTLSPIPATPPPSSPLAESSSPDVTPKPRPRTRSRVRLETPV
                     VRRQPRPSRPTRTLTKRHTKSEARSRRVRAQLTKKVNGKSENGDEIELTESSDSDDDV
                     NGIESTPIVKRLRPRGVGERKSFMKEPSTDITDFEDDAEEADAEATEVEEEPQPKERK
                     LRRKSISQASLSKYGGDIDMAPTSEQRSSKNLPTRGAKKKAIQRMQGGESGTEDEDME
                     VDEERDIGMKEGTPTPQPAIPPRRGRASRSSTPKLDEDSAMVGSPTPSVATETEASTP
                     RPVHTTRSGKTFGAIQNRRRQLLQEARNDPDMDEEDESDEEDGEPELDIDLSEATVAS
                     LIRLLRDELVQMCETRGIEVGGTKPQLAKALLEWRDEQKGSYPSSASTARPSPPRTAM
                     PRRKSKSKSKTKSKFKSNKHVPAIGTAAHAPGKPTPVLLRSHIHANDPETPPLSKGEE
                     GDVEEEKKGTEAELNLDLQELGLEDSVIKPSQLIKLEKIGSGGFKDVYVGKFRGRKVA
                     ISEFRSHLSEMDIRELKLLAEFSHPNIVRFRGICIPEDSTHVPCMLVSELCENGDLFD
                     YIRNVPCPTLKRLLSLMLDIARGLEYLHTRKPSIIHRDCKSSNILINRSGVAKVGDFG
                     LARVKNSTRSMIRSLVGTVNWQAPELWHPTPRYDYKVDVFSAGMVYWEMMSGWIGEKK
                     YPWEGHNEHYIYDAVGTKHRRPPVTGMRKHWGSEPVNLMERMWHQDPAERPTMTDVVH
                     DLESILAELK"
     gene            1033886..1035406
                     /locus_tag="CNF03490"
                     /db_xref="GeneID:3258404"
     mRNA            join(1033886..1034049,1034100..1034162,1034216..1034751,
                     1034805..1035027,1035079..1035177,1035230..1035406)
                     /locus_tag="CNF03490"
                     /product="splicing factor u2af-associated protein 2,
                     putative"
                     /transcript_id="XM_571423.2"
                     /db_xref="GeneID:3258404"
     CDS             join(1033915..1034049,1034100..1034162,1034216..1034751,
                     1034805..1035027,1035079..1035177,1035230..1035382)
                     /locus_tag="CNF03490"
                     /codon_start=1
                     /product="splicing factor u2af-associated protein 2,
                     putative"
                     /protein_id="XP_571423.2"
                     /db_xref="GeneID:3258404"
                     /translation="MPNAPIPGQFEQDTRVSFDKVSGKWQYEDDEGTEHEWNGTAWIP
                     IIDDELVRAQQAAYSVPGVDESTPSNAAIAREERRNKKRKKGEKDYTSNTSNAPAAAT
                     EASKPAPAPSAPKKTGVWVTNLPPNTTIQKLADVFSKAGVLHIDDEGNPRIKMYYDDE
                     GNFKGEAWVVYFKEGSVDLAITLLDDTELELGAGYPPMRVKVAEYFKDQEKGKDKEKK
                     EKTEGEKKKLTAEEKQKMSKRMKTLQSKITWRSDDESDDPAAPLGGAPAPTNNRFARV
                     VVLKGMFVPEELEKDPALLLELKEEVREEAETLGQVTSVILYDKEEDGVMTIKFKEPV
                     SAQACVAKMNNRYFDGRVIYAGLYNGKERFKKSGGRTFDEDNDQEEKERLDNFAHWLV
                     EGEDEEAAKK"
     gene            complement(1035385..1036209)
                     /locus_tag="CNF03500"
                     /db_xref="GeneID:3258349"
     mRNA            complement(join(1035385..1035560,1035617..1035670,
                     1035723..1035768,1035824..1035828,1035889..1035983,
                     1036054..1036209))
                     /locus_tag="CNF03500"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_024657437.1"
                     /db_xref="GeneID:3258349"
     CDS             complement(join(1035450..1035560,1035617..1035670,
                     1035723..1035768,1035824..1035828,1035889..1035983,
                     1036054..1036084))
                     /locus_tag="CNF03500"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_024513056.1"
                     /db_xref="GeneID:3258349"
                     /translation="MSDQLYAVADFCLIPMGLSVPSVGPQIAECQKVLEKSGLEYKLH
                     GYGTNIEGPWDEVMKAIGDCHKAVHAMGTPRIATDIRIGTRTDKSITSGGNDGKVKRV
                     EEILAKESSKA"
     gene            1038573..1039831
                     /locus_tag="CNF03510"
                     /db_xref="GeneID:3258413"
     mRNA            join(1038573..1038746,1038807..1039183,1039239..1039336,
                     1039389..1039502,1039555..1039831)
                     /locus_tag="CNF03510"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_024657438.1"
                     /db_xref="GeneID:3258413"
     CDS             join(1038741..1038746,1038807..1039183,1039239..1039336,
                     1039389..1039502,1039555..1039676)
                     /locus_tag="CNF03510"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_024513058.1"
                     /db_xref="GeneID:3258413"
                     /translation="MKAPISSSTQDDMKVYYNETLKGGFRGALLAAAITGTSYFVLTK
                     RSPTFRSLPLPAKAFGGVVISIPCMFISAERAGLAYERAQWSGVGQKEIERNIERQSE
                     RWGKMTQMEKAKNWVGNHKYSLISAAWVGSLGLAFGIVARNPYQTTAQKVVQARMWAQ
                     GLTVGLLVGGALLAGANSNPPDEFSQKKEGDHSWRDILELDEHLTQEERAQLHGNADP
                     KKLKEIHEAALKRKAAVGKV"
     gene            1039901..1042064
                     /locus_tag="CNF03520"
                     /db_xref="GeneID:3258445"
     mRNA            join(1039901..1040561,1040611..1041282,1041342..1041494,
                     1041542..1041917,1041974..1042064)
                     /locus_tag="CNF03520"
                     /product="expressed protein"
                     /transcript_id="XM_024657439.1"
                     /db_xref="GeneID:3258445"
     CDS             join(1040198..1040561,1040611..1041282,1041342..1041494,
                     1041542..1041837)
                     /locus_tag="CNF03520"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513059.1"
                     /db_xref="GeneID:3258445"
                     /translation="MSREIGAEVVSIGSPLSSSPLPSALSSPTILPSTLLITSTTEIQ
                     EDKGNDEREKVAVELLKGEVLKKNSIGETEGGDLLDKGQAKADQSSFVNEEAYDQDVV
                     DGLSSDPIAGPSPTPSKASVIPTRRVSLEKRTEIFAKDEGGIQGAKNNAISSIQARQK
                     EVTNEGGNSAEQINGAKIVEEGGLPGKALDAQEDLEGPGETSSSTDVVQKDPESDQKG
                     ANDGNAGEDQRTELGNSMEKAAEELEQPLQNSTESRPSAEVAQTGNEEHGQSHGREAI
                     EVIGPESTEASIDKTTVEPEQPQEAREILSTTEVASDVQNENGQGHPGESVKEGAEPE
                     QPDEPAETVTALITDAKANPEENEVSQLLAEPPLNAEDDVETVEKPQHIIEAGLSEAH
                     LSPPFANELESEVRPTSSLEEATCPPIIPKIRKGHLASLLVLNPAYTLPSHANAKPRR
                     FFCPHKRKVMIGDESLERISIPGVKKRKTEHVEMMYQVLLVDKP"
     gene            complement(1041967..1046603)
                     /locus_tag="CNF03530"
                     /db_xref="GeneID:3258076"
     mRNA            complement(join(1041967..1042326,1042380..1042600,
                     1042656..1043040,1043095..1043178,1043239..1043404,
                     1043456..1043481,1043539..1043687,1043738..1043777,
                     1043827..1043860,1043917..1044012,1044061..1044271,
                     1044334..1044400,1044457..1044506,1044563..1044782,
                     1044904..1045038,1045094..1045307,1045357..1045377,
                     1045430..1045479,1045535..1045761,1045824..1045970,
                     1046491..1046603))
                     /locus_tag="CNF03530"
                     /product="glycogen phosphorylase, putative"
                     /transcript_id="XM_571431.1"
                     /db_xref="GeneID:3258076"
     CDS             complement(join(1042123..1042326,1042380..1042600,
                     1042656..1043040,1043095..1043178,1043239..1043404,
                     1043456..1043481,1043539..1043687,1043738..1043777,
                     1043827..1043860,1043917..1044012,1044061..1044271,
                     1044334..1044400,1044457..1044506,1044563..1044782,
                     1044904..1045038,1045094..1045307,1045357..1045377,
                     1045430..1045479,1045535..1045761,1045824..1045970,
                     1046491..1046530))
                     /locus_tag="CNF03530"
                     /codon_start=1
                     /product="glycogen phosphorylase, putative"
                     /protein_id="XP_571431.1"
                     /db_xref="GeneID:3258076"
                     /translation="MAELTKENLDKVTASPGSSSHGSRTPSLHQPEMSRRSSLSAGHP
                     HSFKHVDTTQIGVPIVTPRKERPGHQRSLTGSYFPSQKGGIVDMPGEWPIGDEKTWRE
                     AKKAMEIDQDNPQDVANTIVRHVNTSLGRQVYNVDEVAAYQATALSVRDQLLDRWNQT
                     AAYHTAKAPKRIYYLSIEWLVGRSLDNAVLNLGMRNVYEEANRKLGFNFEDLLNEERD
                     AGLGNGGLGRLAACYIDSMATLNLPGWGYGLRYNYGIFKQLISNSGEQLEAPDPWLDR
                     ENPWEIARLDVTYPIRFYGRVDPIPNTDRAVWSGGMECLAVAYDTPIPGYGTKNCANI
                     RLWSAKPVQGFDLNSFNAGNYEASVAASSEVENITRVLYPNDNMYAGKKLRVMQQYLW
                     VSASLQDMLRRFTKLDLPWTELPDYVCIQMNDTHPTLAIPELLRILIDEEKLDYNTAW
                     KITQKVFAYTNHTVLPEALERWQLDLFEELLPRHLQIIYRINFDFLGLVAKRWPGDMD
                     RIRRMSIIEEGSPKYVRMAYLAIVTSFKINGVAELHSQLLQATIFRDFVEFKGRDAFT
                     NVTNGITPRRWLLQCNPELAALITHTLGSDDWATNLKLLKNLLPMADNADFRKAFTNI
                     KMDNKNRLASLIEAELGITLNIDSVFMTQIKRLHEYKRQTLNLFGVIYRYLRIKQASP
                     EERKKITKHTAIFAGKAAPGYYVAKLVIRLINNVARVVNDDPDVGDILKVVFIPDYSV
                     SIAEVLVPASDVSVQISTAGTEASGTSNMKLALNGALLLGTVDGANVEIAEDAGEDQS
                     FLFGHLAEQVDEVRYANTYQPTPLEQRSPELAQTFKAIEAGTFGDGAIYAPLLKTVYE
                     HDYYLVSNDFGSYLSAEKLMDECYDSDKTEWTRKSIITAFNMGDFSSDRSVQDYADGI
                     WSVEPCEVPEDFSI"
     gene            complement(1047044..1049028)
                     /locus_tag="CNF03540"
                     /db_xref="GeneID:3258226"
     mRNA            complement(join(1047044..1047715,1047762..1047969,
                     1048024..1048343,1048392..1048486,1048541..1048755,
                     1048798..1049028))
                     /locus_tag="CNF03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_571666.2"
                     /db_xref="GeneID:3258226"
     CDS             complement(join(1047053..1047715,1047762..1047969,
                     1048024..1048343,1048392..1048486,1048541..1048755,
                     1048798..1048976))
                     /locus_tag="CNF03540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571666.1"
                     /db_xref="GeneID:3258226"
                     /translation="MPPIPTETQEKGQKPIHNPWLEVRSLWTNQAIQDGDLKALRRIS
                     SLPGGFGGEEERKRAWAFLLGTSKLDSASSEAGPSKLPVTTQPILAKATEEKPEIGED
                     SKNSREPQPHKDETQVKLDTDRSFVTYPKEITSENKLAMQEDLYDLIVNVLRKYPTLS
                     YFQGYHDILSVFYLTFVPAKQDIRRPSFRLRRQTRSRSRSGRGTPTNVLEEKVTIEEE
                     KLEFESKPDEEPGQKRDTQSWRELRKCAESVSLNRVRDAMGSGMEGMMALLRILKRLL
                     AHADPELSHFSSLISPVPTLPFFALSWVLTLFSHDCDSLEPIQRMFDYLLARNPIAAV
                     YLSASILISKKPRMFALAKKLGREYQEDPSLLHPLFVLIPPLYPDTPSSPNPQTSPSI
                     SPSELELHNPDINPYSPIRLSDIFQLADRLLEEYPWDGPLIRGREIMGPGSVMVTYDQ
                     EWSEEEWTAEKALQYVDVEVVQPGAAVMDEDELVPSPTPRRVTNPALWEVLKKVKPGT
                     LVALGVVFLGVGMAVYGVKLEGRGVVTWRRVIVGVWRGARKAYQESNLYPV"
     gene            1049160..1051523
                     /locus_tag="CNF03550"
                     /db_xref="GeneID:3258364"
     mRNA            join(1049160..1049417,1049505..1049632,1049743..1050153,
                     1050203..1050277,1050328..1050370,1050422..1050948,
                     1051004..1051523)
                     /locus_tag="CNF03550"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_571433.2"
                     /db_xref="GeneID:3258364"
     CDS             join(1049198..1049417,1049505..1049632,1049743..1050153,
                     1050203..1050277,1050328..1050370,1050422..1050948,
                     1051004..1051438)
                     /locus_tag="CNF03550"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_571433.1"
                     /db_xref="GeneID:3258364"
                     /translation="MFNAPRPMASSYSYTDPLSNSAAAGAAFGELDPWSSAPSPAGSV
                     TPARATASASEGRNIAANGNKEEGLNGLINDPPALYVSLLDQLDTSGTGEVSLAAVHR
                     LLGTSKLPAVVVEKIIHLTSRDKSTLTRPEFFCALALVSLAQSSPDPNDISIEKLSFS
                     LSNLPLPKLKPSDPPSVSSGVAASTAAATGFNAWDGTINKGTTYSANNSTFRSTDPMV
                     DNAEDRWWKDQERIVVTLIPEKEGWFLQKYRIESDKRGEGPVARRYSDFVWLMDVLEK
                     RYPFRILPPLPPKRINPSSAFLEARRLALIRLLSFLTAHPVLRTDACLNIFLTSSSFE
                     SWRKRTPVSTDEESLSKKLTTAQEMSIPSDLELKLDNLRERLPAMLGHYTRLVVMAER
                     SLVRLQVQAAEAARMAMSTQSIGELVPRCCWRSVQGDDGESGRGVARECGLCEGVGRG
                     WGDVGDGWVSVGEELEKGVQLLQKHIESLKSQRDLYSSFHALFYRHNKLSLDNVDVLR
                     KRVDSRFSKIESLKSAKKPGWEGEVDKLASQSDRDTAEIQRLLARRVFVRACMWHELS
                     VVFHSMQAAQGTMGWKDFVKDQKERTKRLNGVWQGLEETLESMPLE"
     gene            complement(1051604..1052535)
                     /locus_tag="CNF03560"
                     /db_xref="GeneID:3258304"
     mRNA            complement(join(1051604..1051724,1051793..1051945,
                     1052068..1052152,1052386..1052535))
                     /locus_tag="CNF03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_571664.2"
                     /db_xref="GeneID:3258304"
     CDS             complement(join(1051686..1051724,1051793..1051945,
                     1052068..1052152,1052386..1052489))
                     /locus_tag="CNF03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571664.2"
                     /db_xref="GeneID:3258304"
                     /translation="MAADNMTQQTAAAPVEQQQETSGFFSSFVSYFVPTAHADDSEEE
                     EKEEPAEEEEEEEEEDPEDIAPAIREECEKNACAEHVHHFAHCQEKVEAGEGFPGEDC
                     VEEFFHILHCVDACAAPKIFKKLA"
     gene            complement(1054043..1054135)
                     /locus_tag="CNF03570"
                     /db_xref="GeneID:3258316"
     tRNA            complement(1054043..1054135)
                     /locus_tag="CNF03570"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3258316"
     gene            complement(1054479..1055934)
                     /locus_tag="CNF03580"
                     /db_xref="GeneID:3258203"
     mRNA            complement(join(1054479..1054849,1054904..1055216,
                     1055274..1055336,1055424..1055934))
                     /locus_tag="CNF03580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571662.2"
                     /db_xref="GeneID:3258203"
     CDS             complement(join(1054749..1054849,1054904..1055216,
                     1055274..1055336,1055424..1055813))
                     /locus_tag="CNF03580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571662.1"
                     /db_xref="GeneID:3258203"
                     /translation="MAATTILVVGATGKQGGQVMAALLNSGRSQLSLRFLTRNDSSPS
                     ATELISKGATAVVGNLSDRQSLLTALKGVDRAYLVTDAGAGEEKEAELGINFVEAAKE
                     AGVSHMVLSSVSAADLAEDVPHFRSKAKVERSLQTSGMSYTILRPVAFMDNFPVAPGF
                     ARFMVVGMFYAAIGGRKCQLISVKDIGIFGGMALLDPDSPHFHNAILDLSGGNYDISD
                     VRRAVYAAQGKGQPWFATYTPKLVRRLLPYDFRQMMIYLELVGYPDIDTAKLREIYPD
                     LMTLEQYFRQDL"
     gene            complement(1056171..1060097)
                     /locus_tag="CNF03590"
                     /db_xref="GeneID:3258504"
     mRNA            complement(join(1056171..1056571,1056641..1056798,
                     1056870..1056934,1056984..1057036,1057094..1059540,
                     1059603..1060097))
                     /locus_tag="CNF03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_571659.2"
                     /db_xref="GeneID:3258504"
     mRNA            complement(join(1056171..1056571,1056641..1056798,
                     1056870..1056934,1056984..1057045,1057094..1059540,
                     1059603..1060097))
                     /locus_tag="CNF03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_571660.2"
                     /db_xref="GeneID:3258504"
     CDS             complement(join(1056530..1056571,1056641..1056798,
                     1056870..1056934,1056984..1057036,1057094..1059540,
                     1059603..1059858))
                     /locus_tag="CNF03590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571659.1"
                     /db_xref="GeneID:3258504"
                     /translation="MGLAHGESSAEGEAEGAAFEAGPSHPPSTPPRSTASILMTDGFL
                     GEVARWKDADGSSRRVSTAKRTSRMIGSKVGISPPPPPGPPPSNPPPLPPPSFHPFAS
                     VTSTSRRLSQRPIPSARSSTISALHKSPMSNRPSPSAGPPFDENLPPFPGQPRNTSGG
                     LNANGRSESPTPGYPAESLGSPLRAANPQQPTQIGDSSSTTTARISRTTKPRTPSRHL
                     LQNALDLAQKAVEMDRDNDVIGALAAYREAVSKLRSVMERVGLETGGVGSEKKKGKSE
                     EEGRTLKGIHDAYVARIQLLSSYEVSEVRPEPTGAGPSLIEGRRQSFSQASSRQSLDE
                     GATTGIGNLVLSDNPRLSANSPPRLSPSLSTRDKITTSHGGDLGKSPRLPSINGSASG
                     EMSLQQALDQVADASASATGSMVTFPSSSRDPNLPHSAGHRTIGLGHPSTSPSNFMSS
                     SPHAHVRNASMVSIETTSSSMSPTSRRFKRRNKPSLGLDMEADLTGIDGVVADMELLT
                     TTPTESHLMLSPGSQNQVQVGKTPSPQLSTHSEERPLPPVPQGGEHNTQQTRRIRAGS
                     DASINSTGSAMRSPTGGYLVSPSTNKGMISKRRRSRHGSTGIDEMMMEQQEGEHNAQR
                     SRTTSQSGTRSGDTDLPPVPSSSKHQPSVSISSQFNVNSGGGSPPLIQRPNPLLQQLS
                     SLERGKGLRINTSPSNGLTPPTTTITTRQSSYSSHSPSVGNTLPSNADNSPRSYSSFS
                     PLSSLPGLQPTEESLRPFHVLKILRQSMDVDGPGAHLTPAIHIAPAIWNPATWTKLSA
                     AAAQADKTNVPKIVAQDVKTRCMHTLALCLESVKSAGYELLAGPREQRRSSEGAGAEE
                     QKWKRLAEEFVRALDDLEEEMDSASKLLSKGGVGVSSWKGNKTVSSWGSRISRGMDKI
                     SNNKTLDTPDRYVDNLAYFCMTSQILADHLANLIGPCTPAYASMSEKAYHDIETRVRR
                     SAEFVRVVVVPFVLEDFKQFLLRYLKGGVRYLED"
     CDS             complement(join(1056530..1056571,1056641..1056798,
                     1056870..1056934,1056984..1057045,1057094..1059540,
                     1059603..1059858))
                     /locus_tag="CNF03590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571660.1"
                     /db_xref="GeneID:3258504"
                     /translation="MGLAHGESSAEGEAEGAAFEAGPSHPPSTPPRSTASILMTDGFL
                     GEVARWKDADGSSRRVSTAKRTSRMIGSKVGISPPPPPGPPPSNPPPLPPPSFHPFAS
                     VTSTSRRLSQRPIPSARSSTISALHKSPMSNRPSPSAGPPFDENLPPFPGQPRNTSGG
                     LNANGRSESPTPGYPAESLGSPLRAANPQQPTQIGDSSSTTTARISRTTKPRTPSRHL
                     LQNALDLAQKAVEMDRDNDVIGALAAYREAVSKLRSVMERVGLETGGVGSEKKKGKSE
                     EEGRTLKGIHDAYVARIQLLSSYEVSEVRPEPTGAGPSLIEGRRQSFSQASSRQSLDE
                     GATTGIGNLVLSDNPRLSANSPPRLSPSLSTRDKITTSHGGDLGKSPRLPSINGSASG
                     EMSLQQALDQVADASASATGSMVTFPSSSRDPNLPHSAGHRTIGLGHPSTSPSNFMSS
                     SPHAHVRNASMVSIETTSSSMSPTSRRFKRRNKPSLGLDMEADLTGIDGVVADMELLT
                     TTPTESHLMLSPGSQNQVQVGKTPSPQLSTHSEERPLPPVPQGGEHNTQQTRRIRAGS
                     DASINSTGSAMRSPTGGYLVSPSTNKGMISKRRRSRHGSTGIDEMMMEQQEGEHNAQR
                     SRTTSQSGTRSGDTDLPPVPSSSKHQPSVSISSQFNVNSGGGSPPLIQRPNPLLQQLS
                     SLERGKGLRINTSPSNGLTPPTTTITTRQSSYSSHSPSVGNTLPSNADNSPRSYSSFS
                     PLSSLPGLQPTEESLRPFHVLKILRQSMDVDGPGAHLTPAIHIAPAIWNPATWTKLSA
                     AAAQADKTNVPKIVAQDVKTRCMHTLALCLESVKSAGYELLAGPREQRRSSEGAGAEE
                     QKWKRLAEEFVRALDDLEEEMDSASKLLSKGGVGVSSWKGNKTVSSSKSWGSRISRGM
                     DKISNNKTLDTPDRYVDNLAYFCMTSQILADHLANLIGPCTPAYASMSEKAYHDIETR
                     VRRSAEFVRVVVVPFVLEDFKQFLLRYLKGGVRYLED"
     STS             1060062..1060870
                     /standard_name="Sac1"
                     /db_xref="UniSTS:470846"
     gene            complement(1060457..1060538)
                     /locus_tag="CNF03600"
                     /db_xref="GeneID:3258461"
     tRNA            complement(1060457..1060538)
                     /locus_tag="CNF03600"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3258461"
     gene            1060674..1062804
                     /locus_tag="CNF03610"
                     /db_xref="GeneID:3258093"
     mRNA            join(1060674..1060894,1060945..1060953,1061060..1061439,
                     1061502..1061724,1061775..1061891,1061947..1062399,
                     1062452..1062804)
                     /locus_tag="CNF03610"
                     /product="expressed protein"
                     /transcript_id="XM_571435.2"
                     /db_xref="GeneID:3258093"
     CDS             join(1060856..1060894,1060945..1060953,1061060..1061439,
                     1061502..1061724,1061775..1061891,1061947..1062399,
                     1062452..1062676)
                     /locus_tag="CNF03610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571435.1"
                     /db_xref="GeneID:3258093"
                     /translation="MEIKSGKTSMRRKQSNSFLQALGKPRQSLTSSSAPSTTHSSPPS
                     ASTLTLVADEFYSPTSENDSTSMSTRSMSVSTHGRAPESFTVPGGGRSSSQTYSIGGG
                     KEKGKEAEGKNGVILRRPEDVYKVVRDRILSWSYMMEWYQGDAHWFNTVRISRTDIEQ
                     MLGYKHLETRARNYYALGISLSALFDIPASGDFLRALIKLLEEWESFCEGSTATKGVR
                     SLFRGPRSGRRVTGSGSMMSDFGLAMDGSESFLLNFNLPFAPDFFQVHTTACSIVRDI
                     YRKLLGMFLPPAPPSSLSNSSPSSRPLPKSVASLAHPSTVIHTARREPLPFANTKSPG
                     ANSLSTATFANQQGYYGAMSPTDDVGGQMENGGDALLAFIAGDVPGDRTLVGDGQKLT
                     PQVSELFTKADAKLKKHFAILTREADGLAKRVIDDQINSLLFSLTPGSKAMKFDGATG
                     LPANGSGHTTAATMGRTGHMEEDRMRDFGTI"
     gene            1062886..1065478
                     /locus_tag="CNF03620"
                     /db_xref="GeneID:3258257"
     mRNA            join(1062886..1063662,1063713..1063889,1063942..1064196,
                     1064244..1064378,1064436..1064570,1064627..1064712,
                     1064771..1064823,1064871..1064896,1064949..1065045,
                     1065107..1065211,1065273..1065478)
                     /locus_tag="CNF03620"
                     /product="Beta-hexosaminidase precursor, putative"
                     /transcript_id="XM_571630.2"
                     /db_xref="GeneID:3258257"
     CDS             join(1062994..1063662,1063713..1063889,1063942..1064196,
                     1064244..1064378,1064436..1064570,1064627..1064712,
                     1064771..1064823,1064871..1064896,1064949..1065045,
                     1065107..1065211,1065273..1065295)
                     /locus_tag="CNF03620"
                     /codon_start=1
                     /product="Beta-hexosaminidase precursor, putative"
                     /protein_id="XP_571630.1"
                     /db_xref="GeneID:3258257"
                     /translation="MLFSGLLEVLTSSLPFLAPSSPLSAKPDINVVPLPRHYIIGDGS
                     TPVCLSTNFSIQAAPSSLATFPTDLQDAITSTQHRLKNTQVTYLSPNEGSEFFTGGSG
                     AIRSCAYYLDTLHIDFTAYNGTDILSETVAPVEERAELEAYTLDLSLKGKATISSRGA
                     LGAFRGLSTFEGLFYSLEAGVQGSDRVYAPLAPYHIEDKPSFGWRAVLLDTSRHYFSV
                     PSILKILDTMSMVKLNVFHWHVTDSNSWPLDLDSYPELAAKGASSQSERYSQKDMQMI
                     IDYAGHRGIDTLLEIDTPGHTASIAPSHPSFVACFESTPFKHFAHQPPAGQLRFADEK
                     VTEWTAQLLREIGSLSKGGYFSTGGDEINMNCMLEDMPTASKLKAKGWTLDDALDHFT
                     EKTHAPLRQAGKTPVVWQEMALNHGTMSSLTNDTIVDIWVNSADARKVLDQGYRIVHA
                     SADYFYLDCGQGGWIGEEGGNNSWCDPMKSWARMYSFDPFKDVKDEERHLVLGGQTSL
                     WTEQTDETNLEPTLWPRAAALAEVFWSGPGPDSRPRSSNKALPRMHDIRYRMVGRGVR
                     AAPLQPRWCALRPGACILAA"
     gene            complement(1065633..1068331)
                     /locus_tag="CNF03630"
                     /db_xref="GeneID:3258336"
     mRNA            complement(join(1065633..1065975,1066094..1066179,
                     1066254..1066432,1066502..1066614,1066681..1066907,
                     1066969..1067039,1067101..1067216,1067277..1067294,
                     1067351..1067421,1067467..1068331))
                     /locus_tag="CNF03630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657440.1"
                     /db_xref="GeneID:3258336"
     CDS             complement(join(1065922..1065975,1066094..1066179,
                     1066254..1066432,1066502..1066614,1066681..1066907,
                     1066969..1067039,1067101..1067216,1067277..1067294,
                     1067351..1067421,1067467..1068202))
                     /locus_tag="CNF03630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513060.1"
                     /db_xref="GeneID:3258336"
                     /translation="MSSPIDGHLQSQPQRQSYREQEGAMAEQDVGLLAPGPAAYQYDT
                     PYEDDDGPYRDRMMTTSPSIGPWDSASQCSLPHHSQPGFPLPQPSHMPLAGEGTQLSG
                     EKHLTDKPSYGDLSYIDEDGEYNRTDKLLPGSTILNGSRAFDTVEMGNVRPLSSYDDD
                     PAKYASYQDQPSYPYPPQQGQEGGFAGFTRPSNLYIMLLFPTGLDRLLSLFNVKAGAY
                     PVEQAIERKKRGLGGQKYPVAAWCLTAAMTAVMIYEMVRNYQAMGTPIAIKPTFNYMI
                     GPSSEVLINIGARFPPCMKNVSALPATFELACLNDTSSSPTTTCTIEQICGHGGFHGE
                     TPDQWWRFILPIFLHVGIIHLIVNMLVQIIVSAQVEREMGTIPFLIVYMLGGIYGFVL
                     GGNFTRTGIPSVGASGALFATNACVLVDLVLHWKYEERPKLKAFLLFLEFVIGFAMGY
                     IPNAVDGLAHLGGWAMGILCGTILYPAITETKRRKYVIWGCRVVALALIIMAMVMTIK
                     NFYTDDPNEACEWCKYLACIPTSSNDYCTGTGITTTGTSTTKRSWDLL"
     gene            1068633..1069838
                     /locus_tag="CNF03640"
                     /db_xref="GeneID:3258374"
     mRNA            join(1068633..1068854,1068922..1069332,1069402..1069470,
                     1069532..1069838)
                     /locus_tag="CNF03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657441.1"
                     /db_xref="GeneID:3258374"
     CDS             join(1068648..1068854,1068922..1069332,1069402..1069470,
                     1069532..1069651)
                     /locus_tag="CNF03640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513151.1"
                     /db_xref="GeneID:3258374"
                     /translation="MSQPTTLNHTLVPMPTRQHADRAEALWTLSIALIDSAVDILEHH
                     VRTDEQLSKDSALLPGGTLGKHFRHVIETFRAFLLPLYPVPTTAPHIPEINYDAILPS
                     SRRPIARSLDSCRSAMRQISKDLSAWGELCMERGRGRKSGNEADRRINETRGRRERNE
                     RAGLGLDAQDNASEERDGLADEMERIVKVAAITPTKQEMGSTVGRELWYCSLHAIHHF
                     SMLRTIAVYELNLDLPVEFGTAPSTLLYRGLAWKPPVEKEHVKVVRTSKL"
     gene            complement(1069793..1071200)
                     /locus_tag="CNF03650"
                     /db_xref="GeneID:3258435"
     mRNA            complement(join(1069793..1070375,1070448..1070717,
                     1070801..1070997,1071082..1071200))
                     /locus_tag="CNF03650"
                     /product="diphthine synthase, putative"
                     /transcript_id="XM_571439.2"
                     /db_xref="GeneID:3258435"
     CDS             complement(join(1069892..1070375,1070448..1070717,
                     1070801..1070997,1071082..1071144))
                     /locus_tag="CNF03650"
                     /codon_start=1
                     /product="diphthine synthase, putative"
                     /protein_id="XP_571439.1"
                     /db_xref="GeneID:3258435"
                     /translation="MFYVIGLGLSDEKDITVKGLEAVKNSARVYLESYTSILMVEKEK
                     LEAFYERPVITATREMVELEADDILKDADKVDISFLVVGDPLGATTHSDLLLRAQSRN
                     IPTSIIHNASILTALGSTGLQMYSFGQTLSLPFYTETWRPDSWYPRLEENLRLGVHTL
                     VLLDIKVREQSEENMARGRLIYEPPRFMNPAQAFNQMLLTESIRHPAPRHPSQSQSTD
                     QTQKPSQLPSSSHSDSEEEEEEAERVDPYPSLMPPSQTLAISLSRVGTPSQRLISGTL
                     SELAALDEEEFGGPLHSVVIVGKRLHPLELEYAGKFAVGGEQGDWWKVGKEVYGVERE
                     TFY"
     gene            1071446..1073103
                     /locus_tag="CNF03660"
                     /db_xref="GeneID:3258091"
     mRNA            join(1071446..1071639,1071704..1072107,1072165..1072282,
                     1072334..1072444,1072501..1073103)
                     /locus_tag="CNF03660"
                     /product="GPI-anchor transamidase, putative"
                     /transcript_id="XM_571632.1"
                     /db_xref="GeneID:3258091"
     CDS             join(1071457..1071639,1071704..1072107,1072165..1072282,
                     1072334..1072444,1072501..1072932)
                     /locus_tag="CNF03660"
                     /codon_start=1
                     /product="GPI-anchor transamidase, putative"
                     /protein_id="XP_571632.1"
                     /db_xref="GeneID:3258091"
                     /translation="MRLSRILTAISLLLSPLISSLPHEQLDPQLSNLFGNDTTTDGHT
                     NNWAVLVCSSRYWFNYRHMANTLAMYRTLKRLGLPDSNIILMLADDVACNARNAFPAT
                     VYANAGKMLDLYGEGIKVDYKGYEVTVESFLRLLTGRHDATVPRSKRLLSDASSNVFI
                     YMTGHGGNEFLKFQDNEEVSAYDVADAIEQMWEKRRYNKLLYVIDTCQANTMYSKFYS
                     PEIIATGSSSLGESSYSHHNDMDIGVAVIDSFTHNVLQYLETVGKTSRNSLQEFFNTY
                     DPAKIFSHPGISTSLSSVPPEQILITDFFGAVARVEISPQSAELPLESRLIASKDGWE
                     HTSLSINDGSLTEEIPEVLPRKIEGTKKGNGEWNRPLVDKTSEWGFLPPYLIGVVSFI
                     WLYISLGDKEDKDDSEEVREEEL"
     gene            complement(1072174..1073978)
                     /locus_tag="CNF03670"
                     /db_xref="GeneID:3258438"
     mRNA            complement(join(1072174..1073343,1073407..1073424,
                     1073484..1073706,1073761..1073769,1073827..1073978))
                     /locus_tag="CNF03670"
                     /product="expressed protein"
                     /transcript_id="XM_571657.2"
                     /db_xref="GeneID:3258438"
     CDS             complement(join(1073123..1073343,1073407..1073424,
                     1073484..1073706,1073761..1073769,1073827..1073880))
                     /locus_tag="CNF03670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571657.1"
                     /db_xref="GeneID:3258438"
                     /translation="MSRFSGRSLDKLWFAFFAFHLPISILLDLQYLYPPSLIPSSLKA
                     FMLWSINLTRDPILLGAVNNDPTFGWLKCFSWLEAGFQVPCFVVGLWGLWNNDKRVYP
                     VILAYGASTATTLLPCLHTIFTTQATPPHTTAEIANLLAEYVPFLLLPLGMAVDMSWR
                     IVKIINAAEGRKNV"
     gene            complement(1074605..1076721)
                     /locus_tag="CNF03680"
                     /db_xref="GeneID:3258018"
     mRNA            complement(join(1074605..1074827,1074889..1075232,
                     1075282..1075401,1075450..1075670,1075721..1075973,
                     1076024..1076115,1076169..1076326,1076384..1076530,
                     1076598..1076721))
                     /locus_tag="CNF03680"
                     /product="rtf1 protein, putative"
                     /transcript_id="XM_571655.1"
                     /db_xref="GeneID:3258018"
     CDS             complement(join(1074674..1074827,1074889..1075232,
                     1075282..1075401,1075450..1075670,1075721..1075973,
                     1076024..1076115,1076169..1076326,1076384..1076530,
                     1076598..1076704))
                     /locus_tag="CNF03680"
                     /codon_start=1
                     /product="rtf1 protein, putative"
                     /protein_id="XP_571655.1"
                     /db_xref="GeneID:3258018"
                     /translation="MSDLENELLGLAEDDPTRHRKRHGSNDRSKRNSKAFIEDSDDDG
                     EEEDMEMESEDDEPALQRSRGPLKNPYPLEGKYVDEADREALENLPEIERENILASRL
                     EEMQKFKDSQALDAMFKTAHGGDDEEEDDSRARKRRKHTSVSEKASRALNVLKNKRKA
                     KDERMQRRAARRRHSRSASASSEEEGQITRRSPSYSPERSLSPQPKNVQPKLSKEEEM
                     DAIAPNRAELESARVSRYELVDMMHKDGFEDVITGAYVRIISPDRDEHGRPKYRLYKI
                     ADVDESGQFGSYSIEYQGRQIRETRALLVKYGSASRLFRMADVSNGVIEESEFQRFSM
                     TNQADGVKAPKRSFLKKKHDEIKALRERPMTSAEIDRRVDSRKSQESSFTRVSLLKIH
                     QLMNTRDLALRRNDHVMVEKLNSDIIALGGDPNTGRLVAEKEGEKDDYDMKIQKINEN
                     NKRKTKEAMMRAHAAAVARKKAEEAVVKAKLAASQNPSTTSTPATDVPKPEVPPPSGQ
                     RKGETPQQYVARTVQLDLDLGDF"
     gene            complement(1076940..1079994)
                     /locus_tag="CNF03690"
                     /db_xref="GeneID:3258044"
     mRNA            complement(join(1076940..1078556,1078608..1079108,
                     1079155..1079441,1079713..1079721,1079769..1079994))
                     /locus_tag="CNF03690"
                     /product="CDC1, putative"
                     /transcript_id="XM_571653.2"
                     /db_xref="GeneID:3258044"
     CDS             complement(join(1077368..1078556,1078608..1079108,
                     1079155..1079441,1079713..1079721,1079769..1079903))
                     /locus_tag="CNF03690"
                     /codon_start=1
                     /product="CDC1, putative"
                     /protein_id="XP_571653.1"
                     /db_xref="GeneID:3258044"
                     /translation="MLGSPRAHSPAAPPAARGRKTGLKSRATQILALRFGWVVLVIWY
                     EVGEFFHSLSTCRFPDSALRQAYPQAPPPTHVVLIADPHVPHPRLSYPPGNPWLNWAK
                     QQIDELFMRKSWNVVMRLGRVDQVLVLGDMLDSGRGVMTDEEYEEYIALFRSIFQLPL
                     TTPMHFVPGNHDISLVPNGRFSAQARLRYQQYFETPNTVLPISNHSFVLLDAVGLVEE
                     DYRRYASEMQFGEWDGVKGGVIEFVKDLRDNPPPGPKILLSHIPLARPEGATCGPLRE
                     KGRISKGAGPGYQNLLGSETSKFLLDAIQPNIVFSGDDHDYCDYVHKENIREVTVKSF
                     SSSTGIRRPGLQLLSLVPPPTESTAGLLPTHADRPCFLPDQLGVYWRVYLPLAILTAL
                     YLFVTNLHSAYSRWDRSSHALSEKMRSSPALLSAETMSPNSFSSRRNGPIPLSIPSRK
                     SSSHLPLSAPSAISSSTLPRPVRYNSTPAEYAPSSRSGQSNPVSPFGSPKLSAVERFA
                     ERDVERDGEAASASVTGLNTPLTLSRRSSYIYMDRGFPSSVSDAAPLSASGTTNWGLG
                     ANTGASSPSSSGFIRRVSSANLSTLASMNVAPPSLSVTSPGTPRRITLPSPLLLPHSP
                     AHAQAHPLSQASSHTTHSHPAVIYTFPTPSRSWLWFERAKSFLRWTWKARKGAVGKSW
                     RELISVAWVGAVVWLGVNALFFLE"
     gene            1080209..1081778
                     /locus_tag="CNF03700"
                     /db_xref="GeneID:3258144"
     mRNA            join(1080209..1080271,1080540..1080644,1080761..1080843,
                     1080950..1081197,1081252..1081419,1081477..1081778)
                     /locus_tag="CNF03700"
                     /product="membrane organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_571441.2"
                     /db_xref="GeneID:3258144"
     CDS             join(1080540..1080644,1080761..1080843,1080950..1081197,
                     1081252..1081419,1081477..1081493)
                     /locus_tag="CNF03700"
                     /codon_start=1
                     /product="membrane organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_571441.1"
                     /db_xref="GeneID:3258144"
                     /translation="MAAHSEQIKNNFLNNPYAQQVFNIANGQVSALDAELNKYPILRQ
                     LEQQTKVPKAYGVIALGFSSVLLIFFNMFGLAQPISNLIGWALPAYLSILAIESPQTN
                     DDKQWLTYWVVFGSLNLVESMGLRAVLYWVPMYFVFKTLFTIWLMLPATRGAEILYFH
                     FLRPMVGNVKSRSQSSFGTSDPLAKETGFNPAGTTAPSSFAHEKTL"
     gene            complement(1081763..1083172)
                     /locus_tag="CNF03710"
                     /db_xref="GeneID:3258244"
     mRNA            complement(join(1081763..1081977,1082053..1082766,
                     1082860..1083172))
                     /locus_tag="CNF03710"
                     /product="methylenetetrahydrofolate dehydrogenase (NAD+),
                     putative"
                     /transcript_id="XM_571443.2"
                     /db_xref="GeneID:3258244"
     CDS             complement(join(1081864..1081977,1082053..1082766,
                     1082860..1083135))
                     /locus_tag="CNF03710"
                     /codon_start=1
                     /product="methylenetetrahydrofolate dehydrogenase (NAD+),
                     putative"
                     /protein_id="XP_571443.1"
                     /db_xref="GeneID:3258244"
                     /translation="MSQGILITASKVATPFKSELLSALASPRFSSRPPHLVGILATKK
                     EDARTYAEFTKKACETLGITYELRLVGEAREGMDGEGVGIEVEEAILEANEDPEVDGM
                     MVYYPIYGGRQDQYLQSVVSPQKDVEGLNHQFLFNLYHNVRFINPLTLRPIPASHLPE
                     PLPSKSGDSSKGEDVAPEGTVKSILPCTPLAIVKVLEHIGVYNRLLAYGDRARGKVIT
                     VINRSEVVGRPLAALLANDGARVISVDLDSIVEFSKRPSKSAEGKKPSSASPHHITTP
                     LPDMTLHKALSFSDVVISAVPVDSFKVPTRELKDGCVCVNVAGEKNFETDVRDRASIY
                     VPSVGVMTITMLQRNLLRLCEYRDMIKKQEASL"
     gene            1083964..1086592
                     /locus_tag="CNF03720"
                     /db_xref="GeneID:3258318"
     mRNA            join(1083964..1084027,1084100..1084241,1084461..1084605,
                     1084659..1084868,1084924..1085112,1085162..1085846,
                     1085903..1086246,1086318..1086592)
                     /locus_tag="CNF03720"
                     /product="C-22 sterol desaturase, putative"
                     /transcript_id="XM_571445.2"
                     /db_xref="GeneID:3258318"
     CDS             join(1084502..1084605,1084659..1084868,1084924..1085112,
                     1085162..1085846,1085903..1086246,1086318..1086375)
                     /locus_tag="CNF03720"
                     /codon_start=1
                     /product="C-22 sterol desaturase, putative"
                     /protein_id="XP_571445.1"
                     /db_xref="GeneID:3258318"
                     /translation="MESHTVLRPTAIPDLAAIKTWGLEGLTKAKFSFDTKTTTATILT
                     LILSLLVLEQLVYRAKKAHLPGAKWTIPVIGKFADSLNPTLANYKAQWNSGPLSAVSV
                     FNIFIVIGSSNEMARKILNSPNHAEPCLVASAKKVLLPENWVFLHGKVHADYRKALNV
                     LFTKQALSIYLPIQEKIYRSYFNKWMSDPAPAQQYMMKMRDLNMDTSLSVFIGPYLTE
                     AQKQEINDKYWLITISLELVNFPLAIPGTKVYNAIQARKIVMKYLSAASAASKIRMED
                     DDAEPECLLDHWVRAMILARRAKDDGEQTRLLSREYSDHEIAMVLLSFLFASQDAMSS
                     ALVYTFQLTADHPEVLEKVREEQYRVRGNDLERPLTLDMLDDMVYTRATIKEVLRFRP
                     PVIMVPYMTTKPFPVSPEYTAPKNSMIIPAFWNSLHDETCYPEPDRFLPERWLPQADG
                     SAPIADSKPQNYLVWGSGPHKCIGGQYASMHLAATLGTASVLMDWKHERTELSDEVQV
                     IAAIFPKDHCLLKFTPRAPPS"
     gene            complement(1086791..1088537)
                     /locus_tag="CNF03730"
                     /db_xref="GeneID:3258442"
     mRNA            complement(join(1086791..1087071,1087127..1087460,
                     1087515..1087695,1087751..1087812,1087911..1088537))
                     /locus_tag="CNF03730"
                     /product="expressed protein"
                     /transcript_id="XM_571638.2"
                     /db_xref="GeneID:3258442"
     CDS             complement(join(1086987..1087071,1087127..1087460,
                     1087515..1087695,1087751..1087812,1087911..1088505))
                     /locus_tag="CNF03730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571638.1"
                     /db_xref="GeneID:3258442"
                     /translation="MLRMLQSALRRGTDPAPAIARTPAALRTSLLPRHFSLLCRPLQP
                     QHSTRPKLAKAPKAAKPLKTPKFFKASKQSNAKEPYKPRKSKGPVLSETRVTFQLPVS
                     PENATASKNPSSPIHLPFDKLLVMVRAADVVSRMEMPEELPDFPLPPLPDIYDRELLR
                     QVFTHTSYVGARKQSALFDKEAFHHDNEKLEHVGDALLGCIVTCLLHDLYPNLNPGNA
                     TEMKAICVCNQTLSQLSRRYKMPERLITDVNATEILKNGTKTTANIFEAYVAGLHYSY
                     LKHGNTKDVDGGDGPKTHGQGLEHLQGWLRPLFEPIAEWVLGYMKKEQERLEAETAVK
                     AGLMDTDLDDLANGASGKLNELFISRGAGMPVYTYEPRGVDMWKAIVIARNRDGKEWQ
                     GEATRTKKKQAATVAAYKILMQLEVV"
     gene            complement(1088657..1097395)
                     /locus_tag="CNF03740"
                     /db_xref="GeneID:3258220"
     mRNA            complement(join(1088657..1088818,1088875..1089052,
                     1089106..1089346,1089399..1089488,1089548..1089814,
                     1089870..1090117,1090171..1090552,1090608..1090964,
                     1091018..1091359,1091408..1091689,1091742..1091934,
                     1091998..1092108,1092157..1092767,1092819..1092962,
                     1093021..1093410,1093459..1094094,1094141..1094380,
                     1094429..1094882,1094934..1095171,1095230..1095503,
                     1095565..1095865,1095918..1096020,1096069..1096602,
                     1096656..1096802,1096849..1096920,1096976..1097154,
                     1097205..1097395))
                     /locus_tag="CNF03740"
                     /product="phosphatidylinositol 3-kinase TOR1"
                     /transcript_id="XM_571336.2"
                     /db_xref="GeneID:3258220"
     CDS             complement(join(1088803..1088818,1088875..1089052,
                     1089106..1089346,1089399..1089488,1089548..1089814,
                     1089870..1090117,1090171..1090552,1090608..1090964,
                     1091018..1091359,1091408..1091689,1091742..1091934,
                     1091998..1092108,1092157..1092767,1092819..1092962,
                     1093021..1093410,1093459..1094094,1094141..1094380,
                     1094429..1094882,1094934..1095171,1095230..1095503,
                     1095565..1095865,1095918..1096020,1096069..1096602,
                     1096656..1096802,1096849..1096920,1096976..1097154,
                     1097205..1097257))
                     /locus_tag="CNF03740"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase TOR1"
                     /protein_id="XP_571336.1"
                     /db_xref="GeneID:3258220"
                     /translation="MSSQSDVLDNIFQRLSARSEDVRAQAGQDLAEHVVAYTQEYPGH
                     DASKGVWAQVFHKTFEFTRSNNQLERLGAIISISQLLQLTKDDTLDRAQQKVLRLYEY
                     LRPLTTCGDSTVMLPASLVVEDMVRNSPTLHTDTFLGKEVGQALVMIDDSRQEVGRFS
                     GALLLYAFARAAPGVFHQYIPKVLEKIWVPLRDSRSVVRERASMLLSTCLDTLKTRGD
                     RPSTDTYRKIFEEARLGLLKASSTESILGSLLAFNSMLQNQQLSMAEYYRSICELTFK
                     YRDSKEVSIRKAVIALIPSMATYDSDDFEAHYLHRSMAYLLQALNRPADRDISYVALG
                     HMAVHLGSKMKPFIDDIMRIIRDHLRMRGKKNAPYEAPIFQCLAMLATSVGPMLTRQM
                     HEILNLMFPWGLSEPLCTALQATASHIPPLLRTIQDRLLEMLSQTLTGHSYRPLGAPA
                     PRGGAQMDLNLLQSTTNAQSADTLKLALRLLARFDFVGHTLSEFVRDAALPYLEHDSV
                     EVRREAVLATTTLFMTDPICQQTSSNSVEIVNDVLSKLLTVAITDPNAGIRRTVLDHL
                     EDKFDRHLAQADDIRCLFIALNDEVFGNRERTISIIGRLAHHNPAYVMPHLRKSLINI
                     VTELEYSTNARQKEESAKLLCLIIGAAAGLVKSYAPTILSVLLRTASSPDSSIGVQAE
                     CLKCIGELARVAGEELVPSVRAILDLVIEMLNDQASPAKRDTALKTLGQIASNTGEVI
                     KPYTDYPQLMGVLFRFLRMEANSSVRQETIKTIGMLGALDPFKHKTLLGDVDDPIDEG
                     TTSRVNDIVLLNQHNSSVNDEFFQTVVIHSLVNVLHDSTYKDHYQAVEAIMMIFRTQR
                     LRCVNFLPQIVPAFLNVIRIAHSSRTELYLKQLAQFITIVKLHIRNYLNDVFDLIHEF
                     WNPNSTLQITIISLVEAIAKAVEGEFKAYLPKLLQQILRSFDGDLSAKHLPELKLNTL
                     LQILKAFYVFGESIEDYLHLVLPVIVRSFENPAAPDSLRIAALRTTGQLCRKVNFSDH
                     ASQIIHPLVRTLGNSSEELRQTAMETLCVLVLQFGPDYAIFIPMVNKALVENKISHPG
                     YEALITQLLNRERLPPDLGPVERYASDSAVEASAPEPVALKVNQQALKLAWDCSHLLN
                     TSSRTEWISWIIGLGHEMMRESPSQAIRAARSLALSSVAFTKELFNVAFYSCWQELFE
                     SYQEDLWHNLDRAIKKDDVPGDVVNMILGATQFLEHDEKEVAIESRVLGSVAANYQAL
                     AVALHYKEQEFFLDPSKEVIEDLIDVNQKLQQSDAAWGTLEWAQTEMGMTTEVEWYEK
                     LGRWEEALQVWNERDADASTTFSEWEITEGKVTCLHAMGEWEQLSDFVQARWANRTAE
                     EKKLLSPLAAAASWSLKQWDLMDDYISAMKGDGADRAFFKAILAVHRNQIPAALKQIS
                     KARERLDPELTTLTGDSYGRAYDTVVRIQMLAELEEIIAYKDHADEPARQEMQRQTWK
                     KRLAGCQRDVEVWQRILQVRSLVLKPNEDMDTWIEFADLCRTSDRLNLAEKTLTSLVG
                     FQYPSMEDTRGRAPPPIIFAYLRMAWAKNLQIDSREERYETLQHLRDFTDQLTDDVGI
                     GARGPNGRLMLPDQKLYGSYTKLLAQCHVELGQWQATLRESQGSADPSGILHDYSLAT
                     ELDPEWYQAWHTWALANFEVITQLEVSQQGLSPIHFTTYIIPAVEGFLKSISLSPGNS
                     LQDTLRLLTLWFTYGYSSGVTAAVSQGLPTVNIDVWLEVIPQIIARIQTPRQSIQQLI
                     VQLLHDIGKAHPQALIYPLTVASKSTVAARRTVAQNITHKMREHSPKIVDQAELVSTE
                     LIRAAILWHEMWYDGLEEASKHYFGDHDIPGMLGVLEPLHEIVENGPQTLRETSFIQS
                     FGHDLRIAREHLKRYRITQDGTEIQQAWDVYYSVFQRLGKQLKLLNVIELQYVSPKLM
                     AVRDLDIAVPGTYQSGKPIIGIKNVIPTFKVIASKQKPRQCSMRGMDGKEYAYCLKGH
                     EDLRQDERVMQLFGLVNTLLNNDHESAKRHLSIQRFSVTPLSPSAGLLGWVTHSDTIH
                     VLIKQYRDQRKILVDIEHKLMQQMSDESYDSLPLLHKVEIFQYALDNTTGQDLYRILW
                     LKSRNSDIWLERRTTYTRSLGLNSMVGYILGLGDRHPSNLLLDQITGKMVHIDFGDCF
                     EVAQQRDKYPEKVPFRLTRMLIHAMEVCGITGNFSRSCEVSMEVLRDNRESLMAVLEA
                     FVYDPLIAWRLTATDKRPGGVGEVKDLDDPAVYGKQRKNKANETEILNDVENTEVKND
                     KGLQVIERVRRKLTGRDFKPDVVLDVKSQVEKLVVEATKTENLCVAFLGWCSFW"
     gene            1097580..1099608
                     /locus_tag="CNF03750"
                     /db_xref="GeneID:3258055"
     mRNA            join(1097580..1097713,1097765..1097851,1097920..1097999,
                     1098067..1098253,1098310..1099608)
                     /locus_tag="CNF03750"
                     /product="DNA-directed RNA polymerase iii 34 kda
                     polypeptide, putative"
                     /transcript_id="XM_571634.2"
                     /db_xref="GeneID:3258055"
     CDS             join(1097651..1097713,1097765..1097851,1097920..1097999,
                     1098067..1098253,1098310..1099572)
                     /locus_tag="CNF03750"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase iii 34 kda
                     polypeptide, putative"
                     /protein_id="XP_571634.1"
                     /db_xref="GeneID:3258055"
                     /translation="MSSMSTADQQVWKKVLAAKNKNMSLTQIEASFPTMSKKAVMSSV
                     TTLLKLRLLSQVKGKGDDKAMVYHAQTPEEAKQKATLTQEQSIILSIIRSAGNRGIAS
                     AQITRTIGTDTMPISMLRKVLKTLESEGHIKQFKPVNAPTSVYYILAHLKLPEEISGG
                     VWFDDNKEYDQGLVETICAVLLNRVRTATYVDDKKRSQEAKSLVPNALNTSSKYYSLL
                     TPMALRTYVNKLGVTSATLSVKNVMECMRALELDGLVEVVKPVGGVHLQEESDDESTA
                     RSSKRRKVESDSEDEDRDKEREKAKMKAKEKAKMKKRREREKERERKEKERERKRKEK
                     EKERERRKKEKEKERKRKEKERGKKKKKVYGSDNEDSDDVLLSINDDGKKKRSRSLSI
                     SSVSSISSSSSSSSESHSDSDSGSSISSVASSQLDTSSIPFRPSAAATASASTPAQII
                     PGGLSGGLTDLTDTAIIYRATSRISIPLGQTQAPCGKCPVFHFCEEDGPVNPTGCEYY
                     GEWLGDSVGGWEKEALRKMRPGWADNEDDKEKEKTREAEVNGNGDVVMEDY"
     gene            complement(1099595..1101758)
                     /locus_tag="CNF03760"
                     /db_xref="GeneID:3258050"
     mRNA            complement(join(1099595..1099965,1100022..1100122,
                     1100175..1100356,1100418..1100598,1100651..1100778,
                     1100830..1100907,1100956..1101059,1101108..1101425,
                     1101480..1101758))
                     /locus_tag="CNF03760"
                     /product="carboxypeptidase C, putative"
                     /transcript_id="XM_571636.1"
                     /db_xref="GeneID:3258050"
     CDS             complement(join(1099685..1099965,1100022..1100122,
                     1100175..1100356,1100418..1100598,1100651..1100778,
                     1100830..1100907,1100956..1101059,1101108..1101425,
                     1101480..1101726))
                     /locus_tag="CNF03760"
                     /codon_start=1
                     /product="carboxypeptidase C, putative"
                     /protein_id="XP_571636.1"
                     /db_xref="GeneID:3258050"
                     /translation="MRLSTLALMATPALALPNYLRLSNGPSELASDLATHAISSAQAW
                     LQGAVSSTRSSVQNGWKGVQDGLDQGLKVETVDEAGIEYLALSHPAFPLHRLRVVEPK
                     LCDPSVKQLSGYLDISETRHLFFWFQESRENPDEDPLVLWLNGGPGCSSTTGLLFELG
                     GCNIRDKGENTTFNEHSWNSVANVLYLDQPIGVGYSYADEGEVNNSPAAAEDVYAFLV
                     LFISKFREYSKLDFHVAGESYAGTYIPNIASVVHKNNIALDLVPTPSVPKINLKSVMI
                     GNGLTDPYAQFGSVPDWACNSPYAPYDDPSPECDSLRTRANRCQGLISGCYKTNSRFT
                     CVPAALYCWSMFNELQDLGRNMYDVRKTCDKSPEKDGPLCYREMGWMETYLNKPEVKK
                     ELGAPERVTFQSCNMQINQNFLLHGDGMHYAGGLLPDLVEDDIRVLIYAGQADMLVNY
                     IGCASVLDNLQTSYLASYLAAPFVNFTSPDGEVSGYTKSASKDGKGSGNVAFVAFHNA
                     GHMVPHDDPEGALRMVGRWLKNEPLAVAEDE"
     gene            1102012..1107380
                     /locus_tag="CNF03770"
                     /db_xref="GeneID:3258340"
     mRNA            join(1102012..1102129,1102192..1102288,1102343..1102416,
                     1102460..1102643,1102693..1104469,1104520..1105428,
                     1105481..1105596,1105651..1106275,1106340..1106614,
                     1106668..1106758,1106814..1106979,1107046..1107380)
                     /locus_tag="CNF03770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657442.1"
                     /db_xref="GeneID:3258340"
     CDS             join(1102090..1102129,1102192..1102288,1102343..1102416,
                     1102460..1102643,1102693..1104469,1104520..1105428,
                     1105481..1105596,1105651..1106275,1106340..1106614,
                     1106668..1106758,1106814..1106979,1107046..1107317)
                     /locus_tag="CNF03770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513131.1"
                     /db_xref="GeneID:3258340"
                     /translation="MAEDINIFADEEGDVCRVCRLGEEPDNPLVYPCKCSGSVRFVHP
                     DCLKQWVAQSQKKHCEICGHKYTFTKVYPKELPTVIPTTVYLRQGLLFLRRQILWFLR
                     AWLVVIVWLVILPAWNIGALFFMSLLSDLIGLKAPPSEETIDSTTNATIIESAVASNA
                     TTYTPSFVSFPSFIASPFLYANNVVRSSFQKWLQGEENTAVGFVLRGQILSLSMAAVL
                     IGLVLLREWVHQHNWQEAEQPPRHIEPEPNPDEWFILHGVARRQADVIARVLEATRTR
                     APLSLRTARHDLPPADVPGEALGDEAGNDDNDAGNDASERLMIGAGQELNEEWWARQR
                     TWAEGLPAEHRGTFHEILTSLQATANAAQKAELEGQNRDVPPAQILTDNPLFRKPGMP
                     IADIPKQDLENLQAGSQIHILPSQQGIPPRSWVEAPQEKQGQAEIGNDHPDNEESGSA
                     SSEASKQGESMAFDALAEYRRFHALREQQQADVALDSADDDDDEGQGRAGPSRPAWSR
                     RATAIDDEEREERDRVAYSAPELLKEDEVEDKANGKGNAKGKAPATDENVEDKEEGTA
                     FGRTEAPWKPLFDPPQSDDDSPQPKTDEEDGDEGDNDGDGEWEDEPDARPNPFNFDLN
                     NLQAPVANGVVLAPVHDQQNINALGNFNLAAFNDLPPAFANVPEGRIRLVQPEELGLP
                     RANVGANVEFVEEEEDQWDPDDWNGVLEVVGLIGPIHGLFQNLIFALFIMGFGIILIL
                     GVPMLIGKLFLSFDFFRTALGVSSKILTIIRKVTDPVVDIVFEIVKDVVVLPLMASGR
                     AAEKIVAKKLGLEVGYRLGSSSGGFSRLTAGQSASRLSPILEKAGDYIATFGQFCYDS
                     YNSILTFEHHIATSTSFSGRAACVATGYAFVASLVTLTAIAGKARLTRTATEFAETLD
                     QHSNFVKVAFFMTLELVAFPLCVGGMIDLCLVPLFPGATILSRWENLVCSPFGTAFID
                     WLLGSMFMFSFSTLLGQVRKVTRPGTMFFVRDPGDPNFSPVKDIVDKTTLHQLRKLGS
                     SAIMYSAVVFSLFGVVSWGLAYVPGGFLPLKVEPTFGPITSIPFDLLFLHLAIPPTID
                     LVRPQSRARRLFTQWWRAVTTRYRLTNLVAPVPNENERSEAPTKLENALWPICDWICQ
                     KLFGKYRTEATDARVPASDSVVLMPIEQRRKEGGVFVPLDGSGIPYNRADKLRLLKQD
                     KIAREAGRLPTSDYTVVWLPKYWRTRIHMFVASALASMSIVIALAAFTPVAVGRMMWK
                     TLGMDVHDGYSWFAGAYILYFSLTLGRRARKHITNFNRAERLRASIFSKRVKRGVLRW
                     IAGTYGVITFYAVVPALVGMVIDVYLGGLWSDRNNVGRVIHVWDAWAMGTAFCSVIVG
                     VIGLLPRARRTGLHTVCERFREPAAKDFKSTTRLARLVLVPSVILLVAPHVVGTTLVE
                     LLPESANQEENNAILFRSVVLPLMLILSVAYATSRYLEAEASVIRQKVIEAEYVVEER
                     VENYVPPANDGGQSGKLGSGGAGPGSIGDNAEKVAVIGEGDDDWEDM"
     gene            1107950..1111061
                     /locus_tag="CNF03780"
                     /db_xref="GeneID:3258100"
     mRNA            join(1107950..1108046,1108284..1108409,1108562..1108575,
                     1108668..1108693,1108765..1108773,1108843..1108956,
                     1109007..1109127,1109175..1109236,1109290..1109804,
                     1109860..1110235,1110289..1110358,1110411..1110497,
                     1110548..1111061)
                     /locus_tag="CNF03780"
                     /product="malate dehydrogenase, putative"
                     /transcript_id="XM_571672.2"
                     /db_xref="GeneID:3258100"
     CDS             join(1108033..1108046,1108284..1108409,1108562..1108575,
                     1108668..1108693,1108765..1108773,1108843..1108956,
                     1109007..1109127,1109175..1109236,1109290..1109804,
                     1109860..1110235,1110289..1110358,1110411..1110497,
                     1110548..1110903)
                     /locus_tag="CNF03780"
                     /codon_start=1
                     /product="malate dehydrogenase, putative"
                     /protein_id="XP_571672.1"
                     /db_xref="GeneID:3258100"
                     /translation="MYPGSSTSALTRAAIARIALRRSTVACRRSVTSRTISADDKNLI
                     PIRTNLRGSALLNTPRLNKGAGFTREERQIFGLEGFLPYDVHSLEKQCLRAYNQLCKQ
                     PSVILKHAFLASLRDQNQVLFYRLMQDRLKELLGVLYTPGAAEAVAGYSSLFRRPVGC
                     YISFPNQDGMRAQLEGHLTDVNRTADVAYDSNKPDDAIDLVVVTDAEAILGIGDQGVG
                     GITISTSKAALYTLGAGINPNRILPVVLDCGTDNHALFSDPLYMGWKRTRIRGKNYDQ
                     FIDRFITNCRELFPNAIIHFEDFGMANAYRLMEKYKNIPMFNDDIQGTGAVALAALLS
                     AIKVAGSRLSDQRIVIYGAGSAGMGIADQIKDGLMILEGLNKDEAARRFWCVDRNGLL
                     VESMGNGLRHSQMPYARPDAEVEHWNKEDEDRNGIWLMDVIKNVKPTVLIGTSTHSRA
                     FSEELVREMGKHVERPIIFPMSNPTALCEVDPADALAWTENRALVATGSPFPPVQLGN
                     GQEYIVAQTNNALIYPALGLGAILARSKTISNSMLMAGVNSLASLSPALSNSEASLLP
                     DLADVRKVSVDVAAAVVRQAVEDGNAYDENTIKYVKGKGDVSLEEYIRSRMWDAVYRP
                     LELVD"
     gene            complement(1111276..1111357)
                     /locus_tag="CNF03790"
                     /db_xref="GeneID:3258462"
     tRNA            complement(1111276..1111357)
                     /locus_tag="CNF03790"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3258462"
     gene            1112095..1114570
                     /locus_tag="CNF03800"
                     /db_xref="GeneID:3258405"
     mRNA            join(1112095..1112415,1112469..1112631,1112684..1112920,
                     1112976..1113223,1113276..1113369,1113418..1113501,
                     1113552..1113901,1113956..1114217,1114279..1114570)
                     /locus_tag="CNF03800"
                     /product="ubiquitin specific protease, putative"
                     /transcript_id="XM_571674.2"
                     /db_xref="GeneID:3258405"
     CDS             join(1112188..1112415,1112469..1112631,1112684..1112920,
                     1112976..1113223,1113276..1113369,1113418..1113501,
                     1113552..1113901,1113956..1114217,1114279..1114412)
                     /locus_tag="CNF03800"
                     /codon_start=1
                     /product="ubiquitin specific protease, putative"
                     /protein_id="XP_571674.1"
                     /db_xref="GeneID:3258405"
                     /translation="MATPQSRIFDRTDTSICPHLSALLSIPSASSRNPGTSGAKGNTL
                     GFPPGSKGAEIEKRFVDVVKWGALPQGVKRRKTMSPGCHTCKTPLSRPWACLTCPYVG
                     CMPLVGKGANEKDCMKRHWKSSGRKCAFAVDPSTGTIFCEACGDTTYPDTFESLFLTT
                     RIRVEESNDHSREPGLVGGKGRGRGEWKSWNPNNIAALNEREVVRTSCRGLRPLLNLS
                     QTCFLSAVLQALVHNPLLKAYFLSDKHNRHVCTNGGKGLLVGKPFLGVENGPGAVGSD
                     RERGCMCCEMDKAFEEFYNEDKSPFGPITMLYAMWHASTELEGYGQQDAHSFFLAALD
                     QIHAHAKGQLSSCNCIAHQTFAGSLQSSVICSKCSKTSNTVDPILDIQLDFPPPSVPS
                     SASSSSDSSAFGPSTNGQADQLTLAGMLRKFCAPERVGDPGGNGYECSGCGGGVGVVA
                     MRKLGVKKLAPVLSFQLKRFAHSSATTSVKIESHVRFPSTLDMRPYVDSSSSSKSGND
                     RKEKELPDSLYIYDLFAVVTHEGKLDNGHYWADVRDGEEWWHCDDDKVTPTSLSAVLA
                     QRAYMLFYVKRSIAYAQPMSRLLAGGSTGTNGA"
     gene            complement(1114535..1118174)
                     /locus_tag="CNF03810"
                     /db_xref="GeneID:3258037"
     mRNA            complement(join(1114535..1115898,1115959..1116749,
                     1116800..1116829,1116876..1116987,1117040..1117669,
                     1117754..1118029,1118088..1118174))
                     /locus_tag="CNF03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657443.1"
                     /db_xref="GeneID:3258037"
     CDS             complement(join(1114957..1115898,1115959..1116749,
                     1116800..1116829,1116876..1116972))
                     /locus_tag="CNF03810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513032.1"
                     /db_xref="GeneID:3258037"
                     /translation="MSARTRTRHHPSAGTRPRPPLIQTSQAAEPAADGRREDKSAESN
                     PSRPPTPAPTSSRASNPLPDLSRVATAAYTASILARPPPPTIYGRPGTRPFSLDPLPF
                     TDEDIPLPKPYNSNYPHPITAYASPGVNPETVKGSGYNKLLQDIVKEDVKSALGDILY
                     DAGFRDLSNSVYLLFSYESMGQGNGIPESLWSKFENVNNVRLPAAAAVTASVVAQVEE
                     TPPRFTQSQLNSTCSSDFNAHRTVENNQAMGRTLRLLSGESILSPPYSLIQTQTHTQP
                     RDREAMDAWKTEICAAWEATGRCRYGSSCQFAHGIEELKLTRQSLIIRGLAPQSPPTP
                     SDILSPISPHRSSVSRYPVTCRSSQTQIYHPAIISGCPYVIKASDRRMSVPHSQLSRV
                     AEDELQFNDLDLGFRRLSDVSSGPPFANTQNLGVPSSRPRFDPLPSKFAPSPGEEYQG
                     YLFPPCKPTSLSSDSASSITSFNIGPLSAQEKQRRLVSQPSNLTLYTSSSSSTESVSG
                     GSRLSMFSAFDDGLGESLVTPIEVGWENNYLDSASGSSSSKTGLDIQSSNSGTGDEIG
                     FEATGMRKAGLVKSGSMGSVGMMGLPAHSSLPSMVGPKVSTTYEFSSGNSIWR"
     gene            complement(1118415..1121042)
                     /locus_tag="CNF03820"
                     /db_xref="GeneID:3258385"
     mRNA            complement(join(1118415..1118497,1118553..1118886,
                     1118940..1119027,1119236..1120250,1120301..1120908,
                     1120958..1121042))
                     /locus_tag="CNF03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657444.1"
                     /db_xref="GeneID:3258385"
     CDS             complement(join(1118474..1118497,1118553..1118886,
                     1118940..1119027,1119236..1120250,1120301..1120908,
                     1120958..1120979))
                     /locus_tag="CNF03820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513034.1"
                     /db_xref="GeneID:3258385"
                     /translation="MALRKLQAEIDRTLKSVATGVEVFEATFDKLNYATNTTQKDKLE
                     NDLKTQIKKLQRMRDQIKAWLGNGDIKDKTALLENRRLIETQMERFKALEKETKMKAF
                     SKEGLIAQSKLDPAEKAKRDMIDWIGSTTDELSRQIEQTEAEVEALQVGKKKKQAGER
                     LDELEELNERREWHIGRLEVVQRMLENGQLTVGDVEDIQEDVKYFVEANMEEDFDFDN
                     GIYDELNLQDEEDFHDYLHEHPSATDELEPEPEPVVPTQAPKTPAKEKEDKKATPHRL
                     SKSESREKEEEIPPSPVVVKKTPSRKTTLDKDKKDKKDKEKEDKERKERERDEKEREE
                     RSSSSQPTPSKPAPLPPIKYAAAAAAAVGGTVSASAPSQTTPSATSEGSRDDIVASPD
                     EIAAAPTSTSFPPPPPGLSRSPSQAATPQTSSPGTPGLQSHAPSTSTGAADMATPSQA
                     PGSAVPPPGYPAPPSSSSAESSRAAVQAQVAAEQAQAQAQAQAQAQAQALVQAQAQAQ
                     AQSQLSAAQIQAQLQAAQEVQGQAGVMGNLMQSFEVAKEISKRRSDDTNELHAALEDS
                     FANAPQQMDAEPPRYYHPQNPIKTPSYYPQSRLPILEDKSIYSRLELDQLFYIFYYMT
                     GTYEQWLAARELKKQSWRFHKQYLTWFQRAHNPQAITSDYEQGGYYYFDWENSWCQRR
                     KSDFRFEYRWLSDH"
     gene            1121255..1123461
                     /locus_tag="CNF03830"
                     /db_xref="GeneID:3258219"
     mRNA            join(1121255..1121345,1121398..1121469,1121527..1121596,
                     1121651..1121712,1121770..1121891,1121940..1122021,
                     1122068..1122454,1122503..1123018,1123067..1123329,
                     1123381..1123461)
                     /locus_tag="CNF03830"
                     /product="epsilon DNA polymerase, putative"
                     /transcript_id="XM_571676.2"
                     /db_xref="GeneID:3258219"
     CDS             join(1121313..1121345,1121398..1121469,1121527..1121596,
                     1121651..1121712,1121770..1121891,1121940..1122021,
                     1122068..1122454,1122503..1123018,1123067..1123329,
                     1123381..1123399)
                     /locus_tag="CNF03830"
                     /codon_start=1
                     /product="epsilon DNA polymerase, putative"
                     /protein_id="XP_571676.1"
                     /db_xref="GeneID:3258219"
                     /translation="MVNQMRSAIVKVFSTKHSLTLPAPALHYIEEVLIENEIPEDEWM
                     VGLEFWAKEYLKAEDSSSLVSLQALKKAYENLQLGTTEDTQVADPSEVNVESHFSVVD
                     SFDMPAMRYDPVRSGFVQSKAQPSVAGQASSRSAFLRERWAIIKEIILRNENFTPPAI
                     GGHDRANYLKLTSIRNLLGRAGQLFLLFGMLARNEEGKLCLEDGESRVVLDMEDAVPG
                     EGLFTEGCMVLIEGEYTVEETVRVLAMGHPPSERRNIARSLHGHVDFLGGGAVSLKEE
                     QKYNPTVLANTQISFVILSDVWLDHPRTMPALRQMFEGYANTAEYRPMVFVLCGNFCQ
                     GGWEGQEGLKRYSRGFNSLAELLQSIPLLHSSHFVFVPGPSDPWSSTTLPRPSLPSAF
                     TTRLSNRIPNARFVSNPCRLKYFGMEIVICREDLMGKMMRNLVVVKEGEEMNMKRYLV
                     QTILDQAHLSPLPISVRPTLWEYDHALRLYPMPSAVVLADKYERYELTYEGCHVFNPG
                     KFVGGIGEDGWEFEWSMYYPATGRSERSVLTME"
     gene            1123957..1125173
                     /locus_tag="CNF03840"
                     /db_xref="GeneID:3258082"
     mRNA            join(1123957..1124137,1124286..1124408,1124494..1124679,
                     1124732..1124856,1124910..1125173)
                     /locus_tag="CNF03840"
                     /product="40s ribosomal protein s15, putative"
                     /transcript_id="XM_024657445.1"
                     /db_xref="GeneID:3258082"
     CDS             join(1124135..1124137,1124286..1124408,1124494..1124679,
                     1124732..1124856,1124910..1124925)
                     /locus_tag="CNF03840"
                     /codon_start=1
                     /product="40s ribosomal protein s15, putative"
                     /protein_id="XP_024513135.1"
                     /db_xref="GeneID:3258082"
                     /translation="MAEFTSQEEAAAKKASRSFKKYQYRGVELENLLDLSNEEFINLV
                     HARARRRFQRGLKRRPMGLIKKLRKAKTEAGPNEKPAMVKTHLRDMIIVPEMIGSVVG
                     VYNGKTFTTVEVKPEMTGHYLGEFSITYKPVGHSRGANMKDSRFVPLK"
     gene            1126736..1126826
                     /locus_tag="CNF03850"
                     /db_xref="GeneID:3258421"
     tRNA            1126736..1126826
                     /locus_tag="CNF03850"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:3258421"
     gene            1127117..1129686
                     /locus_tag="CNF03860"
                     /db_xref="GeneID:3258165"
     mRNA            join(1127117..1127476,1127530..1127549,1127612..1128038,
                     1128097..1128137,1128190..1128199,1128258..1128455,
                     1128509..1128683,1128742..1128887,1128952..1129111,
                     1129160..1129409,1129469..1129686)
                     /locus_tag="CNF03860"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_571650.1"
                     /db_xref="GeneID:3258165"
     CDS             join(1127205..1127476,1127530..1127549,1127612..1128038,
                     1128097..1128137,1128190..1128199,1128258..1128455,
                     1128509..1128683,1128742..1128887,1128952..1129111,
                     1129160..1129409,1129469..1129581)
                     /locus_tag="CNF03860"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_571650.1"
                     /db_xref="GeneID:3258165"
                     /translation="MMLPRLPRRTVSAGSLAIVEGKGLFSFRPGAKLPRVFSTSIRQV
                     PRQEKSKFTIWARRLAILGAGGGVVYIYDKEVNASALTRSLRTGYIGILCTLDYKINF
                     APSKADEIEALHTRVANRLRWVIDINQGLYLKLGQALGLQAALLPKPYREAFGHVFDR
                     APAVSYDEVVGVFIKDLGVKPEDIFQEFSRDPFASASVAQVHKAILKPGVGDERPGKI
                     VAVKVQKPAIEKQMEWDLFSYRSLMWLSEKLFDMPMYFVAKYVSNQMRFETSFIHEAS
                     NARRCAEFLERTTELRGDVYVPRVYGKDEGCQESDRVMIMEWIDGCRLNDKEQLENWG
                     LNLREVMDLAISTMSAMTFSWGFVHCDPHPGNILVRPHPTKKGKPQIVLIDHGLYIEL
                     PQQFREDYCRLWRSLFVIDIPTIESIAKKWGIALDPNLFASAILLRPFQVRKDKSRPK
                     NDPKPTEEDKYQQQLELKRRLKTMLENERLIPRELIFLSRCQRMMQANNQILGSPSSR
                     INLTAKWASIGYTRSLTNSRSLHNVGLTMWLRDRWDTFVFRFTLSIVNIAFWLTTLRQ
                     KLIPREKGSWEDRIQAQFEAMAKEEFGIEIDDQVFLG"
     gene            complement(1129659..1132391)
                     /locus_tag="CNF03870"
                     /db_xref="GeneID:3258222"
     mRNA            complement(join(1129659..1130537,1130586..1131119,
                     1131176..1132240,1132295..1132391))
                     /locus_tag="CNF03870"
                     /product="myosin heavy chain, putative"
                     /transcript_id="XM_571342.2"
                     /db_xref="GeneID:3258222"
     CDS             complement(join(1129785..1130537,1130586..1131119,
                     1131176..1132240,1132295..1132354))
                     /locus_tag="CNF03870"
                     /codon_start=1
                     /product="myosin heavy chain, putative"
                     /protein_id="XP_571342.1"
                     /db_xref="GeneID:3258222"
                     /translation="MAEDKAKEERAKQAERARKLLAQRKKKKAVEAGTASEFQTPASV
                     DTPTFPSARTSLDDAQPESEKSKNADAKDQGVKPVDVKVETEVIEEETPQEADIKEKP
                     QLEARLEEAAVPNQETPDKPAPVEEERSAPEPPKESKKSKKKAAKKEKQEAAKAAEAE
                     AEAKVQEDAGSEKATEDVAQVEQTPAGSSQNETKETETSEGVKPAPEASSIEPKPQPQ
                     AQGTVKHTEETSNDSLANLQETVSLLLNERSELQSQLSSLRSELETAQGDTKLLEQGR
                     ELIKNLEGEKRSLEFQLNEVQEKAARIEGLERQVKSTENDLDEVKKAKKYLQEEKERL
                     ESELVAQRDAEKERVGKLEKAIERSREREGGLEAEIRRLRQNHNELSNNLSNLAADLD
                     SLRSSSALTESTLADLQAAHATLRSVHDQLSSDHSTLKDEHSRLYSKHSLLQDTHSST
                     NTTFKSLQDAHTSLQSELESIKSKLNNATKRADTAEKRKAALQNDNEELFKQLEEVRE
                     KVVQAMEEKAVLASEVEGWEMKGRGWENTKAEMEKDLEVKDAEATDLHDQMSSLAEEN
                     SSRAEQITSLSSQLSKAQEQIFSLQSSLLAAQAAAIPLPASPLASTSALSPPQENPDL
                     LSTAEAAHALEVSNLTAVIRSLEDGLYKREMRLHELERQIMNLSGRSGTYRSTSGSGS
                     GNGAKGYFFSPPDQEPSAPQSPTIALKPRLNPVDAILPHSVRHKRQVSLNALKARMEP
                     SMSLKGASPLRGSRTMGEIKEEVNMGDEGRRESMDSRIVGVRKQFGDEIMFCCPACDG
                     HLITL"
     gene            1132605..1134706
                     /locus_tag="CNF03880"
                     /db_xref="GeneID:3258269"
     mRNA            join(1132605..1133000,1133050..1133408,1133458..1133788,
                     1133838..1134137,1134195..1134706)
                     /locus_tag="CNF03880"
                     /product="import inner membrane translocase subunit tim44,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_571344.2"
                     /db_xref="GeneID:3258269"
     CDS             join(1132659..1133000,1133050..1133408,1133458..1133788,
                     1133838..1134137,1134195..1134227)
                     /locus_tag="CNF03880"
                     /codon_start=1
                     /product="import inner membrane translocase subunit tim44,
                     mitochondrial precursor, putative"
                     /protein_id="XP_571344.1"
                     /db_xref="GeneID:3258269"
                     /translation="MHSRPVFLRALRLRQQPLPARRFLPPQSLRPLSSTARLLDESKK
                     SEQQSQKKKSTNDEPITPRSPWAVFTQVLKEEIEKNKGWQDNVKQLQGDVDKFADSAA
                     MKRAKDVYEKTRLTNLIKNNPRIQSAVGDLQKAGISVHDAVQHALADSEVLKAISAAT
                     NRFVSAASSATAPIRDTKAYKLMAESLEEAFEDESGVGSRYGGYEEKEARRKKREMRA
                     KKAGRAAIKRVEENPEAGEALVLSDKPESVSRLAFIKESPTYQRMMENYYESDSPFVS
                     AIRTIGTKVGSLFEENETAQVIRAMKALDPNFRMDRWTGELREYIVPEVVDAYLSADR
                     ESLKAWCGEATFNVLWATMGQFIKQGLVSDSKILDIKHVDIAHGKMLENNIPVFVITF
                     ATQEQLLFRSAKTGKVVVGSEDDVEQCRYAMVITRLESELENELTGGWKVVEMARRGA
                     RGGL"
     gene            1134956..1137140
                     /locus_tag="CNF03890"
                     /db_xref="GeneID:3258029"
     mRNA            join(1134956..1136090,1136154..1137140)
                     /locus_tag="CNF03890"
                     /product="expressed protein"
                     /transcript_id="XM_571346.2"
                     /db_xref="GeneID:3258029"
     CDS             join(1135108..1136090,1136154..1136409)
                     /locus_tag="CNF03890"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571346.1"
                     /db_xref="GeneID:3258029"
                     /translation="MSCPCVSPTNPLPSGDIVTLSPFPPEVTELILHYLARRCCNSHF
                     TTILRLSRKVYETHVYQLYEEITLHDGNVEAVFAGMADAHDNQEPASLGGGIKQYTFS
                     KEWNDEDRFTVFPWFTGTMNQATGKISFFKCHPGAQKIMLLKQCNYLRIQTANALLRM
                     LEAVDSFSQEADTFGTHTIPAGPFEFISRPEPKLFQEMAGVSLGEELIRNLLEEPAQW
                     LPPLMALEDAWQSCGSLCLYIPNDLPDSVANEPFHSTYDLVEALRPFHLVMHNASIWN
                     TVYAYPVHNMTFDLVPASEENGIDDSKNREAEIESIVEWCKVLSRVTDTEEELYPTKL
                     TFANFGTIRSGETGEVRPLYAENGKLFRQTPAYQHYIKKIAEELQSNEEFAKWISVMV
                     SPPLLAGPYSCEVCARGRHL"
     gene            1137568..1139696
                     /locus_tag="CNF03900"
                     /db_xref="GeneID:3258063"
     mRNA            join(1137568..1137798,1137852..1138170,1138224..1138456,
                     1138506..1138743,1138793..1139035,1139208..1139696)
                     /locus_tag="CNF03900"
                     /product="aldehyde dehydrogenase (alddh), putative"
                     /transcript_id="XM_571348.2"
                     /db_xref="GeneID:3258063"
     CDS             join(1137674..1137798,1137852..1138170,1138224..1138456,
                     1138506..1138743,1138793..1139035,1139208..1139570)
                     /locus_tag="CNF03900"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (alddh), putative"
                     /protein_id="XP_571348.1"
                     /db_xref="GeneID:3258063"
                     /translation="MAPTFTHEFNHAGYKGKVEVPTGIFINGEWASSVDKNAKTIDVY
                     NPTTGEVLTKIPEALEADVNKAVEVAHNAFNNSWGLSVPGFKRGEYLIKIAELMERDL
                     DILASLEALDNGKTFGAAKGFDVIESARTFRYYGGWADKIHGKVIETSSSKLTYTLHE
                     PVGVCGQIIPWNFPLLMFSWKIAPALAAGNTVVIKPSELTPLTAMYMTKLFNEAGLPK
                     GVINVVVGYGQTVGNALAGHPAIDKVAFTGSTAVGRKVMEEASKSNIKKVTLELGGKS
                     ANIVFEDADFEEAVKYSAQGIFFNHGQTCCAGSRIYVQKPIYEKFVKAFKEQTSKLKV
                     GDPFDPNTYQGPQVSQIQAERIMSYVDHGKQEGATVITGGKRCGDKGYFIEPTVFGDV
                     TANMKIVKEEIFGPVVVVSPFETEEEALEHANDSVYGLASAVFTSNISRATRVASKLK
                     AGTVWINCYNELHPQVPFGGFKQSGLGRELGEYALENYTEIKAVQINVGAKCAIPT"
     gene            1140059..1142920
                     /locus_tag="CNF03910"
                     /db_xref="GeneID:3258099"
     mRNA            join(1140059..1140139,1140186..1140815,1140862..1141092,
                     1141147..1141752,1141807..1141941,1141993..1142088,
                     1142145..1142920)
                     /locus_tag="CNF03910"
                     /product="formin binding protein 3, putative"
                     /transcript_id="XM_571350.2"
                     /db_xref="GeneID:3258099"
     CDS             join(1140113..1140139,1140186..1140815,1140862..1141092,
                     1141147..1141752,1141807..1141941,1141993..1142088,
                     1142145..1142576)
                     /locus_tag="CNF03910"
                     /codon_start=1
                     /product="formin binding protein 3, putative"
                     /protein_id="XP_571350.1"
                     /db_xref="GeneID:3258099"
                     /translation="MSGEEKSLWSEYKNAQGRVYWSHAVTKQSVWEKPDELKTPFEKA
                     LSKTQWKQYASNNRPYYVNTVTKETKWDLPPELVELKKQIEEEEARKVERQRRKEQGI
                     ASPTPSPRESRSPTPEDIRELRASAANAIALYKPNTATPASVPETPLKPQNDDLPVIT
                     MPPGGFETKEESEAAFIHLLKKAGINETHTWDIAMRVIVLDPLYNALDTLAEKKAAFE
                     KYTNGILDERRAAKDARISRLRPIFYKMFAKSGVIKSYSTLKTADKAFERDRYWQEAF
                     PEERMLLLDEYTAKMRRDEESAERELRDRNIMSLTALLPTLDISVSTRWRAAHDLIIS
                     SPAFRSDKDLQKVEVLDMIKVYEDYAYKLEQEHKEESRKLKVEATRNARKAREGFKAL
                     LKELDHNGELTRTSKFKDTYPKIKNDERYIALLGLSGSSPLELWMDAVDDISEEVERA
                     AEKIHNALGKVDKKITLETSWEELEQWCREVHMDTQISEKLRKEVYNLTHSRLKQIAD
                     EEARRIERRKRRRIEDLRYALKKVDAIELDMSYEQALPHMKDLKEFKEIEEEEDRKSA
                     YEKFIKRQKEKLAEAESSKQDYRDRGESYRDSHRSGDRRHSKDDAMDVDDDVKSRRSD
                     REREQDRDRDHKSSRRDDRDRDRGDRRDRDRERERDKERDRSDRRERDRERERERKHG
                     GEQGEGREHKRRRLSSASSAAHRKDRDDEEIEEGEI"
     gene            complement(1142590..1145379)
                     /locus_tag="CNF03920"
                     /db_xref="GeneID:3258437"
     mRNA            complement(join(1142590..1142888,1142941..1143024,
                     1143071..1143642,1143695..1144672,1144722..1145019,
                     1145071..1145212,1145260..1145379))
                     /locus_tag="CNF03920"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_571352.2"
                     /db_xref="GeneID:3258437"
     CDS             complement(join(1142679..1142888,1142941..1143024,
                     1143071..1143642,1143695..1144672,1144722..1145019,
                     1145071..1145212,1145260..1145327))
                     /locus_tag="CNF03920"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_571352.1"
                     /db_xref="GeneID:3258437"
                     /translation="MSEPPAKRSKMDSTAASENNPYLAHRNEGPSYGGMTNGANGVTG
                     SIDRNEHPLNGMVPRKVTVDQAKKIMDGDVNPFKNLAPWSNTYKRILEQRKGLPVYQK
                     MQEFLTVFNENQIVVMEGQTGSGKTTQIPQFVCYSDLPMLRGKMVACTQPRRVAAMSV
                     AKRVADEMDVQLGKQVGYSIRFEDMTEPGTTFLKYMTDGMLLREAMNDPLLERYSTVI
                     LDEAHERTLATDILMGLLKDIAKRRSDLKIIVMSATLDVAKFQKYFGDTNPTGLAPVV
                     KVSGRTFPVETFFTQEPENDYVEAAIRTVLFIHQAEDEGDVLLFLTGEEEIEDACRKI
                     RAEGEELANKGMAGPLLVVPLYSSLPPHQQQRIFDPAPPARKDGLPGRKVVVSTNIAE
                     TSLTIDGIVYVVDPGFCKQKVYNPRIRVESLLVTPISKASAMQRAGRAGRTRPGKCFR
                     LYTERDFVKELEEQTHPEILRSNLANTVLELIKLGIKDLVHFDYMDAPAPETIMRALE
                     LLHYLAALDDDGNLTPLGSIMAEFPLDPQLAKMLIVSPEFGCSNEILSLTAMLSVPNV
                     FMRPASQRKEADLAKAQFTHPDGDHLTMLNVYHAYKSNEDDAKSWCWQNYLNQRSLAQ
                     ADNVRTQLKRAMEKFDLELCSTAWEDRNYWNNIRQALTCGFFMHVAHKEGEKGSYMTV
                     KDNQVVRLHLSCGLDTTPEWVIYNEFVLTTANFIRTVTEVRPEWLLEYAPQYFDPETF
                     PANSETRRALQRVLDRKLGKISSSKHGKDGKDKKDKKKKRKAE"
     gene            1145470..1147199
                     /locus_tag="CNF03930"
                     /db_xref="GeneID:3258051"
     mRNA            join(1145470..1145560,1145607..1145686,1145734..1146086,
                     1146133..1146894,1146951..1147199)
                     /locus_tag="CNF03930"
                     /product="glycogen metabolism-related protein, putative"
                     /transcript_id="XM_571680.2"
                     /db_xref="GeneID:3258051"
     CDS             join(1145542..1145560,1145607..1145686,1145734..1146086,
                     1146133..1146894,1146951..1147137)
                     /locus_tag="CNF03930"
                     /codon_start=1
                     /product="glycogen metabolism-related protein, putative"
                     /protein_id="XP_571680.1"
                     /db_xref="GeneID:3258051"
                     /translation="MAPSSQDISQFTAITQASEDEAVHWLESSGSLEAAVQDYLTAQD
                     AAGTAGAGDDLPGNEAPSLATTGGASGARTLSGAPVQDTVPAGWGQPQRSQFGRIQHN
                     DNDRGDDDKDPEELFAGGGKNSGLAVQNPDDAPGSGNSLVDKILKAASRNGAPPPRSN
                     EPAAPPGRSAFFGGAGNTLGSDETPSTSVASEQPSQSPGPSVQTGGMPGGFGGLGAIP
                     PGLMEQLMNQMSGRSGAPPSALSPGPSNIDHIDPSRISTDENGETVVHRSLTFWRNGF
                     SIEDGPLLAYDEPQNRHLLQALEEGRAPSAAFGVPFDQRVNVEVHQRRREDYVAPKKK
                     MKAFVGGGQRLGDAVPEVASGSASPMPGSLPTSSSNIGENTGRGTSGETKFEVDPSKP
                     TTNIQLRFGDGSRQVARVNLDHTIADLRSYVTAARSDSRPFVLQTTFPSKELSDMNET
                     VEGAKLQNAVVVQRFV"
     gene            complement(1147177..1148989)
                     /locus_tag="CNF03940"
                     /db_xref="GeneID:3258053"
     mRNA            complement(join(1147177..1147339,1147397..1148214,
                     1148386..1148835,1148877..1148989))
                     /locus_tag="CNF03940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571354.2"
                     /db_xref="GeneID:3258053"
     CDS             complement(join(1147244..1147339,1147397..1148214,
                     1148386..1148835,1148877..1148913))
                     /locus_tag="CNF03940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571354.1"
                     /db_xref="GeneID:3258053"
                     /translation="MSSRPDSVRGLYTPPAEEWVFLPPTVSPPPPTSSPPTHLPTPFN
                     ADDSQLEEALVLPLMGRPFNLFLSEYLTTAMGMPFEVGKTLLQIEYRPRRRFESLEVA
                     GQGVKVEGENFKEKFKEEDELSNPEEADMYFTDRLAQSSEPIVPATEQVLETDATGYF
                     PDLHPTWLLKDDPDVSRGNGVWGMIRRIRYTPSEGLPALWKSQLVSTLHSFLSTLLQP
                     SVHSFLQILTPYPPLSLDTPLTAFPNPSLPLGIQVASHLLTHLVLSPLEIIRTRLIVM
                     PVSHPSTPSSIAIFRDMINEEGGFINMYFHPNILFPALLEHTLRPLFALSTPLLLERY
                     LGISPDISPITYSLADLSLGLAHLLILLPIETVRRRLQLQSRAPGGGKRMKTVVKVRE
                     RDYVGIVEALWRIVTEETGVRRTRIEKGEEGGWFAGVRQLYRGFGMAATAHATVFGLG
                     LVSATLSGGDGGWKEI"
     gene            complement(1149467..1150859)
                     /locus_tag="CNF03950"
                     /db_xref="GeneID:3258084"
     mRNA            complement(join(1149467..1149813,1149872..1149997,
                     1150054..1150537,1150589..1150859))
                     /locus_tag="CNF03950"
                     /product="myo-inositol oxygenase"
                     /transcript_id="XM_571356.1"
                     /db_xref="GeneID:3258084"
     CDS             complement(join(1149707..1149813,1149872..1149997,
                     1150054..1150537,1150589..1150819))
                     /locus_tag="CNF03950"
                     /codon_start=1
                     /product="myo-inositol oxygenase"
                     /protein_id="XP_571356.1"
                     /db_xref="GeneID:3258084"
                     /translation="MHAPEINNHIKGEAVKLDKVSDEIDEVNVLKLKQKDAVEKTQAE
                     IDYDLASKFDQEKDKAAFRQYEEACDRVKNFYAEQHLKQTYEYNVKIRQEFRNTVRAR
                     MSIWEAMELLDNLVDESDPDTSVGQIEHLLQTAEAIRRDGKPEWMQLTGLIHDLGKLL
                     CFFGADGQWDVVGDTFVVGCQFSDKIIYPDTFKANPDYNNPKLNTKYGVYEPNCGLDN
                     VLLSWGHDEYMYEICKNQSTLPQEALAMIRYHSFYPWHREGAYQHLMNEKDHSQLKAV
                     KAFNPYDLYSKSDDPPKKEELKPYYQSIISKFFPAEVQW"
     gene            complement(1152538..1153489)
                     /locus_tag="CNF03960"
                     /db_xref="GeneID:3258164"
     mRNA            complement(join(1152538..1152793,1152845..1152948,
                     1153015..1153071,1153125..1153489))
                     /locus_tag="CNF03960"
                     /product="yippee-like, putative"
                     /transcript_id="XM_571689.2"
                     /db_xref="GeneID:3258164"
     CDS             complement(join(1152744..1152793,1152845..1152948,
                     1153015..1153071,1153125..1153216))
                     /locus_tag="CNF03960"
                     /codon_start=1
                     /product="yippee-like, putative"
                     /protein_id="XP_571689.1"
                     /db_xref="GeneID:3258164"
                     /translation="MRSTKTKLMPKKALQDELVSKAFNGRSGRAYLMNSTINTSLGKI
                     EERKLLTGTHTVADLLCASCKESLGWMYIKAPNGDQRYKEGRYILEAARIIKENKW"
     gene            1153636..1155245
                     /locus_tag="CNF03970"
                     /db_xref="GeneID:3258483"
     mRNA            join(1153636..1153907,1153960..1154026,1154094..1154330,
                     1154381..1154490,1154543..1154685,1154738..1155245)
                     /locus_tag="CNF03970"
                     /product="biotin synthase, putative"
                     /transcript_id="XM_571682.2"
                     /db_xref="GeneID:3258483"
     CDS             join(1153686..1153907,1153960..1154026,1154094..1154330,
                     1154381..1154490,1154543..1154685,1154738..1155125)
                     /locus_tag="CNF03970"
                     /codon_start=1
                     /product="biotin synthase, putative"
                     /protein_id="XP_571682.1"
                     /db_xref="GeneID:3258483"
                     /translation="MSFARSLRPVLRSTAPTASRGHAVAVDAPFLPPSPSVQQSEKRR
                     YVDGDVRHDWRRSEIQKVFDAPLMEIIYRAATVHRLHQDASRIQLCTLMNIKTGGCTE
                     NCKYCSQSSSYKTPTKASRLVSIEPVLEAARQAKANGSTRFCMGAAWRDLAGRKSGFE
                     KILEMVKEVRGMGMEVCTTLGMLSPEQAIRLKEAGLSAYNHNLDTSREFYPEVVTSRS
                     YDDRLSTIAAVREAGISVCSGGILGLGERDEDRVGLIHEVSRMPEHPESFPVNTLVPI
                     PGTPLEGNEPVKVHTVLRTIATARIVLPKTIIRLAAGRHEFSETEQAMAFMAGANAIF
                     TGEKMLTTPCSGWDEDKAMLDRWGLRGQRSFEDKESLEVPLKADQVETGASAVI"
     gene            complement(1155159..1156711)
                     /locus_tag="CNF03980"
                     /pseudo
                     /db_xref="GeneID:3258424"
     gene            1155247..1157193
                     /locus_tag="CNF03985"
                     /db_xref="GeneID:36392915"
     mRNA            1155247..1157193
                     /locus_tag="CNF03985"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658586.1"
                     /db_xref="GeneID:36392915"
     CDS             1155741..1156667
                     /locus_tag="CNF03985"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514512.1"
                     /db_xref="GeneID:36392915"
                     /translation="MFRQLRRAFSHHREDSWQLPAGWEIDPSRSNTHLSSTNASRYRL
                     SFDDRASAEIESVASVFGNACTFTDPYFDRIGDDGRAYLQDLSILYVADSSAGEFRSA
                     VQNLVRRQLEAQWWILRRNVDEERSDAGMSRYGSVMESDVGEEQTVESMGDTLPSQIW
                     QSTFSHDGPLSETSSGMTDEPPPPYRSQELSEDLRRSSPIYPQLQSQFENESYQRWGS
                     TPTYHSFGYPLPIHTPHHLSIQPAQPLSPAALYESSYHSSLTDSTRSHSFVGGHPGTR
                     HSEALAAPSSSLISHPEEGATGHGLASNLIDP"
     gene            complement(1157168..1160090)
                     /locus_tag="CNF03990"
                     /db_xref="GeneID:3258485"
     mRNA            complement(join(1157168..1157626,1157679..1157810,
                     1157867..1158149,1158201..1158248,1158294..1158442,
                     1158497..1158910,1158956..1159057,1159106..1159225,
                     1159279..1159380,1159431..1159573,1159633..1159714,
                     1159766..1159824,1159899..1160090))
                     /locus_tag="CNF03990"
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /transcript_id="XM_024657446.1"
                     /db_xref="GeneID:3258485"
     CDS             complement(join(1157243..1157626,1157679..1157810,
                     1157867..1158149,1158201..1158248,1158294..1158442,
                     1158497..1158910,1158956..1159057,1159106..1159225,
                     1159279..1159380,1159431..1159573,1159633..1159714,
                     1159766..1159824,1159899..1159941))
                     /locus_tag="CNF03990"
                     /codon_start=1
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /protein_id="XP_024513038.1"
                     /db_xref="GeneID:3258485"
                     /translation="MPRRDLVRIVLVGDDGVGKSSIITSLIKEAFVTNVPHVVPEVTI
                     PPEITPENFTTSIVDTSSNPRSRPHLLSSISRAHVICLVYSIADPSSFDRVAEYWLPL
                     FRREGINVPVILVGNKIDLRGGRVTNQGLEDESAPIMREFKEVETVVECSALLPLNVS
                     EVFYFAQKAVLHPTAPLYDSREHTLKPKCLEALKRIFTISDVDKDGLLNAHELNQFQQ
                     KCFSTPLQSQELDGILEIVRSYDPYAVQPLPSSSPNTPLSRDSSYGQLHYFNNNVVPP
                     SPPQEGITELGFLYLHTMFIQQGRMETTWTVLRKFGYGESLDLREDFLAPKFDVPSDC
                     SVELSPLGNQFLTDIFEAYDKDQDGALSQNELDDLFSTSPGNPWLSQGFPDTTITDDM
                     GRVTLQGWLAQWSMTTLLNHRTTLNYLAYLGYSSSPATDLPTPTALHVTRPRKQDRRQ
                     RKVTRNVFLCYVLGATGSGKTSLLRSFVNRPFKGGEDGLGGYEPTTKVLSVVNSVEME
                     GVEKYLVLQEFGSKYESEILRNSKRLDMADIIIYVHDSSDTNSFSYISNLRQQYSLDH
                     IPSIFVATKSDLDLAQQRHEVQPDVYCRRLGLQAPMAVSSRLGPLHNLWVAITRVALD
                     PTSSLPRGPRSQMSPAQRIRVVARWGLAATTISAIVAVWMKWQGYSFKGIWGWMAKFA
                     GLRT"
     gene            1160209..1162367
                     /locus_tag="CNF04000"
                     /db_xref="GeneID:3258507"
     mRNA            join(1160209..1160354,1160409..1160520,1160574..1160677,
                     1160723..1161094,1161143..1161667,1161714..1162002,
                     1162057..1162367)
                     /locus_tag="CNF04000"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_571360.1"
                     /db_xref="GeneID:3258507"
     CDS             join(1160241..1160354,1160409..1160520,1160574..1160677,
                     1160723..1161094,1161143..1161667,1161714..1162002,
                     1162057..1162241)
                     /locus_tag="CNF04000"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_571360.1"
                     /db_xref="GeneID:3258507"
                     /translation="MDPNAEDRPKSVQVAEVDIESPEKPQPERAPRTDFGRTENPIVP
                     PPIQAPLASSIFRQALGTERPPPIGPALATEPITEDPEKVRQWQEEEFQRRLRGEYEQ
                     AQRRVGEVVTSNMERPLRLTSIRLAPPPPTTRSSFTSALLSPFLSKPHPNVPSWLHPA
                     PPPPTTLHQILLTTRALVQHVDKFGVYDMDHSGVRLEPRRGGDPDEVELVLALREKGR
                     LFLKAGTEIGGGEGGGNVTARIRNVFGGAETLEGTASLGTKTKSAYQVSLSTPLFASP
                     LLSFALSAFSLDRDNSAFASHRERAQGGRAKLSAITPWGTHDLQYELVDREIDRLTRN
                     ASVSIRELAVPSTKSSISHTWTSDTRDDPWMGTSGRLLKMTHEYAGLPGSSKFAHFFK
                     SITQSQLSRELLPGSGIHYSIASLTTLLYPLFPHSPTSPSTTYLPDRTFLGGPNSIRG
                     WKVGGVGRRDGPDSLGGDMSWALGLSVFAPIPKKEHWPLKLHAFLNGGKVVAYDTSRG
                     FAENIAKMYSTPNLSVGLGLVYRLEPLRVELNFAMPLIGRKGERMARGFGVGVGIEFL
                     "
     gene            complement(1162846..1163908)
                     /locus_tag="CNF04005"
                     /db_xref="GeneID:36392916"
     mRNA            complement(join(1162846..1163499,1163552..1163908))
                     /locus_tag="CNF04005"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658587.1"
                     /db_xref="GeneID:36392916"
     CDS             complement(join(1162924..1163499,1163552..1163659))
                     /locus_tag="CNF04005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514513.1"
                     /db_xref="GeneID:36392916"
                     /translation="MTHNAAEEKKTVQTRLYKSIDDSIGEASYRYEKFIKDQYAPNTN
                     LIPGRIFTGITNLDQLYNARELILNAGTAIEILFFACIPSNVSSTYSVILNERIPWDK
                     LPNLRYLSITAPLFRKGPSGFEPYEIYLHEPGQEFRGLDHLELVLTCDMCSNKDIMSF
                     IDDYGYTLVEQIGQNLFKGKRQKKPLILFVPGHNIERSSWGYKYLKEPTLAIQQHIDN
                     WFAVSGMIE"
     gene            complement(1164488..1164559)
                     /locus_tag="CNF04010"
                     /db_xref="GeneID:3258263"
     tRNA            complement(1164488..1164559)
                     /locus_tag="CNF04010"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3258263"
     gene            1164709..1167922
                     /locus_tag="CNF04020"
                     /db_xref="GeneID:3258081"
     mRNA            join(1164709..1165075,1165128..1165170,1165226..1165246,
                     1165312..1165471,1165532..1165685,1165743..1165838,
                     1165896..1165904,1165981..1166060,1166109..1166566,
                     1166616..1166653,1166704..1167009,1167064..1167184,
                     1167233..1167612,1167663..1167922)
                     /locus_tag="CNF04020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571363.1"
                     /db_xref="GeneID:3258081"
     CDS             join(1164779..1165075,1165128..1165170,1165226..1165246,
                     1165312..1165471,1165532..1165685,1165743..1165838,
                     1165896..1165904,1165981..1166060,1166109..1166566,
                     1166616..1166653,1166704..1167009,1167064..1167184,
                     1167233..1167612,1167663..1167866)
                     /locus_tag="CNF04020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571363.1"
                     /db_xref="GeneID:3258081"
                     /translation="MIHQQPVMRTIPLLCFNDVYRVNQKYNPQPGAPEDNSPDRTITV
                     SQFAELLLSERSKWADRQSEDQDDQEGPSKEGLVLFAGDVFNPSVESSVTRGSHMVPI
                     MNALKVDYACVGNHDFDFGFPHLTKLVESTSFPWLLSNIVDTNTGRQPEPLKRFIVTE
                     RCGVKIGLIGLVEKDWIATIPSWPHNFRYRSMKDTALELSRELRDPNGEHQVDIIIAL
                     THCRVPNDIRLAIELGAVADKPGVENEHGIDLIVGGHDHIYYIGKGATSWEGYAGRKD
                     VPGTTEDHGVRLIKSGTDFRDLTSANLTVTPTPLGSIRRQLITSLTGKHLYVLPSSPS
                     SPPFEELVKSLLSSVSEALTKPVCFTLTPFDARSEVVRTQESGLGNWIADVLMHAYAE
                     SIVQAKGKEGGLGEEFEGDADAAILCGGTLRGDSQYGPGKISLGDILEILPFEDPVVC
                     IELDGKGIWNALESALSKWPAQEGRFPIVSGLAVKWDHTRPPGQRILSIHQIAQPKKD
                     DDDWEDPADMVDFKEQEDGTTVVVKQKKLQLGEEVKNEEGGRMYKVITRDYMAQGYDG
                     FEALKNRNFIVDDENGQIMSSILRSFLLGSSYIFRHKQLEEAAHSHLSRRTSQVLLRA
                     RAEHTSQSQSSPSASLSSSPKRNLLVTQFKSSQDRMTSPNHLTSASLPSNALSPNSEI
                     SESSAWGRLRRHVVQHDWGTIRNALHVAKHEHMSGLDVLAGQAMRQARNHMPGAWSPV
                     QTPPTQEMPEYDGIVLPKDEDGETNLADLAIVSPLVDGRMRDISADKR"
     gene            complement(1167929..1170038)
                     /locus_tag="CNF04030"
                     /db_xref="GeneID:3258104"
     mRNA            complement(join(1167929..1169240,1169291..1169590,
                     1169644..1169782,1169837..1169949,1170002..1170038))
                     /locus_tag="CNF04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_571365.1"
                     /db_xref="GeneID:3258104"
     CDS             complement(join(1168005..1169240,1169291..1169590,
                     1169644..1169782,1169837..1169949,1170002..1170010))
                     /locus_tag="CNF04030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571365.1"
                     /db_xref="GeneID:3258104"
                     /translation="MDQNAFRSLLSAPRADGSSSSRGVLGAPPPKRGWGLKAKEGYEK
                     KEEPPKEKESRPAFAPRQQMKKDSKYKDRADLRRKGADDEFKSVEKLLEDFEARKANA
                     TAEELEAIEKQRAYLGGDAEHSVLVKGLDYALLAARKAELAREEAEDMDEELEELGRG
                     LKGKKNAGAKEDVVEEEKAKQETLGRGFKSIAQKKAEAKAAVDEKKKKKKKKKAKVEN
                     IDAPAPAASQDIDMPKDTGTTKPVEETQPVTKSAPPPPPESDEDEDIFGDVGEYDLRA
                     AAGPESDSDDEDEAMSVDTKESHREGMVSRGRSRSRSFSRDGPYSRDRSLSRNHGYGK
                     GLGPRSPGRRHSPGKRTRSRSREYRYLSRSRSRSREYSGRRYTRSPSYDRYDRRRSVS
                     PYRRRSPSPYRQRRRSPYSRSRSPVYKEDYKRRRTAYDRSSSPRRRYASRSRSPPRHR
                     HPPSPSPKSRSISRSPPAPVRERSRTRSLSPILNYSYPPLSPSRSPSPSSDEGTAAGT
                     RLQPLASSAIPSLKTFLAAQDAASKEAEKKAKKAKWRAQQGLPAQEGDEGDFKSSKGK
                     DMNEKQKANRDYQLLMNKMNKEKQGEKSGNKG"
     gene            complement(1170217..1171358)
                     /locus_tag="CNF04035"
                     /db_xref="GeneID:36392917"
     mRNA            complement(join(1170217..1170557,1170601..1170784,
                     1170836..1171218,1171294..1171358))
                     /locus_tag="CNF04035"
                     /product="tRNA-Lys"
                     /transcript_id="XM_024658588.1"
                     /db_xref="GeneID:36392917"
     gene            complement(1170329..1170436)
                     /locus_tag="CNF04040"
                     /db_xref="GeneID:3258422"
     tRNA            complement(1170329..1170436)
                     /locus_tag="CNF04040"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:3258422"
     CDS             complement(join(1170774..1170784,1170836..1171218,
                     1171294..1171325))
                     /locus_tag="CNF04035"
                     /codon_start=1
                     /product="tRNA-Lys"
                     /protein_id="XP_024514514.1"
                     /db_xref="GeneID:36392917"
                     /translation="MGSQSSKPPYEPAPLDSKAPTPVQKPQPIPPKKRKKAKPRNYDK
                     ELYILASYRPPSYSPPESTLTKPMGWENTNLLPSERLRRQLEEMEGEIMAKRRMKEYQ
                     ARIGPGNGRQKAVRKEERAKKRDDNNELPGYDVAITKQT"
     gene            complement(1171865..1174261)
                     /locus_tag="CNF04050"
                     /db_xref="GeneID:3258129"
     mRNA            complement(join(1171865..1172255,1172311..1172400,
                     1172457..1172753,1172810..1172929,1173041..1173140,
                     1173191..1173302,1173353..1173415,1173660..1173990,
                     1174061..1174261))
                     /locus_tag="CNF04050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571378.1"
                     /db_xref="GeneID:3258129"
     CDS             complement(join(1172151..1172255,1172311..1172400,
                     1172457..1172753,1172810..1172929,1173041..1173140,
                     1173191..1173302,1173353..1173415,1173660..1173894))
                     /locus_tag="CNF04050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571378.1"
                     /db_xref="GeneID:3258129"
                     /translation="MSTTQSTSRLPASRPDSTIQTPALSPSNSAGPSPALSVLQSPAV
                     SEFDLENPFDKIGYEDDEAVMPECWGHRGASASFPENTIASFVEACKTGADGIETDIH
                     VTTDNVLVMFHDPELHRTTDGEGRIDKLPWKGVLEHVRTLEKPHQPIPQFTQVIDLLL
                     QPENSRIKINLDLKVENDPVRLFGLIKSVVEGYEGWQKKLAPRIVLGIWHPKFIVPAT
                     TILPYLPRYAISMDISQCRKYFFNICHGFSIRYEALATSEGARFRQECKAAGKKICSW
                     TVNDPEEMRQCARWGIASVISDKPALWKKIRLDIETDRAKALKPTLQSYISPFFQKKN
                     WWFDYQRLAKEETEYLEREAGTFDIPVPHVEMHIAAPGY"
     gene            complement(1175337..1177117)
                     /locus_tag="CNF04060"
                     /db_xref="GeneID:3258394"
     mRNA            complement(join(1175337..1175577,1175633..1176036,
                     1176100..1176351,1176403..1176434,1176488..1176516,
                     1176566..1176612,1176667..1177117))
                     /locus_tag="CNF04060"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_571379.2"
                     /db_xref="GeneID:3258394"
     CDS             complement(join(1175416..1175577,1175633..1176036,
                     1176100..1176351,1176403..1176434,1176488..1176516,
                     1176566..1176612,1176667..1177078))
                     /locus_tag="CNF04060"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_571379.1"
                     /db_xref="GeneID:3258394"
                     /translation="MEVNKEEALRALSIAQKHRSASNLPSALKFARKSVALFSTPEGE
                     AMITIIEREIESGGSASGSGASSGTSTANGNTPSSKGKASGIEEHVTSAYSRHGTKTE
                     ADDGKSKKREYTTKQLEVVKRVKACKHHQYYEILSVEKTCTENDVKKAYKKLALALHP
                     DKNGAPGADEAFKMVSKAFQVLSDSNLRAAYDSNPDYDPTQRNAGMPSRSSGMGGMGG
                     MHPGFGGAYQQEINPEDLFNMFFGGGGGGFGNSPFGGANVFTFGGPGGFRTYQAGPRR
                     PRQAADGDGNALTALLPILLVLVFSIITILPSILSTAGTPDPSYSFEPSTNLETGRES
                     FNWKVPYFVNKQEWEKSEIWKSVPEARRGTGSEALYSSKVRQFEKGVEGHYVRRLQNE
                     CAMFNDRRGKLIADNSGFFGFGANAEKIAELRKMKNPACEQLRSWGIGQGQVW"
     gene            1177279..1178317
                     /locus_tag="CNF04070"
                     /db_xref="GeneID:3258397"
     mRNA            join(1177279..1177670,1177727..1177977,1178036..1178317)
                     /locus_tag="CNF04070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571684.2"
                     /db_xref="GeneID:3258397"
     CDS             join(1177306..1177670,1177727..1177977,1178036..1178196)
                     /locus_tag="CNF04070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571684.1"
                     /db_xref="GeneID:3258397"
                     /translation="MAIQTVFLNFPSPLSSLQLQLPSTTLISSLPVPPTLASSSYLRT
                     ASSGPLSLSTPLSDLIHENAPSHPITLHVIPRMLGGKGGFGSQLRAAGGRMSSGKATN
                     VDSCRDLSGRRLGTIKEAQRQAELLESEPALRAQAQAAEKAKLEALERKLGINAAESS
                     EDGSKRKIEDVDLAELARKKHKFEDNKFLEESREINDNVRSAVSAALLLKKKKKAKSA
                     GNEKGKEKAVVDEKTEQAKKAEKDRLDMPPPVAAGAATTA"
     gene            1179304..1183522
                     /locus_tag="CNF04080"
                     /db_xref="GeneID:3258149"
     mRNA            join(1179304..1179637,1179690..1179775,1179826..1179957,
                     1180012..1181077,1181132..1181706,1181761..1182566,
                     1182623..1182851,1182918..1183236,1183313..1183326,
                     1183388..1183522)
                     /locus_tag="CNF04080"
                     /product="DNA-directed RNA polymerase i polypeptide 2,
                     putative"
                     /transcript_id="XM_571380.2"
                     /db_xref="GeneID:3258149"
     CDS             join(1179337..1179637,1179690..1179775,1179826..1179957,
                     1180012..1181077,1181132..1181706,1181761..1182566,
                     1182623..1182851,1182918..1183236,1183313..1183326,
                     1183388..1183441)
                     /locus_tag="CNF04080"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase i polypeptide 2,
                     putative"
                     /protein_id="XP_571380.1"
                     /db_xref="GeneID:3258149"
                     /translation="MVAAFDPLAPSQASSSTSPDNTTFHTLTRERQFRHPPVNASDVP
                     ALDELVAPHIKSFNALIEDEGNPGAKGLLQMGVEDIGEKVVFDGKGSEGGLGTKLSYR
                     IDRVALSKPLVPEKDKLAVERRVFPTEARERLATYRSKLTVNIKWTVTDEDGNRKEFE
                     EIKECGLLPVMVRSIRCNLQGLPATELIKHSEESTSFGGYFIVNGNEKIIRYLVVPRR
                     HNPINLYRPSFAKRGASYTPYGCQIRCVRPDETACTNTIHYLSNGGATLRFAWRKVEY
                     MIPLMLILKALVDASDKEIFEGLIQGEYDNTFLTDRVELLLRGQKSWGLHTGAQCLDY
                     LGEKFRVVLNVPDDWSNVQVGGYLLRKVVLVHLPAPRDKFRMLLFMLRKLYSQVSGAT
                     CPDNPDSPQHHEVLLPGFLYGMIIKERFDDCLNAVKSQIQLDLRDGKARSFMDPKYFT
                     SVLSKTNWDIGSKLSYFLATGNLVSPTGLDLQQTSGFTIVAEKLNFYRYLSHFRCIHR
                     GAFFAELKTTTVRKLMPESWGFLCPVHTPDGSPCGLLNHLSHTCQIVTSSLDVSHIPA
                     LLSAQGMTQVFASSIDGRRMVCIQLDGKVIGYASPMKAKQLANRLRKLKTEADSKVPL
                     DLEIGYVPVTKGGQYPGLYLFASRSRMMRPVTYLENGKLDHLGSFEQVYMDVAITKEE
                     IEKGVSSHVELDPTSMLSVIANMTPFSDFNQSPRNMYQCQMGKQSMGTPSTAISKRTD
                     NKMYRLQSGQTPVVRPDLHNQYGFDNFPNGTNAIVAVISYTGYDMEDAMILNKSAHER
                     GFGYGTVYKADIFDLKGVPGASRSAKPTLHFGLGRDVKEDHDARNIISQDGLPIIGTR
                     VKAGDPLCAYIDDTTGRTKFHKYKGDETAFIDEVRVLGSDAGDAELQKIHIKLRIPRS
                     PVIGDKFSSRHGQKGVCSQKFPAIDMPFSESGMQPDVIINPHAFPSRMTIGMFVESMA
                     GKAGALHGLAQDATPFKFSDKDRPVDYFGEQLRAAGYNYYGNEPMYSGITGEEFHADI
                     YLGLVYYQRLRHMVNDKFQVRTTGPVDPLTRQPVKGRKRAGGIRFGEMERDALIAHGT
                     SFLLQDRLMNCSDYSTAWVCRNCGSLVSLGFEEVGGAQGMQEYCRICDGHKHEHAEEM
                     SKENGVGVVMRGGEKKGRMDVVPVPYVFRYLCAEMACMGIKLNVTVT"
     gene            1184071..1186861
                     /locus_tag="CNF04090"
                     /db_xref="GeneID:3258310"
     mRNA            join(1184071..1184777,1184841..1185059,1185114..1185151,
                     1185205..1185277,1185345..1185464,1185516..1185578,
                     1185650..1185842,1185909..1186053,1186112..1186372,
                     1186442..1186550,1186613..1186861)
                     /locus_tag="CNF04090"
                     /product="MSF transporter, putative"
                     /transcript_id="XM_571381.2"
                     /db_xref="GeneID:3258310"
     CDS             join(1184340..1184777,1184841..1185059,1185114..1185151,
                     1185205..1185277,1185345..1185464,1185516..1185578,
                     1185650..1185842,1185909..1186053,1186112..1186372,
                     1186442..1186550,1186613..1186759)
                     /locus_tag="CNF04090"
                     /codon_start=1
                     /product="MSF transporter, putative"
                     /protein_id="XP_571381.1"
                     /db_xref="GeneID:3258310"
                     /translation="MSQKTSSSITIHSSEGSTAANTPMELADPLKTGSKMTPDFEKEQ
                     SSPSSQPSSPSTPQSTVSNRLVPLYRSATDRRSRAHSNSLSRRTSGQTAELQNELRRH
                     VSLHGVATNCGSESVMEARKRLDMGGEKGHEEVVVIDWLPNDPDNPVNYSSPRKYIIL
                     TAANIAGFIAASNLASCAVLGTWGVPYYEISREVWVLSITLPMIALAVAPLILAPLSE
                     SLGRNMVYQVTSVITAVLFVPQIWNNKNVGGFLVSRFFQGIGMSVSNSMVGGTVADLF
                     SPTDRGFPMSLFTLSIFCGQGLGVCFIGWSGQGLSLQWAYGVQAIIATASIIFNIFFM
                     RETRADVLLSWRAKKMTKETGIKHIAAADLEKTDMLTLIKVSLIRPLQYLVTEPIVSA
                     LSAWIGFAWACIFLSQSSILLVFESYGFNAAQAGSFQASMAIGAVLGLISQNHQEYLY
                     RRSCAKHNGKAPPEVRLYWAAYGGLLFPFALYVYAWTGQAGVVHWAVPGVALVFMNWG
                     VFAMYSGVFTYLADAYEIYSSSAQAAQSFCRNMASGIFPLFAHQLYVNLGYPEASTLV
                     ASIALFLSAAPILLVFYGKKLRAQSKVTSQLLKDE"
     gene            1188055..1189532
                     /locus_tag="CNF04100"
                     /db_xref="GeneID:3258216"
     mRNA            join(1188055..1188177,1188238..1188284,1188351..1188669,
                     1188732..1189262,1189303..1189532)
                     /locus_tag="CNF04100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657447.1"
                     /db_xref="GeneID:3258216"
     CDS             join(1188258..1188284,1188351..1188669,1188732..1189262,
                     1189303..1189520)
                     /locus_tag="CNF04100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513153.1"
                     /db_xref="GeneID:3258216"
                     /translation="MGFPMHLTKAARKALDDLLIPSHSTKLLVLRQKIPILHDGLTVL
                     SYSGKMVYRMVRDVRGWGMVERADLISILKEGAGEVEWDIEALVGEPGMERGIEVCLK
                     GKKEEVVRPDLIVGADGMFSAIRHCLYSDSQMVEDKLPGGFSKLPQTIINLRTTSPAM
                     RRWVHDPNGMNLLYGESFSATMMPLSFPSIYVALTIPSQWLNPSSQVRMKGEEIKLEP
                     TVHGKFLRQLERDPGWEKKETYPLWSATSTVGGKGRVVLVGDAAHGMPPFCGAGASAG
                     VIDAVELAKVIVDHLNDPVNNLDDVLRGFRESMKKRNDPIIRQSKRILWLVQAERWYE
                     NAIRRAVFFILDLGERISAQRGRKVAAARP"
     gene            complement(1190114..1192145)
                     /locus_tag="CNF04110"
                     /db_xref="GeneID:3258449"
     mRNA            complement(join(1190114..1190510,1190575..1190682,
                     1190739..1192145))
                     /locus_tag="CNF04110"
                     /product="expressed protein"
                     /transcript_id="XM_571382.2"
                     /db_xref="GeneID:3258449"
     CDS             complement(join(1190340..1190510,1190575..1190682,
                     1190739..1192100))
                     /locus_tag="CNF04110"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571382.1"
                     /db_xref="GeneID:3258449"
                     /translation="MSTPTSNKRVRLHWDPESYPSSERLKAELNHDYAHKIPYHLVSA
                     PLTPSTSTVACSSSPRRAQHSLSSSSPTRKSNASLTAPHQLNLDLGKTFIFGRHHVRD
                     ASRPKPSITIESAVPRKLNHLVANPSNNVESIILSREAHHASRVHALVELILPLSQTR
                     EKVMRIIAIGQNGMRVRLPQQAFTAGPKNKSTKKGVRLVQGQRYDVPVRAGDQVELDF
                     YGDKAVIAMLVDRAQSPEKSPLNQILFPSSPVSRPALSSSMPPSSPPIIRDELEDEED
                     KPPRQAGSDEEDEHPFAQHLASPSRSPLFAAQSCLDIDAQSARSRESSPLSPISNHSA
                     LSDAEPEPEVEASFRASALPARPSSPIHPSSPSYDRDSEPDDIQVKTERLENLPLSRS
                     HSRKSTPARAGSTAATAAPTVPTAEIKGPPADVDRPAVIASTVVFSGSSKLSLPDLVK
                     HMLEAQPHLKAHGDEDMWAIWVGEELESNPMFGKVERHGKDSAGHPLLPHYFYNPSAD
                     PDTQRASDLGGLVRPLRTAARGGQAIDWRPVGRRKRVW"
     gene            complement(1192578..1195845)
                     /locus_tag="CNF04120"
                     /db_xref="GeneID:3258121"
     mRNA            complement(join(1192578..1192846,1192911..1193020,
                     1193078..1194397,1194461..1195694,1195783..1195845))
                     /locus_tag="CNF04120"
                     /product="expressed protein"
                     /transcript_id="XM_571686.1"
                     /db_xref="GeneID:3258121"
     CDS             complement(join(1193481..1194397,1194461..1194662))
                     /locus_tag="CNF04120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571686.1"
                     /db_xref="GeneID:3258121"
                     /translation="MGPTFPVTLMPKKGRWVLSRASLPTFRWRFADEPAGSVLYKFLL
                     PFAIELMAGRTYGLRIKTPKYPEGRLVYIDLGLVCCDRPLACALTGAPHYKGDSSPCF
                     RCLISKKDLLDNCTHPTRSYELQTASVRGKVASYLAGLRHHDENSTQNVFHVDRRSGA
                     RTNMEVNGTKSLWKKTFPNGEHLSVLDLFPWFNRAVRTVVDSMHAVLEGVLKTYWYKV
                     LCQGMYSGGEKGSVNELADVVTGESKDENREVDPNNEPEKSTKKRKERSQDVSPNRQK
                     KRSRKVKWAFKSGKPVLTTKEIDWFKARIPLVYKPTSLENLSSGFGTKGNGKVKASQW
                     RVFGEIYGPLIVPFFFEFIEPSLGGRTAEEGLRGLQMS"
     gene            complement(1197158..1202779)
                     /locus_tag="CNF04130"
                     /db_xref="GeneID:3258454"
     mRNA            complement(join(1197158..1197433,1197501..1197597,
                     1197654..1197887,1197944..1198128,1198179..1198277,
                     1198331..1198550,1198609..1198741,1198797..1199071,
                     1199125..1199292,1199352..1199498,1199546..1199873,
                     1199922..1200166,1200218..1200790,1200838..1201217,
                     1201265..1202287,1202342..1202552,1202638..1202779))
                     /locus_tag="CNF04130"
                     /product="DNA polymerase alpha catalytic subunit,
                     putative"
                     /transcript_id="XM_024657448.1"
                     /db_xref="GeneID:3258454"
     CDS             complement(join(1197291..1197433,1197501..1197597,
                     1197654..1197887,1197944..1198128,1198179..1198277,
                     1198331..1198550,1198609..1198741,1198797..1199071,
                     1199125..1199292,1199352..1199498,1199546..1199873,
                     1199922..1200166,1200218..1200790,1200838..1201217,
                     1201265..1202287,1202342..1202552,1202638..1202706))
                     /locus_tag="CNF04130"
                     /codon_start=1
                     /product="DNA polymerase alpha catalytic subunit,
                     putative"
                     /protein_id="XP_024513042.1"
                     /db_xref="GeneID:3258454"
                     /translation="MSKDALKTLLECRAKGGRLSLWKPEETKIYDSVTDEQYRSIVGS
                     RNDQDDFIEDDDGGDYVDHGLEDWDGAERDDEESEDEDDFEGEDEELRKARKLKRAKA
                     KAKALASSGKAPKSLKPKPKASYSDYSRRSTSSTYRAAAIPSAIQEDDFMANLLSSVT
                     AASNETASRKRKSSPEIPSSDGYQAPSSDSSFFSSRKRYGGDSDDEPVWDAKRGVMGK
                     KPRVSDATITPRGMSRDRDQENEYSFDDTMDVEDVAVKPELVDSEEEEEIQVRKTRPL
                     TATNKLNGAAGAKRKVINSTSVKNVIKREPSPVLAIAPEAAPEIEEIQSVKPRTNGKP
                     KVKANAKHWSAIQESLAASSSNQTSELDTVSAPVGSTKPENVMEKDGSLRFFWLDHLE
                     QDGIVHLVGKVLDKQTGKYVSACVSVTGIERCLYVKPRAKRFARGFETDLDVSEEDVL
                     DEFENFRSQVGIDQYRCKFVKRKYAFEDKDVEKGESDWLEVVYGFDRESCVRVYRLVL
                     NKIEPAIPMDSNGATFSHIFGTNTTPFELFVVNQKIMGPSWLEIKDIAPVEKASSWCK
                     LEFYVTDPSEVNPFSETDPSAPKDTPPFTIMSISLRTIVNHRENKTEILSVSMRTWDN
                     YNIEDPTPPDQLRSQLNTIVRPIERFPSGLESKARSEKSQFQTVKTERALLNSMLGMI
                     YRHDPDVIVGHNFLGGGFEALLYRMKELKADHWSRIGRFRRKGMNVSKMGSNVKLMAG
                     RLVADLSSDAAKGMISSTTWSLTEMTNTHLKVQREDIDPEDTAGYFDHTATSPDRLIK
                     FIRLCEVDAFFQMAIAARVQILPLTKQLTNLAGNSWNLTLNGGRAVRNEFILLHEFHR
                     LEYVCPDKAPYKAKTRPTGDDDEVTEDIIAMKGQRGKAKYAGGLVFEPKRGLWDKYII
                     IMDFNSLYPSIIQEYNIDFTTVERDDDENAEEEKIPDVPSSDVPQGVLPRIIATLVNR
                     RRQVKALMKDKSATPAKLLQYDIKQQALKLTANSMYGCLGFAGSRFSSRPLAALTTFK
                     GREILTHTRELAESLQLDVVYGDTDSVFVNSNVTTYPEALKIANEFKKLVNERYKLLE
                     IDLDAVFERILLLNKKKYAAVKIDEAGERSTEVKGLDMKRREFSKVSKDASAAILKEI
                     LSGEATEVVVEKIHELLTKLGEAVRNNEIPIDDYIIFKRLGKNPEDYPDKKSQPHVQV
                     ALRMKQKGAAVRAHDVIPYIICLDEHGKGGKTASADRAFHPDDLRRQGSELRIDHEYY
                     LDQQILHPILRLCETIEGTERARLAECLGLDPLRYTSTGTAEAQEKEFFTFDSQISDN
                     DRFRDADPLNLVCPSCSEETVFVGLQTDASEVSNIRANGICCNSCQLVIHPASLQLQL
                     ENQIRSHISKYYLGWMTCDGEGCGLRTRAMSVYGKRCLGFIKENCWGTMRLEYTDAKL
                     YNQLLYYRSLFDVEKILNAVRGSQRFDEIRPLTTANQKVLSELVAVTDMYLDKNGRRY
                     VDLKGLFGFMERIKI"
     gene            complement(1203737..1206247)
                     /locus_tag="CNF04140"
                     /db_xref="GeneID:3258159"
     mRNA            complement(join(1203737..1204517,1204629..1204760,
                     1204826..1204937,1204991..1205070,1205139..1205231,
                     1205307..1206017,1206145..1206247))
                     /locus_tag="CNF04140"
                     /product="Rho small monomeric GTPase, putative"
                     /transcript_id="XM_571709.1"
                     /db_xref="GeneID:3258159"
     mRNA            complement(join(1203737..1204517,1204629..1204760,
                     1204826..1204937,1204991..1205070,1205139..1205231,
                     1205307..1206117))
                     /locus_tag="CNF04140"
                     /product="Rho small monomeric GTPase, putative"
                     /transcript_id="XM_024658589.1"
                     /db_xref="GeneID:3258159"
     CDS             complement(join(1204287..1204517,1204629..1204760,
                     1204826..1204937,1204991..1205070,1205139..1205231,
                     1205307..1205333))
                     /locus_tag="CNF04140"
                     /codon_start=1
                     /product="Rho small monomeric GTPase, putative"
                     /protein_id="XP_024514515.1"
                     /db_xref="GeneID:3258159"
                     /translation="MSSSPNNRAIRRKLVIVGDGAAGKTSLLNVFAVGHFSESYEPTV
                     FDNYVTEIELDGKPVQLALWDTAGQEEYERLRPLSYSKAHVILIAFAVDTPDSLENVT
                     QKWIEEVRSICGKAIPVILVACKADLRDKAVANGTYSPERFTDHATGQRIADSIGAKG
                     YFETSALQNRNVDAVFEAATRAAVLVRDAGHGGVGAPNGSFDAGGRKDWGREKEEKKF
                     GCCVIA"
     CDS             complement(join(1204287..1204517,1204629..1204760,
                     1204826..1204937,1204991..1205070,1205139..1205231,
                     1205307..1205333))
                     /locus_tag="CNF04140"
                     /codon_start=1
                     /product="Rho small monomeric GTPase, putative"
                     /protein_id="XP_571709.1"
                     /db_xref="GeneID:3258159"
                     /translation="MSSSPNNRAIRRKLVIVGDGAAGKTSLLNVFAVGHFSESYEPTV
                     FDNYVTEIELDGKPVQLALWDTAGQEEYERLRPLSYSKAHVILIAFAVDTPDSLENVT
                     QKWIEEVRSICGKAIPVILVACKADLRDKAVANGTYSPERFTDHATGQRIADSIGAKG
                     YFETSALQNRNVDAVFEAATRAAVLVRDAGHGGVGAPNGSFDAGGRKDWGREKEEKKF
                     GCCVIA"
     gene            1206492..1207589
                     /locus_tag="CNF04150"
                     /db_xref="GeneID:3258428"
     mRNA            join(1206492..1206681,1206747..1207159,1207217..1207291,
                     1207342..1207589)
                     /locus_tag="CNF04150"
                     /product="ribosomal protein S2, putative"
                     /transcript_id="XM_571691.2"
                     /db_xref="GeneID:3258428"
     CDS             join(1206581..1206681,1206747..1207159,1207217..1207291,
                     1207342..1207523)
                     /locus_tag="CNF04150"
                     /codon_start=1
                     /product="ribosomal protein S2, putative"
                     /protein_id="XP_571691.1"
                     /db_xref="GeneID:3258428"
                     /translation="MAERGGFGRGRGGAGGRGRRGPRRGGKKEEDKEWVPVTKLGRLV
                     KDGKIKSMEEIYLFSLPVKEFQIIDLFLPALKDEVMKIMPVQKQTSAGQRTRFKAFVA
                     VGDFDGHVGLGIKCAKEVATAIRGAIISAKLSIVPVRRGYWGSHIAEPHTVPCKVSGK
                     SGSVMCRLIPAPRGTGIVAAPASKRMLQMAGIQDCYTQSKGCTATQGNFLKATMAALA
                     KTYQFQSPDLWNVIAPGLTPYDEHSSWLAIAAKKAANY"
     gene            1208075..1210376
                     /locus_tag="CNF04160"
                     /db_xref="GeneID:3258119"
     mRNA            join(1208075..1209345,1209405..1209852,1209921..1210376)
                     /locus_tag="CNF04160"
                     /product="expressed protein"
                     /transcript_id="XM_571693.2"
                     /db_xref="GeneID:3258119"
     CDS             join(1208177..1209345,1209405..1209852,1209921..1210202)
                     /locus_tag="CNF04160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571693.1"
                     /db_xref="GeneID:3258119"
                     /translation="MPKEAKLPSTTPPPALFPQILPLLISRLTTSPVNLQILPVIETA
                     LHIQRCVTLEPMPGVSASSLIPLQKLLELSTSHPAAVRVPAIIDAILAHPIHSPVISQ
                     IISNVFNESPDSIEIWRIDVLPELINQTKAGGQKDVVLAVKLMLGMIRAHDELIGLTL
                     EVSEEVLRGLSMAYSKLGEDDRKTRTGVSEEIRLGAMEDVLMICKELITRVGMEGAAG
                     DAMLRFLGENESAAMGVMQGKSLRGDCEALWGKNGRKFSPDSVIIGKLEKKRDDLAKL
                     DPRVMSILAIFPTIPPHLLLIALSHPQFSSIPAGSKASPGELAEPLLACMLNHGEGLP
                     EELGGLKAVVSKLGNAQAAGEVPDEKRKEKKKFERRNIFTAEDLDISRLRLKDGESAL
                     PELQSTIPQHIRDSIQRLISLQASEEEERRQALADSNLLLSDDESDMDDSGEIPLQVR
                     VSGGDTEDTAPVDSDGEAVKVSRRNQQNQNNGMPDKERYEILRTLYLDDPGLFDRDGV
                     TRRSDERKKMREMLGWDDGQIEGWRVMLERDPQKDVILEAHRDRMARKGTSSSGYNNR
                     NNRHDNRARQPSPDGSVMSMNTSYTSNSHSNGGGRGGKGRQNKGNRGHSNAARTRGHD
                     RKMRQMGA"
     gene            complement(1210322..1214911)
                     /locus_tag="CNF04170"
                     /db_xref="GeneID:3258391"
     mRNA            complement(join(1210322..1210509,1210580..1210824,
                     1210880..1211169,1211219..1211792,1211846..1211909,
                     1211958..1212097,1212162..1213109,1213160..1213176,
                     1213238..1213346,1213399..1213538,1214279..1214911))
                     /locus_tag="CNF04170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657449.1"
                     /db_xref="GeneID:3258391"
     CDS             complement(join(1210458..1210509,1210580..1210824,
                     1210880..1211169,1211219..1211792,1211846..1211909,
                     1211958..1212097,1212162..1213109,1213160..1213176,
                     1213238..1213346,1213399..1213538,1214279..1214423))
                     /locus_tag="CNF04170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513152.1"
                     /db_xref="GeneID:3258391"
                     /translation="MAPSSPILSPSRSPLSGSRINGDNSSVDERTAIQSGLLGERKDS
                     GVRKDSLTRERKGKMPVLSHLLCVGNGTVLSLVADKKYVYAGCQSADNEITVFSRSSL
                     QPLYRLLGHQGSVLALLIIEEKKWLVSSSSAGDVRIWSTETLDLLYVIHPCDDTSGDI
                     YSLAWDERAGGTLYFGSQSCSIEWINFGDFCTFHQRKISGSAAGTVHVVPNCTDSSSR
                     PGPSQRSGRYKPHKFFDNPPENGCSGSSTPCSPFPSNTARKETFSKAELDQVSVNLLE
                     QTRPATEIEVPAESRLAFAHYGYIYALHTLSRPNGDKWLVSGSGDSDVKIWECHPSGG
                     ITLVRQFNSLSGAVLSFAFRDDLLYAGLQAGEIAVWDLETGACIRTIEAHEEDVLVMS
                     VLGGDVYTAAADGRVLRVNDEFDCTAAFKAHSGTVMSSTIVKSVKGDSWELITGGNDS
                     YVKIWQVEAPKETLQSENVMDMEHGGDVMLYALSKLVAVPTISDDSHRESCRQGAHLL
                     KKILSQLGASSEVLCGEQGRNPLVLATFTGQDIGKPRKRILFYGHYDVQPAAEKRWIT
                     NPWELSGRDGYLYGRGVTDNKGPIMAVACAAASLRQRRELDVDLVMIIEGEEEAGSRG
                     FASTVRAHKADIGHIDAILLSNSTWIDEEDPCVVFGMRGVVYANLSVESSEENLHNGV
                     DGGATSEPMFDMVRVLGALSDAKGVKVPGFYDSVRPATDEEMSLLRDVSSACGRPLDE
                     LIRVWRQPSFSIASINSSGSGNKTVIPRRVSTDISMRIVPDQDLETIVKGLKQFCRET
                     FQGLESPNKFDIQVTHTASWWLASLESPYFKALEASVQDVWGVRPLKIREGGTVPTVF
                     WLEKEFGAPCVHLPLGQSSDAGHLANERMRLLNLRNGKRVIEAYLTRLASI"
     gene            complement(1215355..1218473)
                     /locus_tag="CNF04180"
                     /pseudo
                     /db_xref="GeneID:3258431"
     gene            complement(1218892..1222044)
                     /locus_tag="CNF04190"
                     /db_xref="GeneID:3258406"
     mRNA            complement(join(1218892..1219397,1219454..1219736,
                     1219789..1219950,1220015..1220625,1220677..1220834,
                     1220886..1221082,1221129..1221203,1221256..1221406,
                     1221460..1221585,1221645..1222044))
                     /locus_tag="CNF04190"
                     /product="vesicular-fusion protein sec18, putative"
                     /transcript_id="XM_571385.2"
                     /db_xref="GeneID:3258406"
     CDS             complement(join(1218988..1219397,1219454..1219736,
                     1219789..1219950,1220015..1220625,1220677..1220834,
                     1220886..1221082,1221129..1221203,1221256..1221406,
                     1221460..1221585,1221645..1222006))
                     /locus_tag="CNF04190"
                     /codon_start=1
                     /product="vesicular-fusion protein sec18, putative"
                     /protein_id="XP_571385.1"
                     /db_xref="GeneID:3258406"
                     /translation="MSFFKRSDPNAPAARRAAQGSPAPYQRVPDNASYSSLPPPIQQA
                     PPPRQSPLPSQDPYGRASGLGGGYGAPVYQVTQPTHPGLGPRGASHYSEKSQNEYGYQ
                     SQPQKGYPQQSHGSTGSGIFNIAPCPSDALALTNRLVVHPSDFPSDVDFALLRGRFVF
                     SIIRDNTGTLPPGHVGPSKIIRQWVGLSAVGETVDIEPYHPGNGEWASTAEIEVGFRL
                     KRKETQDIFDSEEMAAAFINAFPSLPLTPLQPLVFDYRGHELKATVRAISTLDGQDGR
                     TGVTMEGTEIIWVKDPTSGIKLKNSSKRGPTNAILAPNFKFEDMGIGGLDTEFAAIFR
                     RAFASRIFPPGLVEKLGIQHVKGILLYGPPGTGKTLMARQIGKMLNAREPKVVNGPEI
                     LNKFVGQSEENIRKLFADAEKEQKEKGDESGLHIIIFDELDAICKQRGSTNSGTGVGD
                     SVVNQLLAKMDGVDQLNNVLIIGMTNRMDMIDEALLRPGRLEVHIEISLPDEEGRLQI
                     LNIHTTKMRSNGVLANDVDLAELASLTKNFSGAELGGLTKSATSFAFNRHVKVGTVAS
                     FEDVENIKIGRADFLHALEEVQPAFGVSEEELQQVVQNGIIHYSSRVNEILNDGQLLV
                     EQVRKSERTPLVSVLLHGPSGAGKTALAATIAMGSDFPFIKLISPETMVGFTESQKIA
                     QLHKVFADSYKSPLSVVVVDSLERLLDWNPIGPRFSNGVLQALVVLFGKRPPKGRRLL
                     VLATTSNRSILSDMDVLSTFDADIPIPPITSVKHIERCLREVNLFSSNEEMQRAVGML
                     RDVKFGEGGNGELVVGVKKLLSMAEMARQDPDPAAKLVASLIREVS"
     gene            1222207..1224350
                     /locus_tag="CNF04200"
                     /db_xref="GeneID:3258478"
     mRNA            join(1222207..1222462,1222509..1224350)
                     /locus_tag="CNF04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657450.1"
                     /db_xref="GeneID:3258478"
     CDS             join(1222232..1222462,1222509..1224122)
                     /locus_tag="CNF04200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513043.1"
                     /db_xref="GeneID:3258478"
                     /translation="MSNDENPLLRPPFFPIPGVDPNAPISAQTERIDQLNTLLLQDID
                     ANFARFHQIITSKVLPQIKRYAISSEPTRESALFWRSFFENASTVRLSNQGESDTTMT
                     SQQPDTSTQYDDQTLTLRRSADESSVRNDDSFMFDPPPGTSSTPLPAGRGAGGRPNDS
                     WEDSMESPFDRLDRKLMDELKIGKEGYEEQSSSEMPTPSLPSGYSLPGLDSRDSSRIS
                     SIHDYSVGTIDPSRESELPSSFGQSHSRLAQSYYPSPTPKANRLADPPPASSNPFGAN
                     FKGIVDMRDTPLNAKTKGKDNFKPKTSIVPGLDDDSDSDESNGGFGMSPPVTMKFDLP
                     PRAQAIMNAARTPGKVKGKEVEDAAAGAADKEREAKFILDDLLEEMSNEMSPRMETPE
                     ALRRYSVLPGDNAPSRLLFSSSSQPAIAEDEDQTFHAPSLSHPLHPSHARRDDHAEET
                     YHPTSRPAASRQSLANSSFNSNTTEIPNAQIVYSQEEDSFDDEGDTFDSSGEISSLHV
                     PSTGSSTHPGFASLPPSSHPSHPTMADDSYLSSEGDLTQITQASNTSLFGGGPHGGHL
                     GAGAGGRFALMTKEDMDTYHGGRLEDAAGEDVWFSPTRDLARGRNAGP"
     gene            complement(1225302..1228023)
                     /locus_tag="CNF04210"
                     /db_xref="GeneID:3258370"
     mRNA            complement(join(1225302..1225502,1225565..1225698,
                     1225756..1225940,1225990..1226760,1226812..1226958,
                     1227009..1227463,1227523..1227728,1227783..1227853,
                     1227920..1228023))
                     /locus_tag="CNF04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_571707.1"
                     /db_xref="GeneID:3258370"
     CDS             complement(join(1225402..1225502,1225565..1225698,
                     1225756..1225940,1225990..1226760,1226812..1226958,
                     1227009..1227463,1227523..1227728,1227783..1227853,
                     1227920..1227979))
                     /locus_tag="CNF04210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571707.1"
                     /db_xref="GeneID:3258370"
                     /translation="MRSEEEEEDDEYYDEHEEEDDERASNGDNGEAEGDEDDADEAIE
                     EASDEEGSDEDNAEEDAEAEDEEEEEEEEDGEAEEDEEDERDEEEEEASEDEADGEDV
                     TMAAAEDDEAGSMHPSQVSKSAKLPRADLPPPPHLIRRSLFKPAFRAPPAALSVEAIV
                     GIPLPTPVQSLASSTCLSYLLTGGQDGFVRAYDFWGSVNGSQMMTAQQRSVVGLGEGM
                     NKAGLPRGWWTNEVEGIIGGTVAKRTEPVYSMACEGDALWALTGTQSGPINLFSLRHS
                     PGHLVHTLKGHTNVVSCMTLLPEEKGFISGSWDGTVREWDLNTGQTVRTYPSHKAQLS
                     SVSLRPVGFPSSPTPSPRPQALREEEEEGNDGPATNISISMGPDFFEKKETENSKQEG
                     ENGKESSGDKEAELLSEQKPDGDAEMADAASAISGTGDSLFGDDDAEGETAPASILPT
                     TIPSPSLPSPPKPKPLGLALPGQRQSSSAPISTKETETAPVSAPLFAPQASASYARQG
                     AADVIPVLSPVDWKAYSEDVLLTSSMDGQLVLIDRRVPSYEGTGTGVGRLLPGEKTPP
                     WCMSACWLSNGNQVLAGRRNGTVEIWDVRKGSSSTGPNLLRSLKTPVESGPISCVVAF
                     PDGRHIATASQDNIRLWNAAEVFYSEDSAKRSKGKTPFKIIAGHHGGTISSMIVDRTC
                     RFLITASGDRGWGGESTKAVLIHEVKW"
     gene            complement(1228153..1229224)
                     /locus_tag="CNF04220"
                     /db_xref="GeneID:3258262"
     mRNA            complement(join(1228153..1228672,1228724..1228793,
                     1228857..1229224))
                     /locus_tag="CNF04220"
                     /product="expressed protein"
                     /transcript_id="XM_571651.1"
                     /db_xref="GeneID:3258262"
     CDS             complement(join(1228313..1228672,1228724..1228793,
                     1228857..1229038))
                     /locus_tag="CNF04220"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571651.1"
                     /db_xref="GeneID:3258262"
                     /translation="MPALIPQLEPPKDADPIAAATIQLLEQVRATTEWYTNGDSSASS
                     FIDFSGYRQLQEWAKNPEALNVIDKILRARLGLPFPYNQKALILVQLIPEDKLAPYAP
                     LLKPLVESSPDSTSAYTYATPFIVTLATSLHSLADGQAKKTEAKKKEDEEKVKWNSWS
                     EVYGKSRADWVGLPVDNGGVKWGWWAGEPIGVEEWWKNRNIGE"
     gene            complement(<1229408..1231001)
                     /locus_tag="CNF04230"
                     /db_xref="GeneID:3258142"
     mRNA            complement(join(<1229408..1229764,1229834..1230536,
                     1230579..1230774,1230819..1231001))
                     /locus_tag="CNF04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657451.1"
                     /db_xref="GeneID:3258142"
     CDS             complement(join(1229408..1229764,1229834..1230536,
                     1230579..1230774,1230819..1230921))
                     /locus_tag="CNF04230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513126.1"
                     /db_xref="GeneID:3258142"
                     /translation="MPGAMSLADLPCEIIRMVARTIYDPLKITQKDRLTWGIFSTVDM
                     DRDRQNSLNALIALGMTCRKIRREVKGILFTCVRVHDQDKGVELIEHRDTWGIYVRSI
                     IIDLSIFDNTSDQFIKQNKMVGTVRPRSCWSESTFLETLINSLPQLEHLCFFADVSDE
                     PTLVLLFSKLIPTPPSYISPPTPTSLDSPTSHLHHAPTKHIHKPFAQRLRSFSWRLRA
                     PPPSSFREFARSSTFVSIHHLIRHTPNLDFLVLDADMDYTASPDILAVLEQMAQRDKW
                     AESKPPKLSLMLCGPILGWGDLFLQDLVKVYSNIKELFIDRPLTSPLVLDQVGAPDFL
                     VGDLLPLAHLPHLQTLQIGSYQIPSGNKQQHILHVTRLLSRYIPSLRIFGVLDTSGET
                     VWGGIWPKTLWMAAGTGIADKNMGEEGEGKMDRCWGVDEETGKWFIGLEDGDLEVLVK
                     DE"
     gene            1231474..1233527
                     /locus_tag="CNF04240"
                     /db_xref="GeneID:3258290"
     mRNA            join(1231474..1231654,1231882..1231980,1232030..1232181,
                     1232239..1232379,1232425..1232432,1232480..1232562,
                     1232612..1232689,1232744..1233132,1233199..1233527)
                     /locus_tag="CNF04240"
                     /product="oxysterol binding protein, putative"
                     /transcript_id="XM_571695.2"
                     /db_xref="GeneID:3258290"
     CDS             join(1231582..1231654,1231882..1231980,1232030..1232181,
                     1232239..1232379,1232425..1232432,1232480..1232562,
                     1232612..1232689,1232744..1233132,1233199..1233369)
                     /locus_tag="CNF04240"
                     /codon_start=1
                     /product="oxysterol binding protein, putative"
                     /protein_id="XP_571695.1"
                     /db_xref="GeneID:3258290"
                     /translation="MSARPSRRPSSTSIKSALEENKPEGADVPDEQKAGWASFIKSLA
                     RMTGDLSSMTAPPFILSPTSLTEFPAYWCEHPTAFASISEGKDEFERAERVLRWFIGT
                     LKAQYTTRNEKMGSEKKPLNPVLGELFYGVWPDQDGRGETKLVVEQVSHHPPITAYYI
                     ENAKAGVKLQGHSGQKTSFTGTAINVKQSGHAILTVKPKNGHAEEKYLITLPKLRIEG
                     IIWGSPYIELTETNAIQSSTGYTTQIDYKGKGYFSGKAHSFKATITKSGKTLQSYEGQ
                     WTGNSYVGKKSGPLFLDTNEAKEEVTVKPIEEQGEWESRKLWDKVAKGIRGQNYDEAG
                     REKSRIENEQRQRRRDEAAAGITWQHVHFTHVDSDEEYRSLAELLHDKLTPVHEDAYV
                     FKANI"
     gene            complement(1233509..1237079)
                     /locus_tag="CNF04250"
                     /db_xref="GeneID:3258177"
     mRNA            complement(join(1233509..1233690,1233746..1233862,
                     1233924..1234099,1234169..1234187,1234256..1234380,
                     1234432..1234587,1234652..1234686,1234748..1234843,
                     1234895..1234990,1235048..1235223,1235279..1235414,
                     1235470..1235616,1235667..1235707,1235760..1235822,
                     1235875..1235966,1236028..1236168,1236221..1236315,
                     1236371..1236453,1236515..1236601,1236654..1236687,
                     1236752..1237079))
                     /locus_tag="CNF04250"
                     /product="expressed protein"
                     /transcript_id="XM_024657452.1"
                     /db_xref="GeneID:3258177"
     CDS             complement(join(1233657..1233690,1233746..1233862,
                     1233924..1234099,1234169..1234187,1234256..1234380,
                     1234432..1234587,1234652..1234686,1234748..1234843,
                     1234895..1234990,1235048..1235223,1235279..1235414,
                     1235470..1235616,1235667..1235707,1235760..1235822,
                     1235875..1235966,1236028..1236168,1236221..1236315,
                     1236371..1236453,1236515..1236601,1236654..1236687,
                     1236752..1236839))
                     /locus_tag="CNF04250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513150.1"
                     /db_xref="GeneID:3258177"
                     /translation="MLKRLDLVTTALLAVTGVAGKITYSETNDTITLSSDRLTLGVNK
                     TLGAMTGLEFDNVDVLGPVSGRIGMGYFDCYCIPAVNTSVWTPDNPNPQSSRHYYVGQ
                     SQMASFEVHQGNDRNNNPWIGLIMSETYEGTGQFFQQWWFLRDGEPGYHTFTRLQFDN
                     GTEGIDLGNLQEFRQVISPNSDIWTHLVTNDVQYGHLPSDEATGNQTTVQDATWYYNI
                     TEGNPYRTESSDYFTKYEWADLYGDHFAHGFYADGTASNGSTLGFWTVFNNLEGYTGG
                     PLRSDLVVDTNIYNYYASNHRGASTMNITSGFDRIFGPTFIYLNKDGDLHNLYDDAKS
                     YANTSFAADFYDDVADLIPGYVNSSGRGDFKAQISLPEGASNPKIILAQSGVDPQDNV
                     DYTAKQYWTNVSSDGRVTIPRVQAGTYRVTLYAEGIFGQFEQDEVVVSAGDGDGAEFR
                     INWEAECHGIELWRLGVPDKTAGEFLHGFAKDPDHTLHQEEYREYWGAWDFPTDFPDG
                     VNYTIGTSDPSKDWNYVHYSRYGGSFTRPEYVLDNVNAWTVNWVPEGGLDVSGKTAAL
                     TVQLAGARTASGNLDLPEPTSNYSNVDYTVNVNGNPLTWTILYNQSSSCSDRSGIACY
                     NLRNVFTFPGEWLKNDTNNVFEFALPYNASGGDVNFRNYSISVLYDAIRLELSD"
     gene            1237837..1237935
                     /locus_tag="CNF04260"
                     /db_xref="GeneID:3258253"
     tRNA            1237837..1237935
                     /locus_tag="CNF04260"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:3258253"
     gene            complement(1238201..1239691)
                     /locus_tag="CNF04270"
                     /db_xref="GeneID:3258043"
     mRNA            complement(join(1238201..1238662,1238762..1238839,
                     1238942..1238988,1239095..1239152,1239217..1239274,
                     1239329..1239413,1239515..1239691))
                     /locus_tag="CNF04270"
                     /product="ubiquitin conjugating enzyme, putative"
                     /transcript_id="XM_571703.1"
                     /db_xref="GeneID:3258043"
     CDS             complement(join(1238507..1238662,1238762..1238839,
                     1238942..1238988,1239095..1239152,1239217..1239274,
                     1239329..1239413,1239515..1239662))
                     /locus_tag="CNF04270"
                     /codon_start=1
                     /product="ubiquitin conjugating enzyme, putative"
                     /protein_id="XP_571703.1"
                     /db_xref="GeneID:3258043"
                     /translation="MMPPTPRTNASSSSSPYPPSRPNSAKPAISSNGNSSTANSSLIL
                     RKQLMELQKHPVDGFSAGLVDDDNMLEWDIVIMGPVDTLWEGAILKARLIFPPEYPLL
                     PPKMIFDSEMWHPNIYNKGDKKGEVCVSILHQPGEDEWGFEDAGERWLPVHTVESVLI
                     SVISLLSQDVPDLSSPANVDAAKEVREDYPSYKKKVKRLARRSAEEAYD"
     gene            complement(1240391..1245742)
                     /locus_tag="CNF04280"
                     /db_xref="GeneID:3258403"
     mRNA            complement(join(1240391..1240555,1240614..1243198,
                     1243248..1245551,1245599..1245614,1245664..1245742))
                     /locus_tag="CNF04280"
                     /product="histone deacetylation-related protein, putative"
                     /transcript_id="XM_571387.1"
                     /db_xref="GeneID:3258403"
     CDS             complement(join(1240638..1243198,1243248..1245534))
                     /locus_tag="CNF04280"
                     /codon_start=1
                     /product="histone deacetylation-related protein, putative"
                     /protein_id="XP_571387.1"
                     /db_xref="GeneID:3258403"
                     /translation="MDTINPPTPPSRNIVVEAPAAESGTAAVETTSTSVEMEMDVGAA
                     APEGTDAVELLLNISHAVDSSTRSEMVAQEGAETLLEAVQGLSPEQELVPDTADPEPL
                     SAHEPEPEPEPKRKRKKHPTHYLGEDNTIIRCICGFTEDDGFTIQCEGCGAWEHGMCF
                     GFNDVDSAPDQYLCELCDPRPVDKEGARRIQLRMIEQQRLAREAGARIPGPGEKPRSK
                     GGKRRKEQSNSVPEEGGGEMGPPAKPRRGRQQSNKSRTKAPMEASSPAIGDDYFKIDP
                     WAMEYTPIEQNIPRGLPVRRVLRQLYEEWIESLPEQEKEREDNTAASHLPSPTETGLL
                     RLSPDAIFPPPNYSPLAPPLPPVFLTAPSLSSLTPSLIIKPVPSPSSSSGFTTSFLPP
                     TYRDHLTMRAIYTRPTVYGVFTSESFETGTFLGEYLGELVDPATYRQDPINQYTLLGV
                     PKPHVHALGPPINLMIDARNYGSPLRFVRNGCHPNAVIRPIVWRTPSSSSSSSSSSSE
                     GSPKIAFGLFTSRPIPPRGEIILGWEWDDQHLVHSLPLIHPTSSPSTGAVTYPNWQKN
                     LSRGQAEELGWRYERLLGCLWGVFAGCGCASGGAGGKAENKGPGSCALEQMMEFWRVT
                     TGRSNLKPQPPRVVTETEAEGEGEPELDQDGEREDREKERDMAYLGPLVGSVRGWRNR
                     ELEVESVKQWMGTGALPLLSSVDMDMELRRNSVASGKEKKKKPAEEERRVSIDSQATQ
                     EQEEIGEEEEHEKGKMDVDQLTEPAPSPSPSPPTPPLNRRQLSASKPQAHPTVGDRPP
                     TPPHLPPSSSLSPPPRRSSFGTTVPHSEPITEVSEPESEKRPHTEEGREDDGSEDDSA
                     DVEEGMDVHQREDGLEEDEGALSDATTVTLPRSGRSPSLSSLGSTDGSDDSSLSDTQN
                     VSRESEDEGDDEDERVVINASKMKKKVVPSSPPLPPSKSKPNQPKLQSQVPGPKSKDR
                     VKPLVKDREKNKVQSKSGKPFSSPNNGHQVKAKAKRGDLSQAQSSRQRPDSSSSSIKD
                     REKLGKKPVPVGIGAGLKGSKKRAKRIVSSSETEEDEVRVKKKLKEKEKEKKSEQKPS
                     LPSVVAVNSDGPAPKEATPPPKPPLPLTPPPLLTFLSVKEPTPPAPVPEPVPKEPTPP
                     PPEPPKKVSLSEYLKTHKFRKESQTPSPAANTGASGNGGAAGSTAVGAGIPGLGGYLP
                     PKPPSTSAEAPKSEHVEHENREESNPPNSFVPTNTSATVATSASTSGLNLFEHLPSSR
                     GSASGSALGLGPEGNSGLDLVNASGPLSAVEPTPAPVSATKNSDDNDPLSSSAIATAL
                     SLASAITSATSRGQNVNHEASIGATRPVMQSSTSTSYVPRQSQPQVQSTPSSATISLP
                     MPTSASKDHFVHPLPSTPSIPPPATPNNAVSAAARVSSSYIPRQVSSSSMTSAGGVEE
                     PHSPHRGFTGLYGRRERERSPIRGDFRDRDRERDRDWDRDRDRDRRPLSHNHRDLPER
                     PSTSTSTSTSIPPPLAARDLPPHTSSTLPGTPSGLAKTTGLGLGLPRAPPTGPKVPPT
                     GPRAFSGSGAPGAGVETAANTPTAGGLGGVGAGLGLSRGRGFRGFAPRGVWRGRGFRG
                     RGRGG"
     gene            complement(1247110..1249909)
                     /locus_tag="CNF04290"
                     /db_xref="GeneID:3258510"
     mRNA            complement(join(1247110..1247545,1247603..1248080,
                     1248141..1248221,1248269..1248420,1248474..1249143,
                     1249196..1249646,1249694..1249909))
                     /locus_tag="CNF04290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571654.1"
                     /db_xref="GeneID:3258510"
     CDS             complement(join(1247228..1247545,1247603..1248080,
                     1248141..1248221,1248269..1248420,1248474..1249143,
                     1249196..1249646,1249694..1249847))
                     /locus_tag="CNF04290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571654.1"
                     /db_xref="GeneID:3258510"
                     /translation="MDEDEDIAAIDAKIAKLMAKKAEKAAMKEKERLALEQEEAHVLV
                     QATPTKNERKKSDSLFQAPSQPKFVSASSLLPRERKPAQELQPLPIVPSTMAAKMAAL
                     KQRSNYVKSSRQTSASSSASASNSSRLSSKPSSCRPDKLKCEQSRSPSLEVEDKKPVI
                     RRDEEDSTIIEELELGPKQFGPDPEGQDEWLSVEPNSNIRLKKRVMPHADLQEFLTGR
                     YYLPPSKLYSVVRLSRDGTSYDVPVDDEWVTIAVVAQRGPIRISGMKEKRVGSDREDN
                     NNDSDNDDSEDEAGYSDSDDQDGEGSGDIKELIGEKGRSSERPKITKKKKVKENSNKD
                     DWKKHREPRKYINFTLCAMPHRSNNASTPTGDALLHLLLFEADHFVRVEHGNGEVTKS
                     YRGGSGGAYEKWCNLGEGSVIAILNPRIWRNLKGQHAKPHPMEFPLGLNPVSDDSIVV
                     IGQARDLGHCTAVQRDGNRCKSWVDLRQNPICEYHVHAAVRKNKSGRGEFTASTNSFA
                     LVNGTRSAKLGNRKGLLPPAGARPTPRGPDNGGGGATYIVGGGVINTGPFGDENIAGR
                     IGRSRAEKKKRRQEKKEAEKEFQMLYERERGTGGGTTGGMYLEALKRKHKKEESSSEE
                     DEDEQERKPVFSAEAIKRIGYDPSAKKGQFSKEEGQKRLGTIATLEELSTGCRMERAA
                     KRLKEGKLAAKTLPPKGQSTPLLQDTSNPSQPRHIDTLTTAGRNKDNGKVNVDLLNIG
                     KQPHVPKIRLPRPLLNRDGDDDMIDLD"
     gene            complement(1249997..1250086)
                     /locus_tag="CNF04300"
                     /db_xref="GeneID:3258030"
     tRNA            complement(1249997..1250086)
                     /locus_tag="CNF04300"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3258030"
     gene            1250182..1254499
                     /locus_tag="CNF04310"
                     /db_xref="GeneID:3258320"
     mRNA            join(1250182..1250835,1250891..1252538,1252598..1253062,
                     1253113..1254499)
                     /locus_tag="CNF04310"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657453.1"
                     /db_xref="GeneID:3258320"
     mRNA            join(1250182..1250835,1250891..1252568)
                     /locus_tag="CNF04310"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_571388.2"
                     /db_xref="GeneID:3258320"
     CDS             join(1250335..1250835,1250891..1250962)
                     /locus_tag="CNF04310"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513044.1"
                     /db_xref="GeneID:3258320"
                     /translation="MPTRVIPGVTMVDDGPSVVVPPINFSLVAPGIYRSGHPNRKNFP
                     FLKRLNLKGIIYVEGSDPYRQDSLDFVQSQNLELYRFDFSNESDLYTPEGQERMEALL
                     KVLLDKRNYPLLVHDDTGKGSCTLVCALIRRFQSWSLTGLFAEGDMFAGPAGGAEGVG
                     LGETGMEFIAAFQPKLVAYDRTWRPDWADY"
     CDS             join(1250335..1250835,1250891..1250962)
                     /locus_tag="CNF04310"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_571388.1"
                     /db_xref="GeneID:3258320"
                     /translation="MPTRVIPGVTMVDDGPSVVVPPINFSLVAPGIYRSGHPNRKNFP
                     FLKRLNLKGIIYVEGSDPYRQDSLDFVQSQNLELYRFDFSNESDLYTPEGQERMEALL
                     KVLLDKRNYPLLVHDDTGKGSCTLVCALIRRFQSWSLTGLFAEGDMFAGPAGGAEGVG
                     LGETGMEFIAAFQPKLVAYDRTWRPDWADY"
     gene            complement(1254467..1261440)
                     /locus_tag="CNF04330"
                     /db_xref="GeneID:3258162"
     mRNA            complement(join(1254467..1254996,1255051..1255751,
                     1255804..1256166,1256223..1258303,1258354..1258439,
                     1258491..1259740,1259791..1261256,1261309..1261440))
                     /locus_tag="CNF04330"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_571389.2"
                     /db_xref="GeneID:3258162"
     CDS             complement(join(1254558..1254996,1255051..1255751,
                     1255804..1256166,1256223..1258303,1258354..1258439,
                     1258491..1259740,1259791..1261256,1261309..1261381))
                     /locus_tag="CNF04330"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_571389.1"
                     /db_xref="GeneID:3258162"
                     /translation="MSKKGGRDLSQFNYGAMSSLVVNQDRSVVRNDEPTGAPESLVGR
                     IDPKTMGSRVQATAPKDLEKRKAKSKLTSADEVERSIRRAQEKSRAQFGTQGVLDTVA
                     EMEGLRYRPRTAETREVYELLLGLTHTILGDQTQEVVRSAADTILESLKSEDLKEFDK
                     RKDVESVLGQMDESIWAQLVSLGKKITDYVEEEEGGADERQQAVDQEGVAVLFEDEDE
                     ESEDDFEIGGNPSDEDEEEDEEDEEESGAEAAEDEQDALVLGGKSSKRTATTDSDRVS
                     PRDIDGFWLQRLIASYYPDPVQSSDFTSQALTLLSSDAELRDLENSLAEMFGYENFDL
                     VAKLTKNRDVIVWCTKLARSNEDEKQDVEVAMREKGVGWILRELRGIAKKPDHVSTSV
                     VIPKTATIQPGTIAQPRKTIDIDSLIFSEGGHLLTAKKVRLPEGSFKRQMKGYEEIHV
                     PEPKRREPVVGELVPITKMPEWTWPVWESVKTRELNVIQSKVFPIAWGTNEPMLICAP
                     TGAGKTNCAALTILRAISQFRDEATGFIDKDAFKIIYVSPMKALVQEQVDAFSKRFSS
                     LGIHVAELTGDSQLTKQQISETQIIVTTPEKWDVITRKSTDTSYTNLVRLIIVDEIHL
                     LHDDRGPVLESILSRTIRKMDQTHDDVRVVGLSATLPNYKDVATFLRVDPKQGLFYFD
                     ASYRPVGLKQQFIGVTEKKAIKRLQTINEVCYEKVLNYAGRSQTLVFVHSRKETAKTA
                     AFLRDTAMEKETLTQFINPEGASREILIQEAAQCKDAKLKDLLPFGFGIHHAGMSRED
                     RTTVEQLFFEGHIQVLCCTATLAWGVNLPAHTVIIKGTQVYNPEKGKWSELSPQDVLQ
                     MLGRAGRPQFDTYGEGIIITNHGELQYYTSLMNQQLPIESQFVSRMVDNLNAEIVLGN
                     VRNRDEGVQWLGYTYLYVRMLESPKLYNVGADYQEGDDALVQKRADLIHSAAVLLEKG
                     GLVRYDRATGVFQSTDLGRIASHYYIAYSSMSVYNKHLKPNMTMIDLFRVFALSNEFR
                     LIPVRQEEKLELAKLLERVPIPVKEGVDESVAKVNVLLQAYISQLKLSGFDIVTDMVF
                     IQQSAGRIIRAMFEICLKKGWAQPMRAALDLCKMVERRMWKSMTPLRQFPRINREIVQ
                     RAERKDFPWYRYFDLDAAELGELIGLPKSGAYIQSLVHKFPRLDLQAHVLPLTRSLLK
                     INVTLTPDFQWDRNVHGASQAFWIIVEDVDGENVLYHDQFILRERFAEDEHYVTITVP
                     ISEPVPPNYYLSVISDRWLQAESKLPISFAHLIRPEPFPPHTPLLELQPLPITALHNK
                     AFESLYPFEHFNKIQTQVFQALFTTDDNVFVGAPTGSGKTICAEFALLRLWSKKGKDV
                     PRAVCIEPYQEMVDTRVAEWSSKFEGLEKVIVALTGESTADLALLRKADVVVCTPSQW
                     DLLSRRWKTRKDVQNIGLLIADELQLIGGDVGSTYEVIVSRTRYVSQQTGITTRIVAC
                     SVSLSNARDLGDWIGAGSQTVFNFSPAARPLPLEVHLQSFNVPHFPSLMLAMAKPAYL
                     SMVEHSAGRPTICFVASRKQCKLTANDILTYCLADDDETRFLNVEREDLEPHLERLSD
                     EDLKETLRYGIGYYHEALSKLDKKIVTTLFEEGAIKVLVASKGTAWSLPATAYMVIIM
                     GVQYFDGQEHRYVDYAIADILQMMGRACRPMIDTSSRCVLMCQQTRKDFFKKFLNEAL
                     PVESSLPSYLHDHFNAEIVARTIENKQDAVDWCTWTWFYRRLMQNPGFYNLQGTTPTH
                     IGEYLSELVETTLNDLVNSDCIIIQDDMDTLPNNLGMIASFYYISYITVEIFSQSIKE
                     TTKLKGLLEIVSSAHEFETVPIRHHEDTLLERIYDRVPVKVAKVDYNSPYFKTFLLLQ
                     AHFSRTTLPPDLAIDQSTILGKVTGLLSAAVDVMSSKSLLGCLGAMDLSQMCVQAIWD
                     RDSPLKQVPYFDADVLGRFKAKGLDSVYDIMELEDDERNDLLRMSDRQLARVAKFVNS
                     YPNIEVSYDVEDASSLTSSDPVVLNITLDREADEGNPEDQVADAPHFPHKKMVSWWLV
                     VGDEKTKSLYAIKKVTVKATLKTKLEFTLPEGEWNLKLFLICDSYAGADQDFDIETLK
                     VVEGESSDEESSEEEMEVDN"
     gene            1262528..1265500
                     /locus_tag="CNF04340"
                     /db_xref="GeneID:3258046"
     mRNA            join(1262528..1262796,1262851..1263009,1263059..1263996,
                     1264045..1264352,1264410..1264524,1264687..1264816,
                     1264886..1265500)
                     /locus_tag="CNF04340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571390.2"
                     /db_xref="GeneID:3258046"
     CDS             join(1262588..1262796,1262851..1263009,1263059..1263996,
                     1264045..1264352,1264410..1264524,1264687..1264816,
                     1264886..1264919)
                     /locus_tag="CNF04340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571390.1"
                     /db_xref="GeneID:3258046"
                     /translation="MEIPSTVARQSSRTRLIPENQHGPHLSKEITPGARAMSLERLIP
                     FRNGWSAVERRRAGVFATSVVVGLASGSNYGYSAYAPQLASQLVISATLVNLIGLAGN
                     FGMYTSGPVWGKIVDSKGQKIPLLAGGLCCLLGYGITHAFYTHIIPLRSPSSDDPSYL
                     RLSLLLFAMFLTGCGGSAGLTSGVNAVAKSFPDSTRASATGAVLAGFGLSAFLFSALG
                     HLFWPGDSGGLLALLTVGTGGPMLFAAFIVRAMPPEGEQSLGPPLYEQVEQDEDGDGM
                     GVEVAVGDYGSPTFSRSSSFELSRSMEFSRSRSPAARGRHIHPDPDHPQPHAHFGALP
                     PSHNATHKPPRSRSSSLSSLPPTLLTHSPVDLIKTVDFWLLFIILAVLSGTGLMYINN
                     AGTVVLALAREGKRVYNKEKIGGWQAKQVGLVSIWNCAGRILGGVYSDFCKTHFQIRR
                     IWALPLVACLFIVSQLSALSTTHAQSLWIVSSLLGLAYGALFNVMPMLILEWFGMRHF
                     SQNWGWTAVAPIIGSNTFNVLFGSVYDANSVGRIGSFDPEGTDVSGVMGMMDFIKRGG
                     VALPDDGSHDCLMGEECYGLAFKLSFLGCILALVLSVLAGVRREKMSKERRGAILARR
                     TSSDEV"
     gene            complement(1264977..1267007)
                     /locus_tag="CNF04350"
                     /db_xref="GeneID:3258416"
     mRNA            complement(join(1264977..1265396,1265456..1265536,
                     1265591..1267007))
                     /locus_tag="CNF04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657454.1"
                     /db_xref="GeneID:3258416"
     CDS             complement(1265606..1266997)
                     /locus_tag="CNF04350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513155.1"
                     /db_xref="GeneID:3258416"
                     /translation="MLQQASHSSSKSTPSSPRLMSSTPPPYSPQRKARRGSEPSPIMI
                     ALSGWPEPVYIASDTSSWDRKKQQSRSGTATPPEIYDGVGGPRIIPQHIPSLLAQKNA
                     RLPASQPQNARAPATSAGKADPAKVFPAPVDNDNNTPTNAPNRWSRSNGRNAIKPLTP
                     AYPPAPPAGSIFATPPAAGNSSNSKTPVAPQFSIFATTCPHLTDPSLGPCPFPTHPHD
                     VRSMFPPTSHLAKRGAQMPLSRPSRDKGTTDKITDKQPIRPKYLPPTIFPSVTISSIT
                     HSPTTIIRSSSSSSSSTKINDKGKEREDPIKRPSTFADPRYLPSSAILHKGRALPLVP
                     SWSGVSSPSSSRTSTPRGERSRSPAVPTPTFDPPPVTGLAPIKTSTDVRVIDENYDPD
                     GSPTFTTTNESNGKAKGKRRLSILGDVEAGILWKKVVVNDLRQNTSNTPEVGEAMDVD
                     VVEEVEKMEKVVI"
     gene            complement(1267147..1270826)
                     /locus_tag="CNF04360"
                     /db_xref="GeneID:3258218"
     mRNA            complement(join(1267147..1267713,1267963..1268545,
                     1268606..1268967,1269021..1269442,1269493..1269607,
                     1269660..1270183,1270247..1270826))
                     /locus_tag="CNF04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657455.1"
                     /db_xref="GeneID:3258218"
     CDS             complement(join(1267474..1267713,1267963..1268545,
                     1268606..1268967,1269021..1269442,1269493..1269607,
                     1269660..1270183,1270247..1270751))
                     /locus_tag="CNF04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513045.1"
                     /db_xref="GeneID:3258218"
                     /translation="MSVKDLTANDIRSNLHSSLPKKILREAYVSSLSGTIQPSGSPAP
                     RVTFTIKTEFARSPNTYERQEVVKEAFVIKIELYSAEWHPFNGSGKPEPRKARAVKKD
                     LEKSLETVRNLKTRLVKEIDLGEMKVLDIQTPKLSDPKQKPYTDVVLAGVGGLTLKFN
                     DRTIKIINEPKIPMTKVHCSRSYSGDSRELLRPATAINIPVVKPVRPLSEFQPPDQLL
                     VDARKRSSEELDPSAKRHRSDERPADSLVTAPAPPTVVNLSSNLTPTNAPSVPAPRAA
                     SAVRRVQIQGDGWISFGPSANQPTLPAGPQSGDNTSISGAIGETGSVTQRAVLPSGSE
                     LNKGFRAKNGTIYHTLEEIAAFTNRMNGIGAVGVVGHINGPSPPTRNGKDWIISLVLT
                     DPSNAIASEQLVLAIFRRDGELLKNKFKIGDVVLCRNCFSTRFNDKSKLNCGSNSDQL
                     FIWRGGRQPINPSEYQKYPLGDDELERMKALWSWNTASSTGKQIVDGMSGKKAKMMYL
                     ANVEVGNFFDGNVKILKVIDNLKEQRQGPALEVYITDGTCPVRAGHINSNFHNLAFGL
                     PPEAVFCVAIDDFGSESGIEHLKKGSIVKIPNLHCKMHRQSGSVEIFWANKGTATQNF
                     RERKISPVIDVDIKAEIERKIMELRAKETAVTGIEYFDSEPEPEAELEVEPQPASAVP
                     SGKVPETKQASIPLTNQTSRPALSTTDSSATAISTIIPMTPLVQPADCWRALHTIYRH
                     PTKHPLSTLSDITEFREPAKLRTIAKVDDIFSREEVGEREMLVHAWCKNCNKCFQSNL
                     MSCGNCGDVEGKQVEWRYRFYLLLMDRQSDLTVFCGEEAEEWLPPLPPYEPTTNPRDK
                     QKTKQRLEQCCKEARDILMGKEGDDGRRPRPWIDWTLEPYIVKYGKVVQNRIFGMKRS
                     GY"
     gene            1270980..1271069
                     /locus_tag="CNF04380"
                     /db_xref="GeneID:3258031"
     tRNA            1270980..1271069
                     /locus_tag="CNF04380"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3258031"
     gene            complement(1271517..1276410)
                     /locus_tag="CNF04390"
                     /db_xref="GeneID:3258455"
     mRNA            complement(join(1271517..1272657,1272712..1272783,
                     1272833..1272912,1272970..1273198,1273263..1273406,
                     1273468..1273532,1275634..1275656,1275708..1275854,
                     1275912..1276019,1276125..1276410))
                     /locus_tag="CNF04390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657456.1"
                     /db_xref="GeneID:3258455"
     mRNA            complement(join(1271517..1272657,1272712..1272783,
                     1272833..1272912,1272970..1273198,1273263..1273406,
                     1273468..1274310,1274366..1274892,1274946..1275393,
                     1275451..1275656,1275708..1275854,1275912..1276019,
                     1276125..1276410))
                     /locus_tag="CNF04390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658591.1"
                     /db_xref="GeneID:3258455"
     CDS             complement(join(1271627..1272657,1272712..1272783,
                     1272833..1272912,1272970..1273198,1273263..1273406,
                     1273468..1273532,1275634..1275656,1275708..1275854,
                     1275912..1276016))
                     /locus_tag="CNF04390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513048.1"
                     /db_xref="GeneID:3258455"
                     /translation="MSAHGHPSTSSQQPHLSNILAPASQPANTERTESEIQADDGGGE
                     GEQGQNADRSDSSKGKEKDKEYDKWIQGIDYAYEYVPVTQRRQGRKNITYELTMRQQP
                     VQARMCGIGDKSDRRPVDPTPIIQLKVIDPQGDDITSIDPQTRQQIRRPSGSEGMTYM
                     QNPYYFLFACLVGGEEQEDELHVIDDGKTRFLTGTPVSSLYHLKDLDNSDAAFFVFPD
                     LGVRKEGRYKLKLTLFEIVDQEVYYCTTMFTSTFSVYSAKKFPGMSKATDLSVSFAEQ
                     GLKIRVRKDPRQPARATASSSGKSKRKSDAHESEEEAPAQGQSKRTRGLSMGYPGHEQ
                     RFHPPPGEHHYYPYPPNYPPPSGYYPPSGHPMPPPPPPSAYDPYRSHMSRSGSPYSYH
                     PPYPPYSAPGYPPPPSSNYHVNSGRPSTNPESSPSRHRHSLPPPGYVLDPRPIPLPSS
                     HGHHAYPTSSGMGYPPYPMHSESYDRAGVPWAQERRPTLPPPPLPESAMGRPGSRGTG
                     HHSTHPSSLRQGVSPLESPGRLQYAQSPDMGSYRPLSSASTREGRDGRERERERELHR
                     GSPVILPPITRSPVLISQGLPSITDPRESRECLNQSESRASVGGDSGSRPSSSGKNKM
                     GLGNLLG"
     CDS             complement(join(1271627..1272657,1272712..1272783,
                     1272833..1272912,1272970..1273198,1273263..1273406,
                     1273468..1273798))
                     /locus_tag="CNF04390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514516.1"
                     /db_xref="GeneID:3258455"
                     /translation="MVHHSQLTSNGADQMSFYVYPPPPPPGYQLVYVPPFHTTHLPRQ
                     RPCSTSSLPTTPSNPYPPHLPTPSYTPMSIRHCSSVATDHDCILRTYELTMRQQPVQA
                     RMCGIGDKSDRRPVDPTPIIQLKVIDPQGDDITSIDPQTRQQIRRPSGSEGMTYMQNP
                     YYFLFACLVGGEEQEDELHVIDDGKTRFLTGTPVSSLYHLKDLDNSDAAFFVFPDLGV
                     RKEGRYKLKLTLFEIVDQEVYYCTTMFTSTFSVYSAKKFPGMSKATDLSVSFAEQGLK
                     IRVRKDPRQPARATASSSGKSKRKSDAHESEEEAPAQGQSKRTRGLSMGYPGHEQRFH
                     PPPGEHHYYPYPPNYPPPSGYYPPSGHPMPPPPPPSAYDPYRSHMSRSGSPYSYHPPY
                     PPYSAPGYPPPPSSNYHVNSGRPSTNPESSPSRHRHSLPPPGYVLDPRPIPLPSSHGH
                     HAYPTSSGMGYPPYPMHSESYDRAGVPWAQERRPTLPPPPLPESAMGRPGSRGTGHHS
                     THPSSLRQGVSPLESPGRLQYAQSPDMGSYRPLSSASTREGRDGRERERERELHRGSP
                     VILPPITRSPVLISQGLPSITDPRESRECLNQSESRASVGGDSGSRPSSSGKNKMGLG
                     NLLG"
     gene            complement(1277952..1278675)
                     /locus_tag="CNF04400"
                     /db_xref="GeneID:3258117"
     mRNA            complement(join(1277952..1278461,1278510..1278675))
                     /locus_tag="CNF04400"
                     /product="expressed protein"
                     /transcript_id="XM_571400.1"
                     /db_xref="GeneID:3258117"
     CDS             complement(join(1278041..1278461,1278510..1278658))
                     /locus_tag="CNF04400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571400.1"
                     /db_xref="GeneID:3258117"
                     /translation="MSSQPNPTSTFPTIIWHPSFNPSQGFNSASIDSNQALRPWLPSP
                     QVSNTNSDKLSSLSLDDQSHPQSHPQSQSQSRPSQSTPQPPSTSTSKTRQPQAYVAYP
                     ELTCLHCLGANPPGKLGYVVSYVPADASGKPLTNDEGWHKVERRDTQEEELPEGTRSP
                     SAFQAAEILGDKKYVPDGAEDDLVGDMVE"
     gene            complement(1279711..1282617)
                     /locus_tag="CNF04410"
                     /db_xref="GeneID:3258172"
     mRNA            complement(join(1279711..1280480,1280532..1280605,
                     1280656..1281371,1281426..1282617))
                     /locus_tag="CNF04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_571402.2"
                     /db_xref="GeneID:3258172"
     CDS             complement(join(1279979..1280480,1280532..1280605,
                     1280656..1281371,1281426..1282188))
                     /locus_tag="CNF04410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571402.2"
                     /db_xref="GeneID:3258172"
                     /translation="MPNIISKILHRKSKSSSSAGTSPSPASKSTPNLSRSTQTPSQSP
                     TTPAKSRHTPPTTVGSRSARNLVNSPGPDVAAQSKDLPDIPSFAAVQASSRNQQRLNQ
                     SPNSSRVLPTKFASPVGQDEEDVVVIDKSSDPRLPEETSLEERPLDEMVRKTSGQIGR
                     SREDGGAFGGGHQTESFDPHSSTEASFEARGPEGLSEKSLNQTLQPIESGGDLKRGKT
                     TRSLQGAENTQKISEFPSPPERPENISRLNGGEANQDLSYLADLVSTGETTPGSIAGV
                     TVPVAGGTWVQSNDRTLATEDNINDKFSTLSTNSRHPQGHPEYDFPRAPSAAGSSTGT
                     STYATAFSTPMADAASLAPSDTTARAVEGASLERGITPTGVDAAPNAITANPATGALA
                     RNVTSATSTSVPTTTTSATPADNAITTASKQEREGRSLDVLEQHRAELNDKIEAGCSA
                     RAKESQPLTEEGYEVFVKAGMKDLVGKADTIETNTRWLEPVVKEHIRPQVHTEYATNI
                     DREIHVYHEYPRILPVEDPNPTTQPTKHRIFSAVDNKWHEVDEATAREVLGDDVFENG
                     PKEVREKRFSLLPGLGEMRKEDQDKWRLVNGKWVEIADVREPYNGRLGGEQEDEDGFL
                     WGQGNGKVWEREYTVGETVSDWKEVAKEKLGLGHKNTESTKKIQTDQVPRSASQSVGV
                     AL"
     gene            1282861..1284185
                     /locus_tag="CNF04420"
                     /db_xref="GeneID:3258361"
     mRNA            join(1282861..1283225,1283279..1283386,1283447..1283681,
                     1283739..1283921,1283977..1284185)
                     /locus_tag="CNF04420"
                     /product="allergen, putative"
                     /transcript_id="XM_571404.2"
                     /db_xref="GeneID:3258361"
     CDS             join(1283160..1283225,1283279..1283386,1283447..1283681,
                     1283739..1283921,1283977..1284089)
                     /locus_tag="CNF04420"
                     /codon_start=1
                     /product="allergen, putative"
                     /protein_id="XP_571404.1"
                     /db_xref="GeneID:3258361"
                     /translation="MSGVTQGVKEFFSKSSKPETTEVCTDTAPEVVQEHIRPQEHVET
                     AEAVDRERHVHHLQHRLQPVEDKQTLNAKHINTTEPVITREHKEEMRPEHQEALAKQR
                     NLARDTRSTGEVEKSGAHVGTAVNEHQHHHIHETVQPVVQRETVDPTVVHKTEAIHEK
                     VEDAPIVHEVTTLPTISADKYAKNKSSIEGEGDHCSTFEGAPQVAGQSSGVSAKNTAA
                     DATSTGRHQSSKTQAL"
     gene            1285977..1286838
                     /locus_tag="CNF04430"
                     /db_xref="GeneID:3258251"
     mRNA            join(1285977..1286096,1286177..1286308,1286375..1286838)
                     /locus_tag="CNF04430"
                     /product="antiphagocytic protein, putative"
                     /transcript_id="XM_571406.2"
                     /db_xref="GeneID:3258251"
     CDS             join(1286010..1286096,1286177..1286308,1286375..1286704)
                     /locus_tag="CNF04430"
                     /codon_start=1
                     /product="antiphagocytic protein, putative"
                     /protein_id="XP_571406.1"
                     /db_xref="GeneID:3258251"
                     /translation="MMSSTSSELCFDCANCVEMLPKGTTKSVTRPEILERLTRIENHI
                     EVQTALLSSMAASKDYEKKVVYTDDDDELEEPDVQLCNVTREMAALKTYKPQPKVTNH
                     KVIIEAALGRLDHVNGDSSIRWAQSVILGLQAAETLQNDKQMMELARVIGCLEACELR
                     WAGDWRAGVASITLKELRTLMI"
     gene            complement(1286861..1291337)
                     /locus_tag="CNF04440"
                     /db_xref="GeneID:3258409"
     mRNA            complement(join(1286861..1287145,1287214..1287557,
                     1287608..1287783,1287858..1287985,1288049..1288152,
                     1288212..1288606,1288656..1289063,1289135..1289815,
                     1289878..1290009,1290066..1291125,1291326..1291337))
                     /locus_tag="CNF04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657457.1"
                     /db_xref="GeneID:3258409"
     mRNA            complement(join(1286861..1287145,1287214..1287557,
                     1287608..1287783,1287858..1287985,1288049..1288152,
                     1288212..1288606,1288656..1289063,1289135..1289815,
                     1289878..1290009,1290066..1291337))
                     /locus_tag="CNF04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658592.1"
                     /db_xref="GeneID:3258409"
     CDS             complement(join(1286976..1287145,1287214..1287557,
                     1287608..1287783,1287858..1287985,1288049..1288152,
                     1288212..1288606,1288656..1289063,1289135..1289815,
                     1289878..1290009,1290066..1291124))
                     /locus_tag="CNF04440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513148.1"
                     /db_xref="GeneID:3258409"
                     /translation="MSDAYDDDDAFFDDPETLNLLVQVEERALQASQAQPKASQLPAR
                     NTVAADNYGNRPKQLGARRTLPQPVNATSNIRAQWKPPVPAAAGGSRSRHGEEPPPID
                     IVVDSTGRYDLAAGSADEAVVTDNRRSKSLALGARLGLGHGRSGSTSSVGGTARKSEG
                     EDGRSTASEERRRAITQALSGAEAGTKTLSRSNSTSSITARLSHAPAPAPPPPSQPFN
                     TARQLSRSASVGSHAGSQVFGAANQPSPLQGNARLPPIPSSGGGSGSQGGQRQRYGNV
                     QAEELLKKERERRIALETELARLRAGTASSNTTTTANAQKVTAGDGGDDLEKKIKELQ
                     AQMWAAKGEAETIRRAQKEEKDRFKAELERLQQAVAEKEAQVKEKEIQSKRMIESVRH
                     QAIFTNHAIQTSAAKPRPQASQRASTSFQFPRHLPTPARGNSTNLAFHADPDVTPLAK
                     GARENHNHRRPPSLAQTPGPASVTPSAFYNAFAATPKIVASGAGSRKKLKTSHEHEHE
                     RSPQPSPPPSPSRSQSQALPTRSQLVPDAHTSPTKSPRGSPRSKAGVSPAPTRHRLRM
                     GGNKGKERTQSSPFRSSPSRVSRRTSSPTASSMDIDDEEPDADWEGDAGKETTDQRGE
                     FLYQLFNHTPLSSYQPLLLSYTTEPSLYRILTYHPPMQPNPPNHLYMTDQPGLRRPDL
                     QQDQHQRPAGPAWGTQYTAQCYELLKTCGTGEMDDFAVLAQGVTRCLGGMLQALVSAI
                     LSERGKQDKDEDKKDVSYYEITALSNLYDLLSSLVHLFPSIITYISEISVIIPATQRL
                     VVEVFSREGKLEEMDTRLKAERNRERRGGGQEKMETEEEGGKKNEDEEKEEEEHESEE
                     VKMEGRVFAAWAVELGDGIAGLCEAMCWYGDGSGIWQGSELVDIILGLTSRSLDSHTV
                     RRGLEVFFAAAIHGNHFAFLTSPTESTPSLAGQPPLIERLSRYLISPHPSASSEEILK
                     MNLMIVKGMCMMAVSNTDAVVLMGSKTILVPALVLVLQAESSKIWGIHAYRTPVEDAL
                     ALLHPSLSLLHQLVFPFPPFDSSSPPATLPSGSAVNPNATPQRNRLCSSQIDSDAPIG
                     IDLVQVLQQTSQIKEFNGLQHMFVSAMGCMAYGIFGEGIGSEQGVEEADLRAIQVLSG
                     DLLENVVEGPEGDVIYELYVPNEEAPPEGIEGDGDKVQVDEDVYQEMDVDEG"
     CDS             complement(join(1286976..1287145,1287214..1287557,
                     1287608..1287783,1287858..1287985,1288049..1288152,
                     1288212..1288606,1288656..1289063,1289135..1289815,
                     1289878..1290009,1290066..1291124))
                     /locus_tag="CNF04440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514517.1"
                     /db_xref="GeneID:3258409"
                     /translation="MSDAYDDDDAFFDDPETLNLLVQVEERALQASQAQPKASQLPAR
                     NTVAADNYGNRPKQLGARRTLPQPVNATSNIRAQWKPPVPAAAGGSRSRHGEEPPPID
                     IVVDSTGRYDLAAGSADEAVVTDNRRSKSLALGARLGLGHGRSGSTSSVGGTARKSEG
                     EDGRSTASEERRRAITQALSGAEAGTKTLSRSNSTSSITARLSHAPAPAPPPPSQPFN
                     TARQLSRSASVGSHAGSQVFGAANQPSPLQGNARLPPIPSSGGGSGSQGGQRQRYGNV
                     QAEELLKKERERRIALETELARLRAGTASSNTTTTANAQKVTAGDGGDDLEKKIKELQ
                     AQMWAAKGEAETIRRAQKEEKDRFKAELERLQQAVAEKEAQVKEKEIQSKRMIESVRH
                     QAIFTNHAIQTSAAKPRPQASQRASTSFQFPRHLPTPARGNSTNLAFHADPDVTPLAK
                     GARENHNHRRPPSLAQTPGPASVTPSAFYNAFAATPKIVASGAGSRKKLKTSHEHEHE
                     RSPQPSPPPSPSRSQSQALPTRSQLVPDAHTSPTKSPRGSPRSKAGVSPAPTRHRLRM
                     GGNKGKERTQSSPFRSSPSRVSRRTSSPTASSMDIDDEEPDADWEGDAGKETTDQRGE
                     FLYQLFNHTPLSSYQPLLLSYTTEPSLYRILTYHPPMQPNPPNHLYMTDQPGLRRPDL
                     QQDQHQRPAGPAWGTQYTAQCYELLKTCGTGEMDDFAVLAQGVTRCLGGMLQALVSAI
                     LSERGKQDKDEDKKDVSYYEITALSNLYDLLSSLVHLFPSIITYISEISVIIPATQRL
                     VVEVFSREGKLEEMDTRLKAERNRERRGGGQEKMETEEEGGKKNEDEEKEEEEHESEE
                     VKMEGRVFAAWAVELGDGIAGLCEAMCWYGDGSGIWQGSELVDIILGLTSRSLDSHTV
                     RRGLEVFFAAAIHGNHFAFLTSPTESTPSLAGQPPLIERLSRYLISPHPSASSEEILK
                     MNLMIVKGMCMMAVSNTDAVVLMGSKTILVPALVLVLQAESSKIWGIHAYRTPVEDAL
                     ALLHPSLSLLHQLVFPFPPFDSSSPPATLPSGSAVNPNATPQRNRLCSSQIDSDAPIG
                     IDLVQVLQQTSQIKEFNGLQHMFVSAMGCMAYGIFGEGIGSEQGVEEADLRAIQVLSG
                     DLLENVVEGPEGDVIYELYVPNEEAPPEGIEGDGDKVQVDEDVYQEMDVDEG"
     gene            1291529..1293308
                     /locus_tag="CNF04450"
                     /db_xref="GeneID:3258041"
     mRNA            join(1291529..1291630,1291677..1291775,1291846..1291953,
                     1292032..1292337,1292387..1292635,1292685..1293032,
                     1293094..1293308)
                     /locus_tag="CNF04450"
                     /product="pyruvate dehydrogenase e1 component alpha
                     subunit, mitochondrial precursor, putative"
                     /transcript_id="XM_571697.1"
                     /db_xref="GeneID:3258041"
     CDS             join(1291574..1291630,1291677..1291775,1291846..1291953,
                     1292032..1292337,1292387..1292635,1292685..1293032,
                     1293094..1293168)
                     /locus_tag="CNF04450"
                     /codon_start=1
                     /product="pyruvate dehydrogenase e1 component alpha
                     subunit, mitochondrial precursor, putative"
                     /protein_id="XP_571697.1"
                     /db_xref="GeneID:3258041"
                     /translation="MSFALRARGLRAATRSLGAKPLRSTLPQVRYVQIDADKSSPMHD
                     LPASGSEPFKVQLHADSFHSYRCDAPPPETTVTKDELINMYRTMVQMRRMEQAADALY
                     KQKLIRGFCHLAIGQEAVSVGMETAITGQDRVITSYRCHTFAVLRGGTIKGVIAELMG
                     RKDGMSFGKGGSMHIFTPSFFGGNGIVGAQVPVGAGVALAQKYNKEKAATFALYGDGA
                     ANQGQVFEAFNMAKLWNLPCVFVCENNKYGMGTSAERSSMNTQFFTRGDQIPGLQVNG
                     MDILAVREATKWAREWATSGKGPLLVEFVTYRYGGHSMSDPGTTYRTREEVQQMRSSQ
                     DAIAGLKKYILEWGATDEASLKAIDKAAKEEVDAAVEEAKQSPFPDQVEFWSDIYYKG
                     SEPTHMRGREKEEVHYYNKSA"
     STS             1293193..1293388
                     /standard_name="CT3"
                     /db_xref="UniSTS:470852"
     gene            complement(1293460..1295784)
                     /locus_tag="CNF04460"
                     /db_xref="GeneID:3258417"
     mRNA            complement(join(1293460..1293986,1294065..1294494,
                     1294557..1294727,1294779..1295092,1295144..1295329,
                     1295516..1295784))
                     /locus_tag="CNF04460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571716.1"
                     /db_xref="GeneID:3258417"
     CDS             complement(join(1293865..1293986,1294065..1294494,
                     1294557..1294727,1294779..1295092,1295144..1295288))
                     /locus_tag="CNF04460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571716.1"
                     /db_xref="GeneID:3258417"
                     /translation="MADRERTSTTSSVTSSSTRVATSTLSSSARTTSTTSSATQNRAT
                     PVTSSRTSSSSSSSSSSARTSSRIITSTSSSTTSSRSATSTTSSRLTRTRNTSTHSST
                     HSSTLTSSSATSSIVPSTTASSTSSSATASSTVAAANANGNQSSSSLSGGAIAGIVIG
                     SIAGIVLIALLITAGIRRKSRAERAKRRSSVFDWGTSAGMENTEAYEKPRYDPPSESF
                     AMAEANNGPQHVSYATNDFAVAPPAAERTEPLSYAERHNPQYSYRNSFQPVSLVPGLP
                     PAQPPAQARGSFPAQPQQQQQNMAGVGGASGAAGVGAATGAVAGSGAAAAAAGPRGVT
                     AGTWVSVKVGFVRSLEDELAVTPGQKLYLHEVYDDGWSLCEDEEHKKGVVPVNCLQSL
                     L"
     gene            complement(1296285..1297689)
                     /locus_tag="CNF04470"
                     /db_xref="GeneID:3258157"
     mRNA            complement(join(1296285..1296444,1296546..1297066,
                     1297124..1297430,1297496..1297689))
                     /locus_tag="CNF04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657458.1"
                     /db_xref="GeneID:3258157"
     CDS             complement(join(1296313..1296444,1296546..1297066,
                     1297124..1297430,1297496..1297600))
                     /locus_tag="CNF04470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513146.1"
                     /db_xref="GeneID:3258157"
                     /translation="MTSPSRSPSPKVPQCPNGLFHFPTDSALVTDADEDVMEIYMCLA
                     TMSDNTDKQDIGKSSEGLGYLDLTRSVLELQLNLTTVSTKAVEEVESYHQRKDARSRG
                     KRGKKKGVEENKGVQSVEVRLQQDLTALKGRKGDTGSVLWRSSLYLAHHILSQYYHPS
                     TDTTPLLDPSLLKSSRILELGCGTGLLAVLLSRICGQYTASDRLENLKLVQRNIELNG
                     LTVGDSKANTLGSLQKSVKLEEIDWAQVSEDGKKRNSRPEPQRNHEEYDLVLAVDCIY
                     NEALVIPLIDTFARYCPVGGRTMVWVVVELRSADVMSTFLDSWLQDASGPWTIVRLGE
                     DAMGDWDGRRPRWAGWVGWR"
     gene            1297793..1300523
                     /locus_tag="CNF04480"
                     /db_xref="GeneID:3258225"
     mRNA            join(1297793..1298110,1298158..1298180,1298229..1298280,
                     1298332..1298414,1298475..1298641,1298691..1298916,
                     1298974..1299571,1299627..1299734,1299792..1299814,
                     1299869..1300040,1300096..1300171,1300227..1300523)
                     /locus_tag="CNF04480"
                     /product="membrane transporter, putative"
                     /transcript_id="XM_571408.2"
                     /db_xref="GeneID:3258225"
     CDS             join(1297858..1298110,1298158..1298180,1298229..1298280,
                     1298332..1298414,1298475..1298641,1298691..1298916,
                     1298974..1299571,1299627..1299734,1299792..1299814,
                     1299869..1300040,1300096..1300171,1300227..1300392)
                     /locus_tag="CNF04480"
                     /codon_start=1
                     /product="membrane transporter, putative"
                     /protein_id="XP_571408.1"
                     /db_xref="GeneID:3258225"
                     /translation="MLPPPSSRQSSYVYSTHARRGSSPSAPKRIASFRSVAENALGLE
                     PEDDDEEEELRAELGVDDEVALAEEQRERGLEETLETLGFGAYHWRLLALCGFGWMSD
                     NSALQCIAVILPRVQVHFNLSSKVVGLLSASTMAGMMIGAVGWGVVSDLLGRTMPFNA
                     TLFLTGVFGIGASFSPSFSILCCWMFCLGSAVGGSMPTDGTLFLENLPHSKQYLLTLL
                     SVFFSFGAVLSSVISLVFLPGASCGTYDGCDIDKHENDGWRRVLFVLGLFNLVCALAR
                     WFLFKLQESPRYLVSNGREREAILALQTIADFNDHTINIQRADVQSRECSAIEPSTRR
                     SSFASPSRDEEGISYGGVESDTERKMKNQPVRSGSSFYKEDEDDMFERSFIPTEGQIE
                     EEREGLMEGESVDNDEVDADMSSRSNDRFKAQIDGWKKAPVVWWKSWIAQMAKLFVPQ
                     WRRTVILMWIIWGSMSYAYTMFNVWLPAVLESRAKGHGDAAIKEALGDFVLYSLAGCP
                     GSVVGAWMVQTRLGRRKSLAICTLCTGLSTFAFIRVEQKWAVVVSSMVISAAATAMYA
                     VLYGMTPETFGTSIRGTACGTSAALSRLTGVIAPVSAGFLLTITPSLPVFTSAAVFCM
                     TAACSMALPFERVGGTGRGSRMMH"
     gene            1304841..1306798
                     /locus_tag="CNF04490"
                     /db_xref="GeneID:3258137"
     mRNA            join(1304841..1305509,1305562..1305781,1305837..1306798)
                     /locus_tag="CNF04490"
                     /product="Ran1-like protein kinase, putative"
                     /transcript_id="XM_571410.2"
                     /db_xref="GeneID:3258137"
     CDS             join(1305153..1305509,1305562..1305781,1305837..1306549)
                     /locus_tag="CNF04490"
                     /codon_start=1
                     /product="Ran1-like protein kinase, putative"
                     /protein_id="XP_571410.1"
                     /db_xref="GeneID:3258137"
                     /translation="MSTSANPLHVAGGSPQFIDGGYIELVAVIGTGAYGVVYLAVDSR
                     YPQPVYRAIKCMRRSGLDERQKHFQRREMGLHRLASGHPSIITMDRIFEEGDYIYVVM
                     DYGDEGDLFSMITDKKRYVGDNELIRSVFLQLLDGVTWMHSLGISHRDIKPENIVCSQ
                     DGTRVRICDFGLATSEERSSEFGCGSTFYIAPECLGDWFPENKTYPTRSGDIWSLGVI
                     LVNLVCGRNPWRIASPSDESFNSYLADPHFLRKILPVSDECLYILTQIFTVHPEERIT
                     LPVLRQLISKVETFSMTVDELRHAHISAQQKIAATQPPVLLSLPKEDDSWSEQEELFA
                     YDDDMETPSLRSDTDSPRYPLCLSPTTSSNGESLPPTPNLIPDECIAFAHQPQSPQFW
                     EYVPKVTFEYDNQRSTDVHIKGSSLFTYNSTPTTYAQ"
     gene            1307346..1309848
                     /locus_tag="CNF04500"
                     /db_xref="GeneID:3258505"
     mRNA            join(1307346..1307534,1307639..1307712,1307799..1308458,
                     1308506..1309848)
                     /locus_tag="CNF04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657459.1"
                     /db_xref="GeneID:3258505"
     CDS             join(1307870..1308458,1308506..1309719)
                     /locus_tag="CNF04500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513052.1"
                     /db_xref="GeneID:3258505"
                     /translation="MVLAHITFKKGEKERDKPSVVQSPTSIAVPNHQSTPSTSSTVGS
                     PTSKYHPSWLLRRKPSISSRRTDAQDNPLSDTESPPTASSSSSFNVQLGFSPKRCASE
                     LEKESESSSSQKDWARILRSRSTSESRSRDGNPGDRPSSSSKKAGWSYSRQMHDGDAS
                     ARVPTPSEAMENVLKDDVFGLSESMGTLGLVTDVRRDVNAKIADDQAALINGMTFPSS
                     PPTPSTLSKIPLSATPIVYPTPLSPPRRSIPQSPRAAQHIQRQQRPDTPPSISRALTG
                     ANKPNVDSSNRYLRSISPSPSPASSRISPQSLNQSQLPRVPVVTTEWLKRKPSTGRLR
                     HNASLSVDNVPVPPSHPMSSTVTSPRPVQNEEKPKALDESPQIEQRTTSSNRNRIVSH
                     SSSTNSDIDGVSSSDGEIGFSSPYRILHGTTPSKSTTRPSGNGPDRGYEVKITCLDDR
                     ADNEEMKWQVTIRQRSSKNSLHHPTSPLQLSTATSLAQAPATASSINLSLSLDKPTGK
                     LVFISFPMDIHATPTTRRRRGSHSQPPTLSQTYTTSPKNMSAPNYRPVTPPPIPRTMG
                     ATTSRPTTPTSSVRKKPPPAWSPPIAPEDGAGSA"
     gene            complement(1309809..1312163)
                     /locus_tag="CNF04510"
                     /db_xref="GeneID:3258133"
     mRNA            complement(join(1309809..1309911,1309977..1310045,
                     1310104..1310161,1310223..1310275,1310327..1310677,
                     1310730..1310800,1310854..1310864,1310912..1311083,
                     1311145..1311181,1311234..1311327,1311378..1311487,
                     1311539..1311655,1311712..1311876,1311928..1311954,
                     1312016..1312163))
                     /locus_tag="CNF04510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571639.1"
                     /db_xref="GeneID:3258133"
     CDS             complement(join(1309878..1309911,1309977..1310045,
                     1310104..1310161,1310223..1310275,1310327..1310677,
                     1310730..1310800,1310854..1310864,1310912..1311083,
                     1311145..1311181,1311234..1311327,1311378..1311487,
                     1311539..1311655,1311712..1311876,1311928..1311954,
                     1312016..1312077))
                     /locus_tag="CNF04510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571639.1"
                     /db_xref="GeneID:3258133"
                     /translation="MPLPQLFKLPYDRVSPKDKESFAYATLVKRWPVVLTNVISAISN
                     ANHEISMSSDADKDAKVAEGKKIISQISEMKYEMGHNALLTPIEEDGEINVECYNTEL
                     ASYPEEDRKWGNMNWLFAECYLYRRLRSYFALTQHWNSYDPFFDQKAETYKSSSGAIL
                     HLAKAINSAVAEKDELNKDFERPGSALEIAFMEMIQADLWGNATDLSLLIDLKYEDLQ
                     KLQAVGSEAQAEQAKFILRNDLSKAWEHFKGLKNGRVDFVMDNAGFELFTDFILADFL
                     ISCTPFVGKVVFHPKAIPWFVSDVLPYDFTWAIDSLLDTTFFSQHASQPLTDEDTASL
                     ISLGKRWKEHIEAGRFKLSVPFDTPLGKAPALGGFWTTQYAYQDLPVMAPDVLAELQK
                     SDLVIFKGDLNYRKLLGDAWWPTTTPFDEAIGPLAGQITLLSLRTNKADTIAGLDEGI
                     AEKLDKEQPDWRVSGKYAVVMFSKRR"
     gene            1312431..1313516
                     /locus_tag="CNF04520"
                     /db_xref="GeneID:3258402"
     mRNA            join(1312431..1312757,1312820..1313516)
                     /locus_tag="CNF04520"
                     /product="expressed protein"
                     /transcript_id="XM_571609.2"
                     /db_xref="GeneID:3258402"
     CDS             join(1312527..1312757,1312820..1313002)
                     /locus_tag="CNF04520"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571609.1"
                     /db_xref="GeneID:3258402"
                     /translation="MSNPLDQPEIPTPVPPSTATPAAASVSQQDHQSDKRQPLAIEYN
                     NPSKEEEVQTLDLGEGNVIKLDKLGPMIINNDGTLSRIQNWQDLHPIEQERTVRLLVK
                     KRNLVRLKNLSDVEKAKGEDNGEELTVLKEGNEEE"
     gene            complement(1313154..1319943)
                     /locus_tag="CNF04530"
                     /db_xref="GeneID:3258484"
     mRNA            complement(join(1313154..1313760,1313816..1313981,
                     1314032..1314843,1314889..1315166,1315217..1315448,
                     1315507..1316793,1316849..1319152,1319192..1319254,
                     1319291..1319665,1319705..1319943))
                     /locus_tag="CNF04530"
                     /product="clathrin-coated vesicle protein, putative"
                     /transcript_id="XM_571414.2"
                     /db_xref="GeneID:3258484"
     CDS             complement(join(1313200..1313760,1313816..1313981,
                     1314032..1314843,1314889..1315166,1315217..1315448,
                     1315507..1316793,1316849..1319152,1319192..1319254,
                     1319291..1319665,1319705..1319743))
                     /locus_tag="CNF04530"
                     /codon_start=1
                     /product="clathrin-coated vesicle protein, putative"
                     /protein_id="XP_571414.1"
                     /db_xref="GeneID:3258484"
                     /translation="MPDISPDVLRVEESRFTGDGSDLSLLHWLRQAEQAIEAISPEDL
                     SKQIQSLHTFFLNLLLPNPNPTLPKPGRPIRHLVTRCVVKLHQRVESRSLFDFVQALV
                     KAVSDGGSKGMSAAENLGRVASWYCIGEVIKEHGKNMMSFMAEICTSSLKVFKNTNLS
                     VLLRTQAMVAFSRSLHSAGKALPDALVKDLLKSLRSGLQDKALSVQRASAKTFIALHL
                     HTPVLQLQPTLDMVAPLSFKSLETADHLTRRAFSRMLAHFLAATQVPGSGVVPESSKK
                     SKPEAEDQSGEPTVMTSVAEDRASKTLFTTQEMLKYLSIPYNKQQSPRKLRNAIIDAY
                     ATLFTTLGGEYVEARYEEIVKHIMDEIVIPQRGGRYEVLATRQAAKILLRDLVGERLL
                     SEPGQVSAIRELTLNYLKKWQPTLLPGQPRINKNVLIVSLHEIAGLLEQLGNAPAQII
                     ELLAEPLVRLLAHESYSVRLSTAFTLRRFCTTNPSQLPRLLGVLIADIEKDLNLLSSP
                     TAPKEVAPRLVGKAFGLSALIAVSPVRPLYVSHDVPTKVFDLAVSLLKRAGDHEIPQA
                     STEIQVAWYLMTGLMSLGPSFVKLHLPQLLVLWRNALPKPSNKDTSVGERGEAEWNFL
                     LLVRECALSSALNFLNHNHSLVNIDVARRLATLFTNTLNYVNGFATAYAEALREQANS
                     PNPSPIFTTRPSLVDREATLRRRVLQCFTVLGPSSATESTQPALLQAAITVFADPENY
                     SGSGAQAAIAAQAGNFVGIWHSADGYAFGVTSLARARDDYGKNGEEDEGEEGWLNRDK
                     VEIELEGQLSRPILGSLEHDFLPLLAAQQPLSSPTPAPAQTGVIDAGLSLFSILFPHQ
                     NLEGQVQSLATLSSHMRSSKLEKNPGRKQAVIVNTVTALRKTLKGVEGAGGKARKVVG
                     SAQVSEMIRSLLQDAIFDPSPSIRSTSAEALGLLSSLASPTHLSSQVQWLVDQVVTNR
                     SPDARAGCALAFGAIYSFVGGLAGGPILKTIVNILMSLATDPHPVVHFYAMKALARVV
                     DAANLSYEPYVLTTLGMLSNIYLLETHEPEGGSLGSVNLRGDLPAYQVICRILHALIG
                     VLGPELQEPGKVRSLVFLLVHEFGEETDEGLAVEAIKCVQQFLMFAPTAIDIPKLVQT
                     FRTHLASPRRPLKVASITALYQIVQRDPVLISKLGGNQLVEDLFGLLDDDPSIDGVKK
                     VISSWLRGTAAALPSGWIDLCQRIMTRTAAQKAAIRRPQQASAPAAGPAFIDDEGESL
                     GGGASTSASSNALSSRWRTQLFALECLHDIVVSVAESNRPEHFDPIIARKMGANGRHM
                     LWSRVGDLIKMAFSASTAGVMEVRAAGLVVLRDVIEKFSASPDPDFESALLLEQHQAP
                     IAAALTPSFGSDSAPEVLSLAVQVCAVFVGSGVVKEVPRMGRILKLLTGALEQCKNGE
                     MLSLGDMEDLSPSAVIMLQISILTAWAELQISSVRQSYLTDVLKPYRWLLAPFWIGAL
                     RDYAQLRTDPEMGGLSGAVDSTAGLGREVLLPYYEQAVPKLLHAVAISFAINDPFAFG
                     AMDGQRYDSPNPPTSVPSIRPEPSANFYIVYGLSFESLLKTIGDVSASPLASACLKAM
                     QSLVKPVLSGTTVFEGQFFDELCTVCYRIAMSEPATVKSEAVEVMSSFATSRKGTGTM
                     DSAQTRRALAIIAFTLRQIVPTKEMKPSWNHVDSTQDKVNLLRSAFMAFAQIIECVEV
                     SQKADMYAVGLHLFMGLLESESPVDLVGGCLGCLKVQMEGLVAAQVPGVSNGEKIVHG
                     VVSACLSNIDDMRTRVNPVANIIIKNNLLAVTLILTALPADLKVSRNLVESVGYTIGQ
                     YLGAGIERPELGLTAIHCASTILPASLRLLPSPLGPNSPPAPSPVLQHATLHLLPPMI
                     TYISDNVVAHATNPDYAPPLEGIQAVIKTLVSWGTGLPEEHKPRGYGVLLPTLCLMLD
                     PPGSTGQGQSSSQLHGVAAAVLLGLAQSGPGAFKEATMAMKEGERGELEHAIRDAVGQ
                     KQGAANGGVAKERKGIELKSFG"
     gene            1320442..1321595
                     /locus_tag="CNF04540"
                     /db_xref="GeneID:3258309"
     mRNA            join(1320442..1320565,1320616..1321127,1321180..1321595)
                     /locus_tag="CNF04540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571416.2"
                     /db_xref="GeneID:3258309"
     CDS             join(1320504..1320565,1320616..1321127,1321180..1321517)
                     /locus_tag="CNF04540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571416.1"
                     /db_xref="GeneID:3258309"
                     /translation="MSLDTSSSAIHLQLPPTSSSLRPPSQITVHPSVIAQILTHHSRH
                     SADSESTRVIGALMGNRSDNGQEVDIRSCFAVPHTEQGQQISVDRPFQQDMVNFLAKN
                     GTKEVIVGWYASQKTVNSNSAIIQEYFSFETNPYPAVHLTVDTDIEESGKGLGVKGWV
                     SQPLGLTSKSECSVFVPVPVSIKYADSERAALDLLTAPQPTPSPALPPLPTLSNSLSQ
                     LSSLIDQCLAYVQSVNNGSQTPDVEIGRYLLEGLGRWSASGNEDEGGVKAGLQDTLTV
                     EYLSSLVRSQVELAGRLSLLQQPVAQQ"
     STS             1322023..1322621
                     /standard_name="Xho21"
                     /db_xref="UniSTS:470853"
     gene            complement(1325093..1327975)
                     /locus_tag="CNF04560"
                     /db_xref="GeneID:3258166"
     mRNA            complement(join(1325093..1325400,1325452..1325730,
                     1325788..1325819,1325877..1325974,1326030..1326142,
                     1326204..1326460,1326511..1326759,1326812..1326978,
                     1327028..1327119,1327174..1327268,1327325..1327975))
                     /locus_tag="CNF04560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571420.2"
                     /db_xref="GeneID:3258166"
     CDS             complement(join(1325373..1325400,1325452..1325730,
                     1325788..1325819,1325877..1325974,1326030..1326142,
                     1326204..1326460,1326511..1326759,1326812..1326978,
                     1327028..1327119,1327174..1327268,1327325..1327594))
                     /locus_tag="CNF04560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571420.1"
                     /db_xref="GeneID:3258166"
                     /translation="MTSEIKHLDSSMEDEKVLTEHVEVAHTVTRDDMEKGRKKRTINT
                     QLDDAAKLLEEAGGHVEYTHADNKRILRLIDFYVCLPMCLVYFIQQLDKASVSYAAVF
                     DLQTEANLVGTQYSWLSSVVYCAQLVCQPLSSYALIVFPVKYWVMFNMTAWSIVTMAT
                     AAGKNFTGLLLARMFLGVFEATILPSFILITQMWWVRREQSYRTIAYQIANSFAAIFG
                     PLLSYAIGKACDNSDKIKSYQGIFLFMGGFSLVLVPVVWILLPNSPTTARFLKKGNDR
                     LIAIDRLAENNTGTKASKFKWDQFWETYKDPKTYMWAAMWFCCACPSGGIGAFGGLIT
                     KGFGFDTFTTILLQMPPGGIGIITLLVSIYVTNKIKLRWPVIAVVCLFPIAGASALTQ
                     VPSTKTGGLMASYYVAYLFSALQPLLISWCNLNSAGTTKRVLTTATMFGALTVGNIVG
                     PQVYLSREAPHYHTGLYVDIACWCILLILVILMGVYLRLLNRRQEARRLALGLPANLK
                     DMSIMSMEEAEAYKAELAQIMRAQGKDMDSLNVNSFDDMTDFENPMFMYVL"
     gene            complement(1328818..1331623)
                     /locus_tag="CNF04570"
                     /db_xref="GeneID:3258092"
     mRNA            complement(join(1328818..1330190,1330247..1330543,
                     1330594..1331623))
                     /locus_tag="CNF04570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571422.2"
                     /db_xref="GeneID:3258092"
     CDS             complement(join(1329046..1330190,1330247..1330543,
                     1330594..1331392))
                     /locus_tag="CNF04570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571422.1"
                     /db_xref="GeneID:3258092"
                     /translation="MSSSTLPPAQPLPLRHLLETYTTSHPLRTPSPLPPSSRVDPKLR
                     QRLPPPTSASPLLWTLPTWWLFIRFVFTKGIHIALALISHFLFGPKRPSWGYRMTFIT
                     SFMRNIADHSSLADIVLIRRFISLHFLVPLPGDAVVTPITFTVPRRKAEQVAKGFLRD
                     LDVAETGSRQLSGEWVVGTEVWKRLRAEKRARSKKQRTSLRHNLSPNEGSSKQTKVEI
                     EPEALKEKGKANERVIYYVHGGAYYVGNAATHRLITIGVSKSCNARVFAITYRLAPEH
                     VFPLPLHDVLLGYLRLLSPPLSIPPENIIIAGDSAGGGLSLALCMYLRDEGYKLPAGL
                     ILMSPWVDLTMSCGSWDENADSDVVPRPETDDHLNPVGCYLGPKGIATYLTHPYASPL
                     FGDFHGLPPMLIQSGDSEVLRDEITLIAHKATLAGINVTHELYEDMVHVFQMFSFLPA
                     TTTAINNVGIWVRTTLPKIEREQRQAAGMDKDQQEVGALDVDVTESMEEEIGKGNRVV
                     AKDGQEIDVPSGRTEVMSEEIDAAQDLSRQQALTTETGFSGSSIINERPTVDTDSLAK
                     LDSDSDSGSPTPRNSRLPSPSVVFPREPRTPPRHFDPFLDVQPQDQSKSSQPHTLPRL
                     RRVQTAVPTAFALSPPPNPRSSVRCRRPTTTSLLTSPSSSVYGQDTSYPTSPTSLASA
                     RRRLRSGTLSFQPPPTTRTRSKSHSDIFNLVEGYVEGGAANETTVYAAGGEVRSVGIL
                     GEDDEE"
     gene            1332236..1333617
                     /locus_tag="CNF04580"
                     /db_xref="GeneID:3258232"
     mRNA            join(1332236..1332426,1332475..1332555,1332633..1332675,
                     1332722..1333122,1333187..1333312,1333370..1333617)
                     /locus_tag="CNF04580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657460.1"
                     /db_xref="GeneID:3258232"
     CDS             join(1332343..1332426,1332475..1332555,1332633..1332675,
                     1332722..1333122,1333187..1333312,1333370..1333399)
                     /locus_tag="CNF04580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513120.1"
                     /db_xref="GeneID:3258232"
                     /translation="MMLGGAPKCESCSKTAYHAEQVMGPGRKIYHKLCLKCLNCGKRL
                     DSGSLVEHDSHPYCQRCHVVLFGTRDLRHANVLPSIPSTPPKPTPPPSVMTPSYHRPA
                     SLTTSSSPRPLPPPTEFYRPPPQRSTPPPEPATPTDPTVPITKPNFREQRPISVPFAG
                     GAKALDDRGLLKKGESPRSKVGGRIIGDDMCGGCGKRVYAAEQVFSVSHKWHRWCLKC
                     NKCKTTLDPSKVSDREGIPYCKNCYAKEFGPSGTLR"
     gene            complement(1332653..1336234)
                     /locus_tag="CNF04590"
                     /db_xref="GeneID:3258148"
     mRNA            complement(join(1332653..1333111,1333182..1333193,
                     1333292..1333448,1333557..1333848,1333939..1334149,
                     1334240..1334386,1334453..1334561,1334621..1334770,
                     1334829..1335004,1335061..1335194,1335255..1335632,
                     1335681..1336234))
                     /locus_tag="CNF04590"
                     /product="NADPH-ferrihemoprotein reductase, putative"
                     /transcript_id="XM_024657461.1"
                     /db_xref="GeneID:3258148"
     CDS             complement(join(1333701..1333848,1333939..1334149,
                     1334240..1334386,1334453..1334561,1334621..1334770,
                     1334829..1335004,1335061..1335194,1335255..1335632,
                     1335681..1336081))
                     /locus_tag="CNF04590"
                     /codon_start=1
                     /product="NADPH-ferrihemoprotein reductase, putative"
                     /protein_id="XP_024513119.1"
                     /db_xref="GeneID:3258148"
                     /translation="MIPMILYASETGNAQDTAERVARAFRANGRAVTCLPMDQFPISA
                     LPHTYLLILLTSTHGRGDPPPAMLPLWTALLRSSLPEDILEDVHFALFGLGDSSYERF
                     CYAGKMLLRRMEQLGATKMGEPAWGDERSPNGIEDAFLPWLQQTLDLYLPYLPLISPT
                     PKIIESTVLPPPIYKISPASTSKSVEHDLSLERLSISFPIPNGKPAPVRVEDQARDKA
                     STSRTKPDDWVWATLKKNIRLTSKDWWQDVREIELEFDDPDTKPYTAGSICSLQPQSR
                     EDDVNMFLEMMELTSQADEVVTIESLLDEQPLPSHLPPAGTPTTLRSLLTNHLDIRYS
                     PRKSFFEWLRRLSTNEMERERLDEFISDPDEIHTYATRPSRTIVETLADFRFTRIPMS
                     HILEILPPLRRRQFSIASSWEDHPGKVQLLVALIEYKTNLKIPRKGLCSSWLNGLPVG
                     TRIPIHIASPTLFLPQDPEVPIILVGPGTGVAPMRAFVEIRVRQGAAKNTSLYFGCRS
                     STTDYFFESEWDVHREKGVKIQVAASRDQEERIYVQHLIKRDKEYVKEWIVDKKGWLF
                     ISGSSNAMPREVREAVAWCISKEGAGDMTEEESKAYVEQMFEDKRGGEESW"
     gene            complement(1336350..1338604)
                     /locus_tag="CNF04600"
                     /db_xref="GeneID:3258329"
     mRNA            complement(join(1336350..1336896,1336961..1337144,
                     1337202..1337316,1337375..1337517,1337570..1337695,
                     1337745..1337838,1337900..1338161,1338220..1338604))
                     /locus_tag="CNF04600"
                     /product="expressed protein"
                     /transcript_id="XM_571635.2"
                     /db_xref="GeneID:3258329"
     CDS             complement(join(1336533..1336896,1336961..1337144,
                     1337202..1337316,1337375..1337517,1337570..1337695,
                     1337745..1337838,1337900..1338161,1338220..1338419))
                     /locus_tag="CNF04600"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571635.1"
                     /db_xref="GeneID:3258329"
                     /translation="MAVPISNVDRIDEKELGTKIDVADVHYEPSTAEEANLGEEIDHA
                     YLNASRTTRFYRGTLFQMILFGALSFVGPAMSDAISNLGGGGLSTAYLANLATCLNYA
                     ASCAITLVGGPLINKIGIKWSCIIAGVSFPLSGSGYYVRARFQVDWYLIFAKTVSGIT
                     SGFLYVAETTAMLSYPHLHERGLYLGIWSAMRNSGSVIGGAINFATNYSSSSAGGISW
                     STYLIFVGFEASGFIFAFLLSPTKKVRRSDGSHVPYSRDMTWKNEFSALYKHALNKRT
                     WLVFMPAFYSFFYGGVYGTYLTNHFSTRARALSSLIVPCCTIIMVTIYGRLLDNRRWK
                     QRTRAWVALAFWAVPQAACLIWTGVIFGKYGNATTAFDYNLNTREWAQAYFPYFFIFT
                     TGYWTQLSIYWILGTFSADVKSSARTGGLFRCFETLGQAIAYGINSHVGDARIPFYVM
                     CALWALAVPSMIGLIRLVPEVPAWNDDVVDGNVEQTLRKTENLEL"
     gene            1339170..1341567
                     /locus_tag="CNF04610"
                     /db_xref="GeneID:3258209"
     mRNA            join(1339170..1339491,1339554..1339634,1339696..1339746,
                     1339792..1339937,1339993..1340094,1340149..1340179,
                     1340247..1340381,1340429..1340488,1340547..1341054,
                     1341104..1341567)
                     /locus_tag="CNF04610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657462.1"
                     /db_xref="GeneID:3258209"
     CDS             join(1339263..1339491,1339554..1339634,1339696..1339746,
                     1339792..1339937,1339993..1340094,1340149..1340179,
                     1340247..1340381,1340429..1340488,1340547..1340794)
                     /locus_tag="CNF04610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513055.1"
                     /db_xref="GeneID:3258209"
                     /translation="MSNDPFESVVITVTLSDRKLAEVRRVFKNVFYHPDGKVPEEHLA
                     LVDIWYTSWLGLPKDIKTISQIPRTRIVQLSSAGANIFLGTELMKSDQAKKKIAVCSS
                     SGIHTLSIPQYIICNVINLYMKLQIQFHLARTNAEWPSRDQVLQHAGAAGQTHPGNRC
                     LYGKTIGMLGYGHIARETARLFKAFNCNVIAANSNGDKRPEEGFRLPGTGDEDGSIPG
                     QYYSTTDPESFKEFLSHCDVLVASLPSTPQTTYMLTESHLRSLPEGAVFVNIGRGDLI
                     RSEDILAALDAEGGLFGAVLDVTDPEPLPSGHPLFTHPSVIVTPHTSGSFEGYFDSGA
                     DVLLAQGDRLKQDLPPINVVDPTKGY"
     gene            complement(1340470..1343062)
                     /locus_tag="CNF04620"
                     /db_xref="GeneID:3258193"
     mRNA            complement(join(1340470..1340777,1340824..1341478,
                     1341539..1341638,1341702..1341895,1341954..1342057,
                     1342111..1342273,1342333..1342605,1342661..1342760,
                     1342817..1343062))
                     /locus_tag="CNF04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657463.1"
                     /db_xref="GeneID:3258193"
     CDS             complement(join(1341099..1341478,1341539..1341638,
                     1341702..1341895,1341954..1342057,1342111..1342273,
                     1342333..1342605,1342661..1342760,1342817..1342945))
                     /locus_tag="CNF04620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513057.1"
                     /db_xref="GeneID:3258193"
                     /translation="MPSINSTPVPVDFTKYFSKETTGRKRSQLKELRPYFEIPGMISF
                     GVGIPHPSTWPVNGMTLSVPFAGKSVFVPGYNSRSPEDMLPLALYQEPSKNEPLRPDL
                     TEELQYSATYGTKHLLSWIKEHIERVHAPPYEDWINLLTAGNTDGVDAVMRACFDRGD
                     YMLVEEFAYPGLLSPAATLGIKCLGVPLDSEGIDPSALDEILTNWDETERGGPRPKML
                     VMVPTCSNPAGVTVPAHRKQEIYAICRKWDLLICEDDPYCFLQIRPNGADSPIVPSFL
                     SLDTDGRVIRVDSFSKIVAPGSRLGFVTGHKVLVEKIMNTRESSTQCPSGFSIAAIAA
                     ILRAWGGHEGFERKYIPHISDIYSKRCLSIIDLLKKHVPSNTIEIPKPAGGMFLWVRL
                     RIESHPSFPSEDPETISKQVFQAMIDEKVLMAPSEFFKAPSTSVWTPEQEAKRIFVRI
                     SFSLPPQDEMEEGAKRMGRALAREWGLEQA"
     gene            1343482..1345739
                     /locus_tag="CNF04630"
                     /db_xref="GeneID:3258286"
     mRNA            join(1343482..1343801,1343852..1343930,1343987..1344347,
                     1344411..1344582,1344638..1344772,1344834..1345065,
                     1345129..1345218,1345313..1345739)
                     /locus_tag="CNF04630"
                     /product="expressed protein"
                     /transcript_id="XM_571428.1"
                     /db_xref="GeneID:3258286"
     CDS             join(1343640..1343801,1343852..1343930,1343987..1344347,
                     1344411..1344582,1344638..1344772,1344834..1345065,
                     1345129..1345218,1345313..1345566)
                     /locus_tag="CNF04630"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_571428.1"
                     /db_xref="GeneID:3258286"
                     /translation="MVLPIDNPTKSFWIEGAESPYRDHRSTPDLPSEIDVVIVGSGYT
                     GATMAYWIHKFTQNGQTPNMLVLEARDICGGATGRNGGQLRPHFYSRYPAWSARFGPD
                     GALKVIQHEAAHLKAFDKVFNEEGIAQKVCFKLGETFDAAMSEEAWTRLRGAYEHMKK
                     DHGENGDIIKQCRLIEDPKEAEEFTQMKGCIGAVVHPSGQVWPYKFVHAVLELVMNTG
                     KLNVQSHTPVLSVSERDNDGYITVNTERGSVRAKTVIHATNRWASHLLPEFKNLIFPG
                     RGTIAAIKAPEGFLKHTGAQHWDSIVNNYHLQLPPPFNTIILGGAKPLTVHDPKQYVN
                     NDREDLQFAGVPDFYQGWPQRDIVGWQGKDPADLEKTVEEGGVWTGVYSASIDSFPFV
                     GPVPGKPGQFVAAGFAGHGMPRILGSTAHLTPIVLSELGIHYQTPTAANIFPPLPEPF
                     FATPDRVEKLQAIDAAAKFQEEINEGLLSSKKPFAGPVPQIVTT"
     gene            complement(1346424..1348405)
                     /locus_tag="CNF04640"
                     /db_xref="GeneID:3258440"
     mRNA            complement(join(1346424..1346726,1346783..1347156,
                     1347213..1347430,1347485..1348405))
                     /locus_tag="CNF04640"
                     /product="SNF1-related kinase complex anchoring protein
                     SIP1, putative"
                     /transcript_id="XM_571430.2"
                     /db_xref="GeneID:3258440"
     CDS             complement(join(1346643..1346726,1346783..1347156,
                     1347213..1347430,1347485..1348338))
                     /locus_tag="CNF04640"
                     /codon_start=1
                     /product="SNF1-related kinase complex anchoring protein
                     SIP1, putative"
                     /protein_id="XP_571430.1"
                     /db_xref="GeneID:3258440"
                     /translation="MGNTPSHQQQPSRVSPPSTDAPQRHPSLRIHMPRRHVSPQSSNP
                     TSPSSGRPGSGSPRRRKSLELPDLNKLSFTPAALTPAAPVPTTHTHTSHHFAPSTAAG
                     HHARHPASPPLPGTPTGAPSLGSEAANGSGTGSSNRYWRDQLGARASPLAGANSLGAL
                     SKLEPTLSASSTGSRGGAMGSDVNPFFPDPYGVQDPSARNVKAIPIPIPGKDKGQDQP
                     QVQQATAQAQAQPRPSDLGAIVPVQEEKPKDDGLVDVQIQWNGGGRNVYVAGTWDGGW
                     AKRIKLHRSTHDFNTTIRLPPGQYRLKFIVDDSWRCSKQISTAVDDDGTLVNWIEVEA
                     PKTAEEIKAEWAMDSEPAAKEEDTDESQWTSEIPPALILYQYIEELPFRFHPDELSSF
                     LKSVPYIPNVPAPPTLPRILDKVIVNNDSKRLWDSKDHKGQPGYQHAPPAGVDDNSML
                     AVPNHVVLNHLTASAIRNGTLGVGTTTRYRKKYITTMFFRDQPAPNEHPANQPVPQSA
                     H"
     gene            1348534..1351694
                     /locus_tag="CNF04650"
                     /db_xref="GeneID:3258277"
     mRNA            join(1348534..1348734,1348787..1348928,1349039..1349135,
                     1349243..1349343,1349405..1349536,1349587..1349705,
                     1349763..1350206,1350268..1350350,1350405..1350534,
                     1350595..1351151,1351216..1351694)
                     /locus_tag="CNF04650"
                     /product="SNF1A/AMP-activated protein kinase, putative"
                     /transcript_id="XM_571611.2"
                     /db_xref="GeneID:3258277"
     CDS             join(1348575..1348734,1348787..1348928,1349039..1349135,
                     1349243..1349343,1349405..1349536,1349587..1349705,
                     1349763..1350206,1350268..1350350,1350405..1350534,
                     1350595..1351151,1351216..1351500)
                     /locus_tag="CNF04650"
                     /codon_start=1
                     /product="SNF1A/AMP-activated protein kinase, putative"
                     /protein_id="XP_571611.2"
                     /db_xref="GeneID:3258277"
                     /translation="MASRPAPQAPTHYSRHRPQSITGNNAPQSRTKPRIGQYIVERTL
                     GTGSFGKVKLATHAVTGHQVALKLINRSKITTPDMNARVKREIQYLKVLRHPHIIKLY
                     EVITTPTDVIMVMEYAGEELFNYIVQKGKHGMTEDEARRFFQQMIGAIEYCHKHHIVH
                     RDLKPENLFLDSRRNIKIGDFGLSNLMTDGDFLKTSCGSPNYAAPEVISGKLYSGPEI
                     DVWSAGVIMFVLLCGKLPFDDEHIPTLFKKIENGVFHIPSHVSEPARHLLKRMLEVDP
                     LKRCTIAEIRQMPFFQENLPRYLQPLPELADMERYPSLTMDDMTTLLLINEGQADPKK
                     VAEDKGLVFSEDLGVIDPDIVEELLEKITTYSEGMVWEALKMPGDNQVKVAYQLVRDH
                     RRILKDSNAYEDEDSSAMEEFMASSPPAWNADIAPPIDVQQNGADEYPDLEDVDLEIQ
                     DIPNAHFDVLDSSLPGWMTPPSSSTSAMSTPTTTHPTSAQNSANPSFSSVTSDTTASG
                     STAEEAARALLSPAPSSASQSVTSFSSPTPQPQPQRRLDKSMTKPKWHFGIRSRSPPM
                     EVMLEIYRTLNVLGMQWRLKDIPLPDIGGAPPGGYSEEVELVLEDLKEKNGERPVMGR
                     KPPSKKDAMAQEKLAQGLYHVETRARYGDVMVRMDLQLYRVDDQHYLVDFRNLGYYMV
                     SEKDMSLPDVSRQGHSHEEGASNAGGSVPSATSATAAGAKEAGIGGVSGPFHFLEMAC
                     QLIAELASG"
     gene            1351942..1355057
                     /locus_tag="CNF04660"
                     /db_xref="GeneID:3258465"
     mRNA            join(1351942..1352287,1352334..1352397,1352454..1352634,
                     1352693..1352759,1352815..1352924,1352985..1353239,
                     1353307..1353742,1353808..1353911,1353971..1354083,
                     1354177..1354532,1354609..1355057)
                     /locus_tag="CNF04660"
                     /product="carnitine O-acetyltransferase, putative"
                     /transcript_id="XM_571613.2"
                     /db_xref="GeneID:3258465"
     CDS             join(1351996..1352287,1352334..1352397,1352454..1352634,
                     1352693..1352759,1352815..1352924,1352985..1353239,
                     1353307..1353742,1353808..1353911,1353971..1354083,
                     1354177..1354532,1354609..1354967)
                     /locus_tag="CNF04660"
                     /codon_start=1
                     /product="carnitine O-acetyltransferase, putative"
                     /protein_id="XP_571613.1"
                     /db_xref="GeneID:3258465"
                     /translation="MTTIPQIPSDTTTTKPHINPNPNPPPRPPDLPRLPIPPLKDTCA
                     RYLRALEALQSPKEHAKTKEVVKEFLEGGEGTMWQEKLEEYAKDKESYIEEFWYESYL
                     SHSDSVVLSLNPFFVLSSDVTPRSNPQLSRAAALITSTLFFIHDLRNGLLQPDAVRGI
                     PLDMSQYERLFGTCRVPTDTGCRMEVHGNGRHMVVLRRGQFYWFDCLDSKNRPLLTDR
                     EILHNLDAIVKDADKIPTHEIAKDSVGILTTESRKIWSGLRSDLINSNKLNKSCLEVV
                     ESALFIVCLDDAGPEDMAELCSNFLCGGYKLEGGVQVGTCTNRWYDKLQIIVCSNGEA
                     GINFEHTGVDGHTVLRYAADVYTELVLLYAKTINPSTPSLFQAKLSPFARSAKGPPPT
                     PEDEIDTTPKKLEWKLTPSLRAGIRFAETRISDLICQNDSQALEFKGYGGTFIKRHGF
                     SPDAFVQMAFQAAYYGLYGRVESTYEPAMTKSFLHGRTEAIRTVQPESVAFVKTFCSE
                     TATPQEKIAALHKACKRHTQLTKECSQGLGQDRHMYALHCLARKEVMAYEAAHPTSTL
                     SPRVALRRASLASTNNGDLPNGNGNGNGNGNGLMSPPKLYSPEIDLDRPTIPAIFTDP
                     GYNLLGTSVLSTSNCGNPALRLFGFGPVTPEGYGIGYIIKDEGISVCMSSKHLQTRRL
                     LHTLKAYLLETQRILIQMWKEANERPVTSFMDHFGILRDARTGKPISMEVEEEEGKEA
                     GEEVLGGFGFFDVGAQNQIPQSRRRKALVGKTLSIAEY"
     gene            complement(1355331..1362273)
                     /locus_tag="CNF04670"
                     /db_xref="GeneID:3258395"
     mRNA            complement(join(1355331..1355902,1355956..1356044,
                     1356098..1356231,1356277..1356517,1356569..1361325,
                     1361377..1361554,1361605..1361695,1361747..1361873,
                     1361923..1362061,1362119..1362273))
                     /locus_tag="CNF04670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571633.2"
                     /db_xref="GeneID:3258395"
     CDS             complement(join(1355476..1355902,1355956..1356044,
                     1356098..1356231,1356277..1356517,1356569..1361325,
                     1361377..1361554,1361605..1361695,1361747..1361873,
                     1361923..1362061,1362119..1362220))
                     /locus_tag="CNF04670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571633.1"
                     /db_xref="GeneID:3258395"
                     /translation="MFGNNAFGALAMDSAPSSAGPSNQVVEGDEVDVSWLKLIKRNQG
                     VDVRVSEKINLEGLPDECSLMAVVNTWGLVVVGGNSDVRIHRLADIHRLINEAPGGNK
                     TLPESAPVRTISLPARPVWVKSAVKDEYLVVATANGAGVFVWKLRDVVAGDTSPLHSF
                     TSNIPTTLLDVLPNPSADQLGRLVALVAKEGLVMADVEEGKLMPPVAGPFTCAGWSAK
                     GKQIVVGKPDGQLTQYTPDGTPKSDIPSPPGLNSHASFVQWLENDLFLVTYVQNMESM
                     DSDPIEQYVIHRQKPSFTFTKFYDPLNGMGYPSRSEAFRHFAGLGAWGTESKHLAFII
                     SGAATDIAVMNGRPDEGGKWEVLFLDGSERGTMPVANPKTGRDNTSTLGLAFDFTSKD
                     TVQQSTDGTLPDLAPLPRLLAYSQEGVIISFDVRNPDAGPYSGMITARDISSAGAPAE
                     DAMDIGAEPSSVPTSTPSAPKPAAFGSASGSTAFGQSAFGNSKPGTFGASAFGASSKP
                     STFGASPAFGQTSAPDATAGSSSPSAAFGQSAFGSSAKPSAFGTSALGASGASAFGQS
                     SAPIGSTSNAASPASAFGAAKPAFGGFGQQSSQPTAFSQSSFGSSTAPSAFGQPSSPS
                     AFGGKSAFGQPAFGQTDKSASPAPSAFGTSTTPSAFGKPGNPASLASSAFGTSSPSAF
                     GQSNKPASVAPSAFGTSTSTTPAFTGFGPKPAVGGSSSGFGRSAFGQKPEEEKKEGTS
                     AFGQSAFGGASGSAFGGSAFGTSAFGQKPASSPSPAPSTEVSKPPAFAGFGQPKTETF
                     KSSPSPAPSANAEKNDFGLGGFASALETSKPTSVPGLEESPPSSPVMGVGKKPAGLDD
                     DTPPNSPPVKPAVATPNPIATPGAPSSTTPSFFKPATAFGNTAPSFGFGQAAEKKTGA
                     TAFGSSFAPATGAPGSTTPSSGASAFGTPAFGKPSAIGSSTASSPAFGQPSKPTGSAF
                     GFGQSSTPTAPTSVAAAKPIGNISGGFGGFAAASSKEPAKGFGAFASGGGSVFGGGQR
                     SFGSKPASSSPFGNASPAASSFGSKAGSTFGTKPSPPEEKKEEEAKASDVPEPITAKS
                     VAPSFAEVVKEETENEMKEEEVKGFDVPEPIAQKGNAPSFAEITKESIEKNEEDKPEV
                     PEPLASKENAPSFAEITKENAQEKDEDAKEPEVPAPIAEVEGAPSFAQVASHAPESTT
                     PTQEPAKTTVETAQILTSEGSPTKSKTDTPAPKEDADIEKLSEKEKAEDVAKSEHEQT
                     EADTEDSREEKAVAKEHNEVPDQQQIEGGQSTPSAADTKATTPLAEPVIEEPPSGESS
                     PIESEAEVVEQEEGESMNGEDFGDEEPYDEGEREEEEHDENEYDEEAHEQEQYDEEDE
                     YDEDEYDEEEQYGEDEEQYDEVDEYDEEREQRSRSLSFTSDISPVNEQAEDSDEKVDH
                     EDVERDEEEDAVSEKPESSAKKSPPAWFTKPASTPTPPADKKAISPTPTSEGASFFSR
                     LNPAPATTEQPRSSLEPPKLPFPFKHAAKTSSPLSGPPLGQSTTPESSPAKPAIASAF
                     GSLDQKPTEAIKTDTDKTKTPVPPGGFSLFGQKPADSAKPPAPAISPLGQKPAEAAEP
                     AGQKPSTVTFGIFGQPKIEPSKSLPSTESTKPTGTSGFSLFGQKPAETTKSLFSTQPL
                     TVPSTPSAITTPVAARTIPEEKAAKSTDLGLGKPSAPPGPSSLFSIKPAANPQTPFFT
                     PMAAGPATPSTPATPARAPGPSKPKIADLSDVTAPTRPDVPERPAKATAIEKGPMGTV
                     AVKVIEQLNDEVQRLKDALAANAEYHQQLRTRNAGTVEFHALVNLVEQQSVIPFSQIS
                     QVQRLIDELYPTVTKQRDSDAMAERKLADLRSKMSRMDMKIGQVEKLIKARRDSSFSE
                     AARLMDLDPEQAAYQAKLRKATQDAEGQIEQLENLLAGLKRRAERQEHRQNPSQPPLE
                     RIQRSVRNIDAAIRERQQTIDELSRRIASLRVSTPREILLSQSVARGPINFEPTKEMI
                     AEIEASMASTEPKRKRLEKIKVARLTKLSVRRDGEDGGTVKQGSFTHEFVANGPIIIN
                     EIPLPGKLSPPPSPATESLP"
     gene            1362439..1364036
                     /locus_tag="CNF04680"
                     /db_xref="GeneID:3258470"
     mRNA            join(1362439..1363026,1363077..1363164,1363232..1363552,
                     1363616..1363716,1363777..1364036)
                     /locus_tag="CNF04680"
                     /product="polynucleotide 5'-phosphatase, putative"
                     /transcript_id="XM_571432.2"
                     /db_xref="GeneID:3258470"
     CDS             join(1362508..1363026,1363077..1363164,1363232..1363552,
                     1363616..1363716,1363777..1363941)
                     /locus_tag="CNF04680"
                     /codon_start=1
                     /product="polynucleotide 5'-phosphatase, putative"
                     /protein_id="XP_571432.1"
                     /db_xref="GeneID:3258470"
                     /translation="MSTYIPIHDRPPHYANLPSPPSNSRQPRPPRYSSPDIDPDIPLA
                     RMSSAHESDPSEQANATQSGDYVPRQRVGSQGAEQEGQSRKRARTSPSHSGGNGSYVP
                     RQRTEESHHSHHNGHSGHAQSDQHGNGQVYRPRHGQAPLTGSIFNLSPRNPFTSVVGD
                     FIMNAAMGHSNVEIELKLGTFMTPSMPGQQPRRINMPTLSEMIIPHDYPNGPFVSTIN
                     HLHHRTLNELLNRAVESQSTHPTGRLYFSRSKLADSFYDHSEHGHGKVRVSRDMDNGH
                     VVQAVEKRRIADLNVYCPGMAYDFRISVNTETPCEVPTGNAKSVRYKDRACYRHQVCR
                     VDLTSVFSSNPRNADVPPSRSFELEIEVLDVPALLAEGAAQSERFDEILQNVLDSARM
                     LVKNI"
     gene            complement(1363980..1367702)
                     /locus_tag="CNF04690"
                     /db_xref="GeneID:3258189"
     mRNA            complement(join(1363980..1364298,1364367..1364527,
                     1364598..1364725,1364810..1365876,1365933..1366172,
                     1366228..1366335,1366386..1367179,1367229..1367288,
                     1367339..1367702))
                     /locus_tag="CNF04690"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_571434.2"
                     /db_xref="GeneID:3258189"
     CDS             complement(join(1364059..1364298,1364367..1364527,
                     1364598..1364725,1364810..1365876,1365933..1366172,
                     1366228..1366335,1366386..1367179,1367229..1367288,
                     1367339..1367609))
                     /locus_tag="CNF04690"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_571434.2"
                     /db_xref="GeneID:3258189"
                     /translation="MRTSSGLRGIRSSLFFLSTLCLLIVCLPTALGLQQELAGIVDWH
                     KPLIGEPLLEPTPPLFVEGKGIDGGRVVQLTKKNLLAVLNAENGEIVWRQALEDNDPV
                     VSFHVQEDTILLLSGPSASSARLFSLTTGHLLWHAPLLPLSQSHLITPVYLGTDAAYV
                     AAQGSEPASWLVLSDGKRITRLSSDKGDILWSMESPGAGSNMVFKQIMPSGNSIHILA
                     LHYSFAVQSLLTSTIALDKPIPRADFGQVPSVVQIPEQAMIASAHETGTAHIVWIDHG
                     RIRSLHLNEGGTLGEIKEILPGKGRLYGSIIDVGLRHKGYILGKREDGGVEILDVRDG
                     KKVEEFELSKDSPERSDSVYSAMVTERGVLVNRVYWSYNMAVGVAQSISIPASATSEV
                     ITSGFTFAFDDLVHGVILHAAVSPSVNERHLPSLILTTSSHAIQRMQFNGAQWTREES
                     LADVTAVMFVDLGEPEVEEVREVLDEEGFGARLLRHLGELKDLPAYLVRFIKRFTSAS
                     YSSALRITPLNQTKLHRDQFGFQKLVILSTANGKLFALDSSNGATVWTRNLGLMTEKG
                     SDVKVDGMWIVRQNEGGVLLGVLASKTVDKGGVRTVAYHVDAYTGEVSGNVNTGTGLP
                     EGTTLFEGKLREAFLTPFDNCGSKSKVLGVVDDKERLHLWPGCKKVTKTMKEAANKLF
                     FTTTTKSIDGTAIQGFTPSATPLNESSYTYTSSLIWSHPFREDEMILESQPVTLDAIA
                     SFGRVLGDKSTLYKYLNPHLLILSTFSPSTKGLNPVTHKEVGLGRVYVLDTITGETVY
                     ATEIDGVVKRGGIHVAMVENWLVYTWLAEGGYRIGSVEIYEDTEKKGVTPAVSSFVSK
                     QVKAFAQTFIIPSEIKALGFTTSKAGITTKELIFVNNRNQIISIPRRLLDPRRPMGKP
                     TSRDKEEMLIPYDNMIAIDTRKIISHEYQVQGTTSLLSSPALVESTSLLLAYGQDLFL
                     TRGLTPSGTFDILSDNFNKIQLLLTLGGLSAGIFVAKPAVKRKWLRMKWY"
     gene            complement(1368817..1371105)
                     /locus_tag="CNF04700"
                     /db_xref="GeneID:3258415"
     mRNA            complement(join(1368817..1369121,1369172..1369691,
                     1369742..1370323,1370369..1370661,1370697..1371105))
                     /locus_tag="CNF04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_571436.1"
                     /db_xref="GeneID:3258415"
     CDS             complement(join(1368960..1369121,1369172..1369691,
                     1369742..1370323,1370369..1370661,1370697..1371080))
                     /locus_tag="CNF04700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571436.1"
                     /db_xref="GeneID:3258415"
                     /translation="MAKSQKQTEKASKQTPNVASQDLSAQVQKLEASLSTDDFNPNPL
                     LPLIALARHNDPQVVHKAVWALHRVFIKYIVNEKVAGLGGDLVTPVKKPEVEGDVDVK
                     GWVRERLLEYVEILGGLIRDAEPALRSSSIPLLFSLLPPLSASASSTPIIHIPYFRLL
                     LHYFIFPSQSLRGAKPKQKGSGWKIVAANQCEDEKGVLPEDVAGIVSGDFWAAYDDIR
                     WAFFKEAAQLAQTPLTAPHSNNLLALTLPLTNLPKIPADINTFYLPAFSSPPSDPNST
                     TTMKKSRSARTKKGKAAADVDALPEWMKAYESSDSESDSEVQSGKRKRTRTSQLSIHA
                     SIYSIPSQTSVYTSLWESILSSVPLDEVWTRKILVGLHGEQGILAHFKKERRLRIADW
                     LGSLVDGGGAMAMLAMNGLFVLMTEYNFEYPNFYTRLYSLLTPVLLHTKYRARFFRLL
                     TIFLSSSLMPSTIIASFIKRLSLLCLTAPPQGIVMVLPFIYNLFKKHPGCMVLLQRKS
                     SEDSLLAVSSFTPTTTTVNPKDVDPFDPEEKDPLKTKALESSLWEIAALQHHYLSSVS
                     TLAKVFSEPFTKAEYNIEDFLDHSYNTLFETEANRRIKNAPALSIGIETAGGKDIAAF
                     PPAGNNEGEDENGDVVAQLWAF"
     gene            1371281..1373161
                     /locus_tag="CNF04710"
                     /db_xref="GeneID:3258429"
     mRNA            1371281..1373161
                     /locus_tag="CNF04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657464.1"
                     /db_xref="GeneID:3258429"
     CDS             1371859..1373025
                     /locus_tag="CNF04710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513061.1"
                     /db_xref="GeneID:3258429"
                     /translation="MAPGPTSTSKWTSHPSGKRHILFTSFATEGALPSHQQVSGTSQL
                     EEEWAVHGPRTYMLPCITPANEPNEQSDRSTKAALEFVQRWAEASDPSRIYDESLELD
                     KTLDWPEPTASFLELKRFTEDYVSNVQQKLCRRVADEVAKNMDNNDFFTYSVVDWPEF
                     TSKGGMIPSGRIKHMDLDEYITQFMIATEDRNAWEEAQSMQKGSSIVFFTSGVRNPSG
                     VYVKPDGEWDTYDPSCWIQECSISNPRNRTEEMAKSVDFANEEIAKQYLSPYSNIGLP
                     SVSNSGISLDSDVENFQDLNGRFADALRSHSRRIASEINNTLQSSGATTGVSIKWVSP
                     ATFQSMFPQNNLPPSMMSKGGELPGYEQLLGQRLLKARHQSINNRQTEDTFGDS"
     STS             1372501..1373350
                     /standard_name="Eco17"
                     /db_xref="UniSTS:470854"
     gene            1373506..1375769
                     /locus_tag="CNF04720"
                     /db_xref="GeneID:3258393"
     mRNA            join(1373506..1373539,1373601..1373831,1373899..1374128,
                     1374184..1374414,1374466..1375212,1375263..1375425,
                     1375502..1375769)
                     /locus_tag="CNF04720"
                     /product="pim1 protein (poly(a)+ RNA transport protein 2),
                     putative"
                     /transcript_id="XM_571614.1"
                     /db_xref="GeneID:3258393"
     CDS             join(1373527..1373539,1373601..1373831,1373899..1374128,
                     1374184..1374414,1374466..1375212,1375263..1375425,
                     1375502..1375659)
                     /locus_tag="CNF04720"
                     /codon_start=1
                     /product="pim1 protein (poly(a)+ RNA transport protein 2),
                     putative"
                     /protein_id="XP_571614.1"
                     /db_xref="GeneID:3258393"
                     /translation="MPPRRSTSRAASAKPPSRAPSSRLAKVPEASIPAANGNTKRRRV
                     SDTGEPVAKKGRPSTASVAGRGPKKIIGGINAIPSIPPVKTPHNALFVWGTGDQGQFG
                     LGPDNLDEIGRPKLHSWFEEQIEEGKLSRDGKPGSGGLESVYCGGMHTLAIDEAGRVR
                     SWGINDNAALGRITTDVPDPKNPDEMIPNEDLESYPYVVETLEKEGFRAVQVAAGDSI
                     SVAISDKGELRAWGSFRSNEGILGFDGVPGHPKFQYTPISLPALAKVQITQISCGADH
                     VLALTTIGHVYVWGKGEENQLGRRIISRRRINGLEPERLGLRNIVHVAAGIYHSFAVD
                     NKGVVYGWGLNTFHQTGVAEHQDMIITPTVVDALHPDKHNGSKVIKVSGGEHHSLFLF
                     DNGEVWGCGRCDANELGLAEDHPAFEGIKERREELQREREERVAEKQKKLDEVLKKDK
                     VDEEEKQKAEAELSEAQATLKVPPSGEYVPEPVRICFPPIPEKYEVVPEFPAYKDSKP
                     EDNPVVDISAGMRHNLAVSKSGHLYAWGYGNLAQLGLGSEEVAEVPSLVRSKLLRPYR
                     SVTVSAGGQHCVALAVKKPDGEQN"
     gene            1376303..1378014
                     /locus_tag="CNF04730"
                     /db_xref="GeneID:3258158"
     mRNA            join(1376303..1376398,1377086..1377176,1377241..1377376,
                     1377451..1377554,1377611..1378014)
                     /locus_tag="CNF04730"
                     /product="nonhistone protein 6, putative"
                     /transcript_id="XM_571615.2"
                     /db_xref="GeneID:3258158"
     CDS             join(1377088..1377176,1377241..1377376,1377451..1377554,
                     1377611..1377632)
                     /locus_tag="CNF04730"
                     /codon_start=1
                     /product="nonhistone protein 6, putative"
                     /protein_id="XP_571615.1"
                     /db_xref="GeneID:3258158"
                     /translation="MPKVSTKDSKKSTASDAKKRTKKDPNKPKRALSAYMFFVQDYRE
                     RIKTENPEATFGDVGKLLGIKWREMNENEKKPYEAKAKADKERADRENADYKAEGKAS
                     KKAAKADEESDDDE"
     gene            1378183..1380249
                     /locus_tag="CNF04740"
                     /db_xref="GeneID:3258083"
     mRNA            join(1378183..1378641,1378700..1378716,1378790..1379379,
                     1379453..1379581,1379645..1379755,1379889..1380249)
                     /locus_tag="CNF04740"
                     /product="diacylglycerol cholinephosphotransferase,
                     putative"
                     /transcript_id="XM_571616.2"
                     /db_xref="GeneID:3258083"
     CDS             join(1378284..1378641,1378700..1378716,1378790..1379379,
                     1379453..1379581,1379645..1379755,1379889..1379976)
                     /locus_tag="CNF04740"
                     /codon_start=1
                     /product="diacylglycerol cholinephosphotransferase,
                     putative"
                     /protein_id="XP_571616.1"
                     /db_xref="GeneID:3258083"
                     /translation="MRITKAQFTGLDAYKYSGIDKSVVSKYILGPFWAWLVTLFPKNI
                     APNTITFIGLCFVFTNVGTLLFFDPLYEGGALPSWVYFSFAFGLFAYQSMDAIDGKQA
                     RRTGMASALGEMFDHGCDAINTTLEVILASHALGLNQSWWTVASQVASLCNFYVSTWE
                     EYHTGTLYLSAFSGPVEGILLIVGIYIITAIHPLGSGFWSQPLLKPVLYLAPQLFPYV
                     QKVDGLLESVGVWKYVRLESIPANVAFMSFGAIGTLANIVTSYHNVITSRRKAGKPIF
                     PPLFGLLPFFTHTTILLAWLHAESKGGVCIVHDSRMLPFLGYWGMAFSYQVSQLILAH
                     VTKSSFPYWNGMMIFSLFGAADANMGWLFGREPLVQSSPVAANVFIWMSFVVALFNYV
                     RFAREVIWQICEYTGLACFTVRHKDENGKWVQNGKKTQ"
     gene            1380493..1383767
                     /locus_tag="CNF04750"
                     /db_xref="GeneID:3258356"
     mRNA            join(1380493..1380584,1380636..1380733,1380783..1383599,
                     1383669..1383767)
                     /locus_tag="CNF04750"
                     /product="expressed protein"
                     /transcript_id="XM_024657465.1"
                     /db_xref="GeneID:3258356"
     CDS             1380790..1383582
                     /locus_tag="CNF04750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513114.1"
                     /db_xref="GeneID:3258356"
                     /translation="MSTPEAGDQPNSSLSALTSSIDNTSSPVDFLNSLLAPLLPPSLP
                     PPNKPQPPSLQPIDTALNDLLTQLSLLSQDTASAIEQGMSDVSRTVPRLGYDLQFMRE
                     SANGLSVSLGMVQGRVARQADYEMPNNKFPGGEESEAVKAFRALEKITHLDKLKTRLE
                     SARDTLREAESWSTLESEITTLISEKEYAKAGQRLAEASRSMVVFKNEPAEWEERKRL
                     LVSLGDELERVAGEALRESLKKDDGVDEVRAFWEVFMDMEREEEFKGWYFKERGRGLL
                     EAWKEPLVEEGQGENSSKLSDFLPKFYSLVLQTLSAELSYIPLVFLPESSPSILASFF
                     QSTLDSLDPTFSNRLAAVADYHGPGALPELVKAWEATVDLGAGVQGLIDKIIFNTQGG
                     LLSGGAGEIDVESPATILTSPGISSSSPNHPIPRTNSHSHSKRHQSISRRFSRAPNAT
                     TTSLSPSPGNVDDAWETTLYEPFLDWQSSYSSLEKRCLEKEVADLKTSWEKANMKQGG
                     KDVMSGMISRTAELKGRLEEAVARCRIFTFGFGAVHLIRAVDTCISRFFDDERTSILN
                     NAKSKRDNNKQKDKADELDLDELDDDGGDWSGWQVGLHILDSLQKVAEKLVAMEDGLK
                     AELSEYAKMLKAQKGEKWDGQWDGRKATFGTVSLLQQSTLNTADLHALIASAPSPILP
                     QSKSSLLTFIRESQIHLQQTILSPLLTQLDTYPSLAVWIKADKQTKIRKGELYVPQFS
                     LSPTDVITRTSEGLLDLLRVFEVYGGEKALGWSLGSLPFVEGMGHAVALDCLSSSRKD
                     TNKEPSTSISDPTTTATSTSVSLAPIPSSTPAPTPETIQTTWISSLTLSLLSHFTSYT
                     LPSIQHLSQEGQAQLKEDLGYLENAVRALDVEWSELGEWARAVEMEEEEWRENVKREG
                     REGALAAVGRMRGWKF"
     gene            1385947..1388325
                     /locus_tag="CNF04760"
                     /db_xref="GeneID:3258060"
     mRNA            join(1385947..1386155,1386246..1386471,1386546..1386591,
                     1386653..1386732,1386799..1386865,1386924..1386953,
                     1387020..1387088,1387142..1387346,1387405..1387800,
                     1387863..1388090,1388145..1388325)
                     /locus_tag="CNF04760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571440.2"
                     /db_xref="GeneID:3258060"
     CDS             join(1386250..1386471,1386546..1386591,1386653..1386732,
                     1386799..1386865,1386924..1386953,1387020..1387088,
                     1387142..1387346,1387405..1387800,1387863..1388090,
                     1388145..1388190)
                     /locus_tag="CNF04760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571440.1"
                     /db_xref="GeneID:3258060"
                     /translation="MSGQDYSSIEKKNRLEIYSDDAASDPFIALAQEEESHEIKYRTL
                     SWQKAAVLLFGEYVCLAILALAWSWSVLGWVCGALITFGLGLVTWYTSYVLWQFCMKH
                     PEARDICDIAAILFPRVPRVAFEATGIMLLLNNIFIVGFHVFTGAKIFNTLSDNGACT
                     VVFQAVTAIIGILCSLPRTLNHVSLLSIISAIAMFIAIVMSLTYAAIEDAPLDATGPV
                     VTSIGLPDGGPGFVDGLNAVMNITFLWIGQILYPSFIAEMKRPQDFPKALATLTIAEL
                     ILFTVTAAVGYYYCGQYSTAPIIGSLSEPWARKSAFALVLVPTVIIGSLYANIAAKFV
                     FKRVLGKTTHMHSHSIIGWSTWIGIDILIWGIGFILGNVIPSMGSFLSIMSSAFDSFF
                     GFIFWAVAFWHINEGRLFANAKMTTLTVINIIIFFLGLFILGPGLYASVQEIVYEYAE
                     AVRSPFSCASNA"
     gene            1388853..1391290
                     /locus_tag="CNF04770"
                     /db_xref="GeneID:3258138"
     mRNA            join(1388853..1388914,1388967..1389204,1389253..1389583,
                     1389627..1389681,1389736..1389757,1389805..1389925,
                     1389977..1389998,1390045..1390426,1390476..1391290)
                     /locus_tag="CNF04770"
                     /product="dihydroxy-acid dehydratase, putative"
                     /transcript_id="XM_024657466.1"
                     /db_xref="GeneID:3258138"
     CDS             join(1389018..1389204,1389253..1389583,1389627..1389681,
                     1389736..1389757,1389805..1389925,1389977..1389998,
                     1390045..1390426,1390476..1391266)
                     /locus_tag="CNF04770"
                     /codon_start=1
                     /product="dihydroxy-acid dehydratase, putative"
                     /protein_id="XP_024513062.1"
                     /db_xref="GeneID:3258138"
                     /translation="MSNGACEGCNCGRAEQLQQEGDIPIDRPERSFTAPADAAPYEGV
                     EPAVPLRSKQWFNDPSDPAMSALYLERYMNFGITLDELRPKNRPIIGIAQTGSDLSPC
                     NRGHMELAKRVRDGIIANGGTPFEFPCHPIQETGKRPTASLDRNLSYLSLVEVLFGYP
                     LDGVVLLTGCDKTTPALLMAAATVNIPAICMNVGPMLNGYRGHKLIGSGGVMWDSRAE
                     YAAGKINESQFVQQVSLSAPSVGHCNTVGTATTMNCMAEALGMALPGSATIPAVYRER
                     GACAYATGLRIVDLVREDIKPSDVLTKEAFENAIAANTAIGGSTNAPIHLNAVAKHIG
                     VDLSGDDWERVGYHLPLLVNVQPAGEWLMEEYHRAGGLPSVIAELIKHNKLPHPNALT
                     ITGKTIKENCEGDFSRDRRVILPFDKPLRENAGFLHLKGSLFDSAIMKTSVISDAFRE
                     QYLSKPDDPMAFEGPVAVFDGPEDYHHRIEHSSKIDAGTILVMRGAGPQGYPGAAEVV
                     NMIPPGRLINQGIELPCIGDGRQSGTSGSPSILNAAPEAATGGMLAYLKDGDRLRIDL
                     LKRTANVLLSTEEIEARKKEMGPYKVPKSQTPWQEIFRETASELSDGMVIKGAVKYQR
                     LAQTAGVPRQNH"
     gene            1391645..1393863
                     /locus_tag="CNF04780"
                     /db_xref="GeneID:3258501"
     mRNA            join(1391645..1391739,1391802..1392430,1392484..1392580,
                     1392621..1392669,1392717..1393079,1393133..1393414,
                     1393466..1393540,1393589..1393662,1393716..1393863)
                     /locus_tag="CNF04780"
                     /product="transporter, putative"
                     /transcript_id="XM_024657467.1"
                     /db_xref="GeneID:3258501"
     CDS             join(1392093..1392430,1392484..1392580,1392621..1392669,
                     1392717..1393079,1393133..1393414,1393466..1393540,
                     1393589..1393662,1393716..1393790)
                     /locus_tag="CNF04780"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_024513063.1"
                     /db_xref="GeneID:3258501"
                     /translation="MSETEDLELRDRSVKSVKSNSAASVIVPTLNPGHDAESAASALP
                     PVDGGWRAWSFLVAATVIVMLIWGLPYSIGVLHVYWTDTLIKGEGASTLTLAATLQNG
                     LLYMATALSGPLFTAFPRWQRALQYCGLFAAVITFISSAFATEPWHILVAFGLIYPLS
                     GICYLPCNTLLFEYFFSLRGIATGVVFGGTGLGGASIPFLMNGLLNKIGYKATMISFG
                     LGYLVIGSIAIVFIRPRIPVSRQQTMEKRKPVNWSFMKSTPLIIGTITIFLISLGNFI
                     PSLWLPAYASSLNLTHPSGTGLIAILNAASVPGNTLLGYLSDHMPVRTVIVISCVGSG
                     LSCAFLWGFGSTDGVLILFALIFGLLGPSFSAIWTQMIGLICKDDLISPPLVVSLFTF
                     VRGVGSLMSGPISQALLKINNLNGSIGAYGFSNYGVLLIYASVTILSGGATGYLFKSS
                     "
     gene            1394532..1396463
                     /locus_tag="CNF04790"
                     /db_xref="GeneID:3258473"
     mRNA            join(1394532..1394981,1395030..1395126,1395176..1395307,
                     1395358..1395646,1395694..1395975,1396027..1396175,
                     1396231..1396463)
                     /locus_tag="CNF04790"
                     /product="transporter, putative"
                     /transcript_id="XM_571446.1"
                     /db_xref="GeneID:3258473"
     CDS             join(1394656..1394981,1395030..1395126,1395176..1395307,
                     1395358..1395646,1395694..1395975,1396027..1396175,
                     1396231..1396305)
                     /locus_tag="CNF04790"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_571446.1"
                     /db_xref="GeneID:3258473"
                     /translation="MAEAMELSDFPTRRSQSTIDRVLGPDHDSQIEPVTQYALPPVDS
                     GRRAWTFLAAATFVEILIWGLPFSVGILHVYWTNTLFVGYGASTLTLAATLQTGLLYM
                     SCAFFGPLFTTWPKWQKTFQYAGLSAAALSMITSAFASKPWHLLVTIGLVYPLSGACY
                     LPCATLLFEWWQAKRGFASGVMYAGTGLGGCIFPFLTSGLLNRFGYKTTMISLGVGYA
                     VLGSIALIPIRRRIPLSRYDFAAPGRRKHKTDWSVLRTLPMFMGVMTILFTSLGNFIP
                     SLWLPSYADDLNLHDPNGTALIAILNGASVPGNALLGYLSDRLPLRVAITLSCVGSAL
                     ACAFLWGFGTNAGMLITFAIIFGLLGPSFSAVWSKMIGVISKDDPVALTTIFSIFAFT
                     RGIGNITSGPISEALLKYNTMQGAAGAYGLNNYGILLVYTAVTIIAGGATGLLFRGR"
     gene            1396598..1399034
                     /locus_tag="CNF04800"
                     /db_xref="GeneID:3258491"
     mRNA            join(1396598..1396786,1396841..1397249,1397306..1397402,
                     1397451..1397551,1397605..1397635,1397699..1397984,
                     1398030..1398308,1398361..1398435,1398498..1398571,
                     1398629..1399034)
                     /locus_tag="CNF04800"
                     /product="monocarboxylic acid transporter, putative"
                     /transcript_id="XM_024657468.1"
                     /db_xref="GeneID:3258491"
     CDS             join(1396918..1397249,1397306..1397402,1397451..1397551,
                     1397605..1397635,1397699..1397984,1398030..1398308,
                     1398361..1398435,1398498..1398571,1398629..1398697)
                     /locus_tag="CNF04800"
                     /codon_start=1
                     /product="monocarboxylic acid transporter, putative"
                     /protein_id="XP_024513116.1"
                     /db_xref="GeneID:3258491"
                     /translation="MSSDIELFQLPDRRPSQSKIEHSLSYDQEEEVDESVTHHALPPV
                     DGGRKAWSFLAGATVVEMLVWGFPYSIGILHVYWTNTLFKGYGESMVALAATLQTGLL
                     YMSCAVFGPIFTKWPKWQKTFQYIGLFAASLSFIGSAFASKPWHLIVTVGCIYAFAGA
                     LYLPCCTLLFEWFVAKRGLANGAMFAGTGVGGVLYPYIMSGLLNHFGYKTAMISMGVG
                     YAILGTISLIPVNRRVPVSRHDFVGPGRKKPINLTFLRSTPGIIGPLIILLVSLGNFI
                     PTLWLPSYADDLKMSRIDGIALIAILNAASVPGNTLLGYFSDYSLRAVIIVSCVGSAL
                     GCAFLWGFGTNPGVLIVFAIVYGLLGTSFQALWSNMIGVISRDDPIAPSIVFSIFAFM
                     RGIGNITSGPISGALLKYNTFPNGAGAYGFHNYGALLLYTAITIFSGGAAGILFK"
     gene            complement(1398748..1400801)
                     /locus_tag="CNF04810"
                     /db_xref="GeneID:3258146"
     mRNA            complement(join(1398748..1399100,1399153..1399226,
                     1399276..1399350,1399404..1399682,1399733..1400049,
                     1400103..1400203,1400251..1400347,1400398..1400801))
                     /locus_tag="CNF04810"
                     /product="transporter, putative"
                     /transcript_id="XM_571631.2"
                     /db_xref="GeneID:3258146"
     CDS             complement(join(1399026..1399100,1399153..1399226,
                     1399276..1399350,1399404..1399682,1399733..1400049,
                     1400103..1400203,1400251..1400347,1400398..1400726))
                     /locus_tag="CNF04810"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_571631.1"
                     /db_xref="GeneID:3258146"
                     /translation="MASEIELSRLPSQRNESATEQQLDYDREHEVDESATHYALPPVD
                     GGRRAWAFLAGATVVEMLVWGFPYSIGILHAYWSNILFKGYGESAITLASTLQTGLLY
                     VSCAIFGPVFTRWPRWEKTLQYFALFASALSMIGSAFATKPWHLVITNGCIYPFAGAL
                     YLPCCTILFEWFVAKRGIATGLMYAGTGIGGVAYPYIMSGLLNGVGYKAALVSMGIGY
                     AILGSIALIPVNRRVPLSRYYFTEPGRRKQFNFSFLKSSVALTGSLIILFVSMGNFIP
                     TVWLPSYADDLKLRHLDGTALIAILNAATIPGNILLGYFSDFSIRAVIVVSCVGSAFG
                     CAFLWGFGTNAAMLVAFAIVYGFLGSSFQCLWSNMISVISKDDPIAPSLIFSIFALMR
                     AIGNITSGPVSGALMKHDSFPGAVGAYGFHNYGALLVYTSVTIFTGGVTGILFKDR"
     gene            complement(1401200..1402719)
                     /locus_tag="CNF04820"
                     /db_xref="GeneID:3258274"
     mRNA            complement(join(1401200..1401989,1402073..1402342,
                     1402434..1402719))
                     /locus_tag="CNF04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_571448.2"
                     /db_xref="GeneID:3258274"
     CDS             complement(join(1401440..1401989,1402073..1402342,
                     1402434..1402690))
                     /locus_tag="CNF04820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571448.1"
                     /db_xref="GeneID:3258274"
                     /translation="MAPSSALPATSKKAKKPQPTPKAPLPLPSTFSTAQAEKAVKALL
                     AHHAKVSKQKEEEQLLPREEHVWVVVNTKTGSTRRSLNPVKIQLPHPALPPPPTSSVC
                     LFTKDPQRQYKDLLAQHNIKFISRVVGVEKLKGKFKPYEARRELLRDHDLFLCDERVL
                     GVMPKLLGKMFFEAKKQPIPVNLQRKDLTSTLARAISSTYFHPTTGTSTSTRIATPSH
                     SSTSQTLANLLEAVPQIVAEVDGGWEGVLSVGIKTSGSVMLPVWTGKLGGRFEKAEKP
                     EKSANSGEEMEVEVEEKSETPSAPAPTVEKREKKEKAAAAPVEKPKKKSSTIGSTAGG
                     AAKRAKQVAVGAKKPAVKKSKSKL"
     gene            complement(1402888..1407678)
                     /locus_tag="CNF04830"
                     /db_xref="GeneID:3258295"
     mRNA            complement(join(1402888..1403626,1403698..1403771,
                     1403842..1405781,1405856..1406347,1406407..1406518,
                     1406573..1407678))
                     /locus_tag="CNF04830"
                     /product="hydroxymethylglutaryl-CoA reductase (NADPH),
                     putative"
                     /transcript_id="XM_571450.2"
                     /db_xref="GeneID:3258295"
     CDS             complement(join(1403272..1403626,1403698..1403771,
                     1403842..1405781,1405856..1406347,1406407..1406518,
                     1406573..1407451))
                     /locus_tag="CNF04830"
                     /codon_start=1
                     /product="hydroxymethylglutaryl-CoA reductase (NADPH),
                     putative"
                     /protein_id="XP_571450.1"
                     /db_xref="GeneID:3258295"
                     /translation="MLRQTLVSLSSLAASAPIEVITTTFIFATLAYFQLLHAIKGSEF
                     FNVPSVSPPSRPAHFVRLAHQPSSEDASYILPSSHGVAGSSWVGDVESKREWTPISPS
                     DFRKILEQNALGGYTFPIEAGGNTSGEKASVAIVKQLVVTRDGAQEPIDEFEQWLLNE
                     LSVEVDGEKYTYRDLCFNTSDHPSFVPHPLYPSQSTLTMFLQPPSPSDPTLTYLNRLN
                     RLPAFTLSDSTTAFQLLPPSGANWGFLPSIDGVGLFSKLGEGMISGQGESYPMQNVRW
                     FAYAARALVGRFWTLAKNADSADIFVVLLGYIVMHGVFVNLFIGMRKLGSSFWIPVAT
                     LCSSTFAFLIALLSAYLLDLPVDPICLSEAIPFLVITVGFDKPYHLAKAVLQNPDIDP
                     VPSSPEPSIAGYSGELAKDPKSGSSLGLDLGTLHKELAPLERLQRLAEGQVKWVAPVA
                     AKKIVVDAVKTSGVRIVRDYVLEIIALCVGAASGIGGLREFCYLAALIMAVDCVFLFT
                     FYVAILSVMVEVHRIKLIRGNRRVKSVKRVSSSASLNGHANGNGGTTNTSSSTSSPST
                     KRSFWSRSPSSEREDQPQNPVVRLKLLLIISFLTLHVLNLCTTLTEQTALKRHSTHSG
                     AEITSRAMLNPRGISLSPVLQALYESQPPETDLAVQIMPPTQILMTSETLIPSRLSSF
                     DHFMSEWTLLVGDPVLSKWIVVFLAISVLLNGYLLKGIALNSMGGKGPVAAAAQALAG
                     IFDAERGQRALRETTPRGRKMELSAHMVGTNASTSTRDGDSTPRVEEVGKVAASHTVN
                     VPIIKEPRIPSPSFPSASDDSALTFGRRSFEECVEIYAGGVGANNLSDEEIILLVQKG
                     KIAPYGLEKALKNLERAVRIRRAVISRSSLTKSLETSLLPMADYDYKQVIGACCENVI
                     GYLPLPVGIAGPLNIDGQLLHIPMATTEGTLVASTSRGCKALNAGGGVTTVLTHDAMT
                     RGPAIDFPNIVQAAQARLWIDSPDGYATLKTAFESTSRFAKLQTLECALAGRTLYVRF
                     ATQTGDAMGMNMISKGVEKALEVLRGHFPDMHVLALSGNYCTDKKPAAINWIEGRGKS
                     VVAEAVVPGHVVKTVLKTTVKDLCNLNIKKNLIGSAMAGSIGGFNAHAANILTAMYLA
                     CGQDPAQNVESSNCMTLMEPINDGEDLLISCSMPSVEVGTVGGGTILSPQRAMLDMLG
                     VAGAHATSPGANAQRLARIIVAAVMAGELSLMSALAAGHLIQAHMKHNRSTPATPGAV
                     TPFGGITPLRESVLINGPGAK"
     gene            1407978..1409935
                     /locus_tag="CNF04840"
                     /pseudo
                     /db_xref="GeneID:36392918"
     gene            1410060..1411670
                     /locus_tag="CNF04850"
                     /db_xref="GeneID:3258282"
     mRNA            1410060..1411670
                     /locus_tag="CNF04850"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657469.1"
                     /db_xref="GeneID:3258282"
     CDS             1410380..1411510
                     /locus_tag="CNF04850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513064.1"
                     /db_xref="GeneID:3258282"
                     /translation="MSRRQPPVSWEEGENTTTRPYMEETIDEPCIGPEPLPSSLTFSN
                     WSNRDYIPQPQPQPEPPSQFQASFAYSDPQRTSTSTIELAQIPWQQPWEASHQAYGVN
                     TPTLPSPWEVSHQAYNVTPTLPPPWEVSRRTYDVTPTLPPFIPYPLPSSSQQQQQGTT
                     SYPSRQIYPASTTIVTVLLQSENSATVGPMGNDTGQLTIYRNFRAKPSFPPTCTPTEE
                     ELDACLDFKNRLRELYVSNTLPFYVQPEDPPRGSGYQRSQTGMEIENTTDQRGRTRTR
                     PSWDWNAFWDWSTIDNEYKMEGYAETAKAQTLANISASQRVSGGSSGQRRAWKVNYKV
                     VDQDEFMTSHPKTDCEGNLIEGEHHGLSEERARRWKHEWIGG"
     gene            complement(1411724..1416186)
                     /locus_tag="CNF04860"
                     /db_xref="GeneID:3258351"
     mRNA            complement(join(1411724..1411998,1412083..1412258,
                     1412346..1412612,1412689..1412793,1412872..1412973,
                     1413058..1414606,1414656..1414925,1415008..1415340,
                     1415401..1415544,1415614..1415709,1415763..1415934,
                     1416006..1416186))
                     /locus_tag="CNF04860"
                     /product="ATP-dependent permease, putative"
                     /transcript_id="XM_024657470.1"
                     /db_xref="GeneID:3258351"
     CDS             complement(join(1411868..1411998,1412083..1412258,
                     1412346..1412612,1412689..1412793,1412872..1412973,
                     1413058..1414606,1414656..1414925,1415008..1415340,
                     1415401..1415544,1415614..1415709,1415763..1415934,
                     1416006..1416161))
                     /locus_tag="CNF04860"
                     /codon_start=1
                     /product="ATP-dependent permease, putative"
                     /protein_id="XP_024513118.1"
                     /db_xref="GeneID:3258351"
                     /translation="MMLPPLPLPLLFLALPSLIAAGPSASTDRVSVPTRELLDTREGI
                     TLANGASLAAPPRRRPGDPSRPPECPPCFNCLLPAFSCGNSGECNPYDGQCKCPPGFG
                     GQDCLTPLCGALSDGDERFPRPKGELCECKDGWGGINCNVCKDDRACAAFRPRSTDIK
                     ETDEDEENEMVCYKRGLAVSQNFQMCDVTNRKIIDTIPDNKPPQVTFSCSANGPSSNS
                     SFAPNTNPFSPFDDLLAGDTDAFGSCNFQFWVDRIESFHCELSGCSWESKGSFDTNQT
                     NYQCEKIKCACIPGQFLCGEDGSVNIDDFLSEEVKGPGSFSCSAGRGCSFSEPAMNQL
                     INDIFGDKSITLDCESGECLHYTQVPGYVVPEKPDNRSLVALSAAAAAVIFILACILF
                     WYLGRTHRHPSGFGSIHLPSDEASKLMSDHVPATLHFNNLSYTLPSGKRVLSHITGTV
                     RPGELLAIMGASGAGKSTLLDILARKAKTGKVEGDTYINSRPITDESTFRRVVGYVDQ
                     EDTLLPTLTVYETVLFSALLRLPREMSYDAKVYRTLETMNELGILGIKDARIGESGKR
                     SISGGEKRRVSIACELVTGPSILFLDEPTSGLDSYNAQNVVQSLHTLAQRYKRTVIFT
                     IHQPQSNIVALFDRLVLLAKGQMVYSGEARKVKTHFESVGYECPEGWNTADWLIDLTV
                     DAAGEHRGGSRSGQSPSNGNDHGNGAATGLYTQRDDAGAGAAVLDPEAGFPTSPHAPF
                     HLDGNDRGGSPGILGEIKTKAHKLLGAFTSPSSVPSSSSYPATPIESVTPSPRAMAFQ
                     GKDNIHIPRIPEKLASLVLASRASDDAKIVEAEISRIQHGETADGGYPHPNTTISTSA
                     TASATASTTASIIADQRNVEEETGLMKGYQKAGLWDQFKLLSSRAFKNLYRNPLLMAT
                     HYAVAVIAALLCGFFFYQVTNDIPGFQNRLGLFLFILSLFGFSCLSSLGIFANERLLF
                     MRERSNGYYSPITYFLAKLLFDIIPLRVIPPFILGSIVYGLAGLNAEVSAFWKFIMIL
                     VLFNLTASSIVLFLSVAISDLGVANLLGSLVMLYNLLFAGLLMNYDRVPDGLKWMLTT
                     SFFHAGYEALLVNELRYLQLVERKFGLDIQVPSATILSSFGFHAQAFWWPDTALMGIV
                     FGIFTVLSYLVLQFWVKERR"
     gene            1416332..1419734
                     /locus_tag="CNF04870"
                     /db_xref="GeneID:3258256"
     mRNA            join(1416332..1416514,1416568..1416706,1416761..1416834,
                     1416900..1417027,1417116..1417329,1417389..1417791,
                     1417864..1418192,1418255..1418663,1418759..1419240,
                     1419321..1419395,1419508..1419734)
                     /locus_tag="CNF04870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657471.1"
                     /db_xref="GeneID:3258256"
     CDS             join(1416341..1416514,1416568..1416706,1416761..1416834,
                     1416900..1417027,1417116..1417329,1417389..1417791,
                     1417864..1418192,1418255..1418663,1418759..1419240,
                     1419321..1419395,1419508..1419660)
                     /locus_tag="CNF04870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513065.1"
                     /db_xref="GeneID:3258256"
                     /translation="MPRGPSIPPYLTAGASSRAHHALLAQLSQADSTQEEDQIVAHHL
                     TQARAVLHSRDVNTTRIAESLIVILHCTMLRHNVDDDLDFALMPALKLAEAGKTIQER
                     RIGYLFLVERLSPDHELHLLLVNTIRKDLSSNQPANILLALHTIVKLPSRDLGPAVTP
                     LLIAKPLLRHTSAAIRQRTYQALVALHLSSTFPRTPQPHSQSQSIRPHSPFPLSMSKV
                     VKAVCKEKDSSCLCVLFKLLGRLIHTGAHGIKNEEERGYLVQLVLDKTEEMGWLEQGQ
                     VEGGGDGGELILESVRLLGTLVSAEILEMDSAERGEEVREQIEEWIRRKMEEMRMDGS
                     WSRSRSQSRSRSRSQSRSQFQSQSQSQSQSQSGTAVGLTRWKKAFLLEVCGIAPMVPA
                     VIGHCLGVVSRLLVPSSFPSTSSSSSTPANKSTHTHTHTHTQTSVLPPPNEHVLALRC
                     LLLLPPQTWDRSEKMGEGEMGVVMEGVGSGDTSVRRLTIELLYALSPDLARTVFENYL
                     ESIVTSTNLSLPLDMQTQTQIQTLGMEERVKVKMGRRETAGRALEVCEVVARVQARVQ
                     PWPGVQGKEGESGNGDRSVVNWGDVVSVLVTLGEKEKEKDGDGWEEGVKRVMDLVRLY
                     DPSGELLVDAIHARYERRIHETERGRQGHVHEHEHETETLWIQSPTVVMLLGAVACEF
                     SALGLGDGKARQNKRASLRELLSTAALGGSRAGMISSVNSTIGVIPTTSTARATSVQS
                     PALQEIVLLAFVALLRDEGEGEDMERIRKDVESLAKGAQGYIKRRCDEVIYTIDNGLA
                     RELGGGAKSSSLSDIRTSLVDTVATHKRRASLKSESETRSPLSWSTLTATKQLRYEAY
                     GSK"
     STS             1416724..1417638
                     /locus_tag="CNF04870"
                     /standard_name="Xba23"
                     /db_xref="UniSTS:470855"
     gene            complement(1419720..1423848)
                     /locus_tag="CNF04880"
                     /db_xref="GeneID:3258266"
     mRNA            complement(join(1419720..1420148,1420239..1420289,
                     1420373..1421023,1421081..1421615,1421681..1421742,
                     1421941..1422036,1422126..1422384,1422479..1423441,
                     1423506..1423614,1423676..1423848))
                     /locus_tag="CNF04880"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657472.1"
                     /db_xref="GeneID:3258266"
     CDS             complement(join(1420041..1420148,1420239..1420289,
                     1420373..1421023,1421081..1421615,1421681..1421742,
                     1421941..1422036,1422126..1422384,1422479..1423441,
                     1423506..1423614,1423676..1423799))
                     /locus_tag="CNF04880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513067.1"
                     /db_xref="GeneID:3258266"
                     /translation="MASLDNPEAGLPHSQPQPPPTDSQPADQQTKKRSKQQLSCAECR
                     RLKLKCDRDIPCSNCVRRGCRELCPDGVKETRRAGLDAKTAEALQKRLSTLEGFLTEH
                     GFEVDDDSSAVHPRLSSSSRSRMDSNPPTMRRGSIIGGGGNVGGSEDWRSNKDSPTSP
                     FQSTKSNHRRSRSPSRRAHSIGEYQRPPRYLYDSPAPPRDNPFSYNLSSSSLSHSSNP
                     SIPPQTQAQAQALHQLPSQSHLHSHPHSQTQLHLPPISSFSTSTSAGTTIPVGSPVEH
                     SHGTLVLGKSGRSRYLGPTAGTEWLKNQEVGGIGMETPSNSRSPVDTTNPGNGSPAGG
                     RGEKGGEEGVYHGRESGGAYEDPLYSFPFNESGEVSTVEALFARLPPRADAETLVDSY
                     YRYFAWNHDPAPRRTFQPIFDRVYASLLHPRPENSVHLQQLALVYMLLAMGTVHNIEL
                     PPHDESAEEYLTLAQAAMTKGNFMNHATIAGLQTLVTMAHYYLETESGRNGDSAWPLW
                     GLAMSLVVAMGLHRDGARWNLPDDVVQERRQVFWECHTIEVFQANCFSRPNTLVPRYI
                     DTAFPSPNSAEVAMGGKGWPTLKFELCQISSQVLDAGMTVHFQSYDSIQKLYGQLCEF
                     ELNVPYDLRCRSALLALPSVYPDPEMARKNSPEISRHNLHRTLQQFTLSLNISENILF
                     LQRPYFVMAMHDEPADPTRSVYGHSYLAVVERCNVIIQVVSDLYKLHPTIISRQWFFW
                     YHLFTAAVCLGTLILKNPQSALATFALSQIEQAINVYSVLIKQNNSPSMVQNHDWLLR
                     LRQRGAKKIAQAAGMGGTNLPLGVGPGGGGGDGDTGGQEEEDRELLGWKTRLIERAGS
                     GVHTAVNISSSNPASSVPHRTPSPGSLTQNGGGNSGMTPAMHLLQQHFVPPFQTPPVS
                     GMLGTTAQTLGMDNSTDLLLHQFWDPMMMADSTNMTQNANWWSWDFGGLAENGTPIAG
                     GAAGSQTQPQATP"
     gene            complement(1425062..1426824)
                     /locus_tag="CNF04890"
                     /db_xref="GeneID:3258048"
     mRNA            complement(join(1425062..1425352,1425416..1425554,
                     1425629..1425874,1425945..1426120,1426194..1426515,
                     1426622..1426824))
                     /locus_tag="CNF04890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571626.2"
                     /db_xref="GeneID:3258048"
     CDS             complement(join(1425231..1425352,1425416..1425554,
                     1425629..1425874,1425945..1426120,1426194..1426515,
                     1426622..1426714))
                     /locus_tag="CNF04890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571626.1"
                     /db_xref="GeneID:3258048"
                     /translation="MTVSAATTIPSKKLRIALLGCGRMGQRHAVNLHKLVTRAEVVAV
                     ADPSPVAAKWVEENLPGVAYYSTPDSIFSLPNIDAVVISTITSTHASLTIQAIERGIH
                     VLLEKPISVDVEDSRPVVEAARKRKDVKVMIGFVRRFDTALNQLHTHLKSSALSSHSQ
                     PFLLKSTSCDPHDSTGFFISYAKASGGIFMDCGIHDIDMSRWLLNVSSSGTKKQVARV
                     LASGLLTLHPTLADQGDCDNALAIIEYTNNTSCTLHLSRTGMSGYESSVEVFGTGEKL
                     LVDTPASNRVKISDASGRHVDSAPTYMDRYGEAFIHEAEAFVDCILNDLPPPTSAEDG
                     FQAALIAKALTHSFQSGKPVLFGEDGEPILD"
     gene            1427039..1428684
                     /locus_tag="CNF04900"
                     /db_xref="GeneID:3258383"
     mRNA            join(1427039..1427410,1427477..1427646,1427728..1427846,
                     1427907..1428209,1428287..1428684)
                     /locus_tag="CNF04900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_571621.2"
                     /db_xref="GeneID:3258383"
     CDS             join(1427135..1427410,1427477..1427646,1427728..1427846,
                     1427907..1428209,1428287..1428564)
                     /locus_tag="CNF04900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_571621.1"
                     /db_xref="GeneID:3258383"
                     /translation="MAPFTVNWGIISTGGISTTFAHDLLVDPASRNTKDVNHKIAAVG
                     SRSVQSAQAFIDKLKESSEGKPWAWGVKNGVLDGVKPRGTYEEVYNDPDVTAIYVGTP
                     HVLHHRNAKDALLAGKHVLLEKPACLEVEELDELIMIAKEKKLFFMEAVWTRFQPIAY
                     AVEEVIKSGILGKPRRFSADFSMDWNLDADSGRMANPALGGGSLLDMSAYPSVWAMLL
                     VHRNPFNTDKDPKVLLTHQTIYPRTGVDINSRWLVEWKGLCQGMLMTDLDNAGQKDST
                     AVLQCEEGDLVIAYPPYQPETFYIHPRPSRFPGTITSSTTHYHPLHDGNNGMSYEADE
                     VARCIRDGKIESERMPWEESRVVQGWVDKVRKEGPTETAKLVGTAGQ"
     gene            complement(1429272..1431666)
                     /locus_tag="CNF04910"
                     /db_xref="GeneID:3258328"
     mRNA            complement(join(1429272..1429712,1429771..1430968,
                     1431024..1431666))
                     /locus_tag="CNF04910"
                     /product="hypothetical protein"
                     /transcript_id="XM_571458.2"
                     /db_xref="GeneID:3258328"
     CDS             complement(join(1429411..1429712,1429771..1430968,
                     1431024..1431596))
                     /locus_tag="CNF04910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571458.1"
                     /db_xref="GeneID:3258328"
                     /translation="MTFPDTNEGDWASRRAAALAQLTSDSRLTSLSPASACDSPLSSF
                     PSSHQTLAQHSKFPRDDPIAYGGHPKNKDRPYPLSLIPFDLSEPYEVSEYLTIRSYDK
                     ACQVDYLGQPWANEYRDGMIGDEQTFDDRIFRRYLDRFIQENCNYMAMATEFSHQANL
                     KTVFYDRYDKEWAKLDLVDMYRRRTGKILGAPSQSQGTSKSKKDVATTPDASLIGSVN
                     DPSSPSGRKRMLYAVIELKWMNLAALLTGEAKSQTDEKALSYLCQEGVFQTMWYVILG
                     YAISRCIFGLSIVNEYFYRIVYLYQDSASDSPVLALEASKEFLENAGQHFGYPRDGYS
                     VEELAELQDFWSSPPNCLISDRANATLNKEARYHLDATILLFLAHAAALPTQRFLNDL
                     PLPFAHHVPVDATAHSATDMRLKGLEVGRRRHSLRSTKRNKRTLADLYDEEKDEEDKP
                     GDREDKSGDRKPPGKDNRNNDPRNDGSQGGNSGSGGDNSRGGGSGPGGDNLHDGGSGS
                     GRGHEGSDSRDVGGYEGSESRDDGRDPVQDGAGGPSTHLAEAADIRTPTTRQEFLRGL
                     QKLSTPGNMLDMKSSIIASLISNPHTSTSVAPSSPGVNSTTSSEDVHFPDLSLDSNGR
                     TLVHCDLSTDPLPKVHKSTPLDLDLEDIDPETGELTLAAYRDRLAMLGVRVKLVTREE
                     MDVLLARG"
     gene            1431947..1433454
                     /locus_tag="CNF04920"
                     /pseudo
                     /db_xref="GeneID:3258479"
     gene            1434044..1436496
                     /locus_tag="CNF04930"
                     /db_xref="GeneID:3258307"
     mRNA            join(1434044..1434092,1434175..1434351,1434413..1434538,
                     1434588..1434713,1434771..1434932,1434980..1435146,
                     1435197..1435786,1435846..1436025,1436082..1436148,
                     1436215..1436496)
                     /locus_tag="CNF04930"
                     /product="trehalose transporter, putative"
                     /transcript_id="XM_024657473.1"
                     /db_xref="GeneID:3258307"
     CDS             join(1434228..1434351,1434413..1434538,1434588..1434713,
                     1434771..1434932,1434980..1435146,1435197..1435786,
                     1435846..1436025,1436082..1436148,1436215..1436352)
                     /locus_tag="CNF04930"
                     /codon_start=1
                     /product="trehalose transporter, putative"
                     /protein_id="XP_024513068.1"
                     /db_xref="GeneID:3258307"
                     /translation="MSGVTGISLSLSSEELKTQDVEQNEKLDSTTNMFTNAAAATDKE
                     HNMTLWQGCKLYPKAILWSVLISSCCAMEGYDISLVGNFYAFDPFNRKYGVQGVDGTY
                     QVPARWQTGLSNGAQCGQILGLIVNGLATERFGYRIVILGCLIWLTGVTAIFFCAPNI
                     QTLLAGEILAGIPWGVFQSIAISYAAEVCPVALRGYLTSYGNFCWGWGQLIGIGVIKS
                     QFGRTDQWAYRIPYGLMWMFYPPLIIGIYFAPESPWWLVRKGRIEQAKKSLLRLTSSK
                     TDPTFDATETIDMIRHTTELEKDMTSGASYLDCFKGVNLRRTEIVCMLWATQNLAGNT
                     FSNYSTYFFEQAGLTGEIPYDFAMGQYAINMVGTFGAWYLMTKMGRRTLFIGGLCGLC
                     VTLLSIGFVGLVPESKKQAASLATGALMLVWAVFYQCSVGTLAFSLVAEMSTRRLQIK
                     TVALGRAAYNVAAIISNVLTPYMINPTAWNWGNYAGFFWGGSCFLVLVYAYFRVPEPS
                     GRTFAELDILFERKVPARKFKTTEVNAFDVVLHHQVAEDKPDGEVSHVERV"
     gene            complement(1437068..1438867)
                     /locus_tag="CNF04940"
                     /db_xref="GeneID:3258471"
     mRNA            complement(1437068..1438867)
                     /locus_tag="CNF04940"
                     /product="hypothetical protein"
                     /transcript_id="XM_571462.1"
                     /db_xref="GeneID:3258471"
     CDS             complement(1437197..1438777)
                     /locus_tag="CNF04940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_571462.1"
                     /db_xref="GeneID:3258471"
                     /translation="MAAAVKTHAPTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDP
                     FGPLFFSITLRPTLNALSQSLGPSTQALAYLDDIYLFSNDSQVLSKTTQFLADKQHII
                     KLNEKKCKLISFDEIRQDGFKMLGTMVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQH
                     ALLLLRFCIQQNLRHLQRSLRSDDLVDLWERLDTMLWEEVKRMRMRQREDTVEEEALG
                     RSLTKLPARLGGLGLLSFKDVAPLAYRSAAEASDTLLDNLGLLSSPEEPPTPVPQRTR
                     CAELWESQQEAILRNLGDTERKRLTENASRLGRSWLSVIPYLQPLRLSNVEIASGLHD
                     RTLVGSSIPVCRFCGSDSPLGHDELCRARNPWTQRRHNAINRVIYQHLKQIQGATVEI
                     EPHTLSGQRRNDLRVRGSSALAFTDYDLKVYSLGDRDARSTVTPCAPNGKLADFCLDR
                     CVNWLDKVGQVVSKNAPKVTGGVFKPIILSTGGLMSRSTADEWKEWREAMPVGGFEKM
                     EKRIGVELVKARARTLVL"
CONTIG      join(AE017346.1:1..1438950)
//
DBGET integrated database retrieval system