GenomeNet

Database: RefSeq
Entry: NC_006694
LinkDB: NC_006694
Original site: NC_006694 
LOCUS       NC_006694            1178688 bp    DNA     linear   PLN 14-AUG-2010
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 9,
            complete sequence.
ACCESSION   NC_006694
VERSION     NC_006694.1  GI:58273487
DBLINK      Project: 10698
            BioProject: PRJNA10698
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Tremellaceae; Filobasidiella;
            Filobasidiella/Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1178688)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1178688)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1178688)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AE017349.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1178688
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /variety="neoformans"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="9"
                     /note="MAT-alpha"
     gene            complement(<754..>2253)
                     /locus_tag="CNI00010"
                     /db_xref="GeneID:3259436"
     mRNA            complement(join(<754..831,892..983,1047..1137,1236..1673,
                     1727..2186,2237..>2253))
                     /locus_tag="CNI00010"
                     /product="fungal specific transcription factor, putative"
                     /transcript_id="XM_572787.1"
                     /db_xref="GI:58271261"
                     /db_xref="GeneID:3259436"
     CDS             complement(join(754..831,892..983,1047..1137,1236..1673,
                     1727..2186,2237..2253))
                     /locus_tag="CNI00010"
                     /codon_start=1
                     /product="fungal specific transcription factor"
                     /protein_id="XP_572787.1"
                     /db_xref="GI:58271262"
                     /db_xref="GeneID:3259436"
                     /translation="MTVYPVYCFFHWPTFINHVKARRQDNDRSFQASVLAVCAVAAAR
                     LRDGACSELLKVWSPPSSQSDSSGITDIAIISNVHGLRSAALSSISSRASGSGPEFDD
                     LRATALLAILGIQNGDFDQLQIMLGQYHGMSAQLAFHDESQWPQGLEKWEVQERRCLY
                     WSIYTLDVFASSVWGGVIRHRRCQSFVSYPDHRLDDALSLSPTLVGELDTVNWIQGWN
                     TVTDLYRAMEEIMDAAAYQNQRAAPHKPPDLPSPFGRPPLSVSESWPVIRYRYDALPS
                     VFKETKPLTGDFVDNVCSFQAANLSVTLQYGRSMSDRRRAAGCSGEYTHSVHAVDQRA
                     IPSSAIGSRQSFGERGAGSFDHQHVPSYPPDPFVIRKLTCLPRDSFYPRRRDQRAAS"
     gene            <5006..6241
                     /locus_tag="CNI00020"
                     /db_xref="GeneID:3259545"
     mRNA            join(<5006..5524,5584..5647,5701..5844,5929..6241)
                     /locus_tag="CNI00020"
                     /product="expressed protein"
                     /transcript_id="XM_572755.1"
                     /db_xref="GI:58271197"
                     /db_xref="GeneID:3259545"
     CDS             join(5006..5524,5584..5647,5701..5844,5929..6185)
                     /locus_tag="CNI00020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572755.1"
                     /db_xref="GI:58271198"
                     /db_xref="GeneID:3259545"
                     /translation="MLSHSLLASLRARCAVSLLASSSTSVRSLATQASSTITSIRPSR
                     DEIVNMRLSQRSIQAALEALRADGIVVVEDVVNKEAIDKLNSHMEKDTHTLMARGEKG
                     PFNYNLGNLQQSPPYDPDLFSPSIFVNPFGIQVTNAYLGERPTMSFISANSAVKAEVG
                     QPVHSDADFSHPSIPFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERAS
                     GRIKQDLLDARKSISPPLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPW
                     YRQRMTMKLPRSLRPTLEGVDRLGVAADWQDAEVDHLDAPYGNAFDFSQDQ"
     gene            <8997..>9664
                     /locus_tag="CNI00030"
                     /db_xref="GeneID:3259665"
     mRNA            join(<8997..9061,9304..>9664)
                     /locus_tag="CNI00030"
                     /product="hypothetical protein"
                     /transcript_id="XM_572752.1"
                     /db_xref="GI:58271191"
                     /db_xref="GeneID:3259665"
     CDS             join(8997..9061,9304..9664)
                     /locus_tag="CNI00030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572752.1"
                     /db_xref="GI:58271192"
                     /db_xref="GeneID:3259665"
                     /translation="MKLLLVASALATAISVQAQSESNTCYADIIPFYNFREAECGTLA
                     DDIDYAGFIPSNGNSTYDLANGTSSAAASGSASASAAASSAATSNAATTSASATASSG
                     AAASSSGAALAAIDMVTARGLAVGGMSVAGVLVGGLLLI"
     STS             11629..12192
                     /standard_name="Hae8"
                     /db_xref="UniSTS:470715"
     gene            complement(11946..14221)
                     /locus_tag="CNI00040"
                     /db_xref="GeneID:3259567"
     mRNA            complement(join(11946..12363,12429..12488,12563..12953,
                     13021..13643,13694..13973,14039..14106,14174..14221))
                     /locus_tag="CNI00040"
                     /product="protein transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530826|gb|CF676667.1,gi|41531283|gb|CF677124.1,
                     gi|41531290|gb|CF677131.1,gi|41533139|gb|CF678980.1,
                     gi|41533147|gb|CF678988.1,gi|41533265|gb|CF679106.1,
                     gi|41533280|gb|CF679121.1,gi|41535547|gb|CF681388.1,
                     gi|41536912|gb|CF682753.1,gi|41536920|gb|CF682761.1,
                     gi|41539462|gb|CF685303.1,gi|41539467|gb|CF685308.1,
                     gi|41541668|gb|CF687509.1,gi|41541681|gb|CF687522.1,
                     gi|41546560|gb|CF692401.1,gi|41546570|gb|CF692411.1,
                     gi|41546975|gb|CF692816.1,gi|41546983|gb|CF692824.1,
                     gi|41547122|gb|CF692963.1,gi|41547126|gb|CF692967.1,
                     gi|41547654|gb|CF693495.1,gi|41547667|gb|CF693508.1,
                     gi|41550423|gb|CF696264.1,gi|41550431|gb|CF696272.1,
                     gi|41551838|gb|CF697679.1,gi|41551847|gb|CF697688.1,
                     gi|41552104|gb|CF697945.1,gi|41560186|gb|CF706027.1,
                     gi|41560200|gb|CF706041.1,gi|41565529|gb|CF711370.1,
                     gi|41565537|gb|CF711378.1,gi|41566507|gb|CF712348.1,
                     gi|41566516|gb|CF712357.1,gi|41568193|gb|CF714034.1,
                     gi|41568202|gb|CF714043.1,gi|41570139|gb|CF715980.1,
                     gi|41570155|gb|CF715996.1,gi|41570404|gb|CF716245.1,
                     gi|415"
                     /transcript_id="XM_572757.1"
                     /db_xref="GI:58271201"
                     /db_xref="GeneID:3259567"
     CDS             complement(join(12356..12363,12429..12488,12563..12953,
                     13021..13643,13694..13973,14039..14106,14174..14180))
                     /locus_tag="CNI00040"
                     /codon_start=1
                     /product="protein transporter"
                     /protein_id="XP_572757.1"
                     /db_xref="GI:58271202"
                     /db_xref="GeneID:3259567"
                     /translation="MGFRFLELVRPFMSILPEVTAPEKKVVFNHKIAWTAVTLLIFLV
                     CSQVPLYGIMSSDSSDPLYWLRAILASNRGTLMELGITPIVTSGMIMQLLAGAQLIDV
                     DFSLKDDRALFGAAQKLFAMIISLGQATVYVLTGLYGSPSSLGAGVCLLLILQLVSAS
                     LIVILLDELLTKGYGLGSGISLFIATNICESIVWKAFSPNTVNTGRGPEFEGAIIALI
                     HLLFTWNDKTRALKEAFYRDRLPNIMNLLATVAVFAAVIYLQGFRIEIPIKSSKMRGQ
                     RGTYPVKLFYTSNMPIMLQSALTSNVFLVSQMLAGRFPDNLLVRLLGVWEPMENNPTQ
                     LGAVSGIAYYMSAPHSLTSALKDPFHTVIYIAFIVTACALFSKTWIEVSGSGPRDVAK
                     QLKDQNMTLAGHRDASIYKELKRIIPTAAAFGGATLGLLSVVADMMGALGSGTGILMA
                     TTIIYGYFELGIKENSGIDATGLGDLLF"
     gene            14423..17369
                     /locus_tag="CNI00050"
                     /db_xref="GeneID:3259794"
     mRNA            join(14423..14520,14577..15264,15365..15700,15778..16063,
                     16130..16192,16272..16291,16370..16453,16533..16829,
                     16925..17369)
                     /locus_tag="CNI00050"
                     /product="tRNA dihydrouridine synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551293|gb|CF697134.1,gi|41551308|gb|CF697149.1"
                     /transcript_id="XM_572750.1"
                     /db_xref="GI:58271187"
                     /db_xref="GeneID:3259794"
     CDS             join(14432..14520,14577..15264,15365..15700,15778..16063,
                     16130..16192,16272..16291,16370..16453,16533..16829,
                     16925..17239)
                     /locus_tag="CNI00050"
                     /codon_start=1
                     /product="tRNA dihydrouridine synthase"
                     /protein_id="XP_572750.1"
                     /db_xref="GI:58271188"
                     /db_xref="GeneID:3259794"
                     /translation="MTDDPAATPRPETSVNARPAFSGQAPIKAEYLINTTPIVESASA
                     SELNNIHPDDAAEGRTDSRDSRDGRDRPDNKRRKPNKQDKKDKKGQNKGRHFPVIREA
                     SVRICRAWETTGICDRADKGDCRYAHSWEGYFEVKPNDISYRPDWSLVGEAPFVVEGE
                     RVVGGEDVVGKTLDLDTVCPVLKDLGYCPFGWRCRFLGAHVKRVAAAVDGEKEKEAGP
                     EKRMGEWQVENWVQSEVENGWKQKETNWPEHEVLNALRRSTASFPFSEAYLKKVDPDK
                     PFTLQNKKPTKQQPHKRKNNVLDEEEAANGPTGIPSAGDDEENAMNATENERNEEKGK
                     VYGEPEAIDVPLRPEEKRRLNWEGGRYLAPLTTVGNLPFRRLCVDYGATITVSEMALA
                     QPLVYGAKEEWALVRRHESEKMFGVQVAGGFPNRMVPAAEVIANTIGKGGGVDFVDVN
                     MGCPIDLVFNQGAGSALMDSPGRLGKLLVGMNRALGDIPLTVKFRTGVAHGKPNAHKL
                     IPRFVTEWGAGALTIHGRSRQQRYSKPADWEYIKTCVTALRESVADANLPPVPIFGNG
                     DCFSAASYYEEMDRSGVDGVMVARGALIKPWIFTEIKERREWDISAVERLEGIKKFAE
                     FGLSHWGSDTQGVNTTRRFLCEALSFQHRYIPIGLLERLPAKLNERPPAYRGRNELET
                     LLASPFAGDWVKISEMFLGKVDEGFSFVPKHKSNAYGGEEAQG"
     gene            17697..19727
                     /locus_tag="CNI00060"
                     /db_xref="GeneID:3259808"
     mRNA            join(17697..18141,18205..18285,18365..18415,18493..18530,
                     18613..18717,18808..18940,19045..19179,19257..19727)
                     /locus_tag="CNI00060"
                     /product="oxidoreductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540090|gb|CF685931.1,gi|41540097|gb|CF685938.1,
                     gi|41542050|gb|CF687891.1,gi|41542054|gb|CF687895.1,
                     gi|41551806|gb|CF697647.1,gi|41551818|gb|CF697659.1"
                     /transcript_id="XM_572748.1"
                     /db_xref="GI:58271183"
                     /db_xref="GeneID:3259808"
     CDS             join(17760..18141,18205..18285,18365..18415,18493..18530,
                     18613..18717,18808..18940,19045..19179,19257..19561)
                     /locus_tag="CNI00060"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_572748.1"
                     /db_xref="GI:58271184"
                     /db_xref="GeneID:3259808"
                     /translation="MTKSLYSLFSIILLFAVSSSFAFASPQAQYHQHAMTTSHLLSVH
                     NDSSGHNHTAPSLETLIVTVPVSAEKLAEVKTHFKTVHVFDEGETVTKEAAREVEVWY
                     SNYLGIPKEIEYEDVPNLKLVQLTSAGANLALNSPVLKNEEARKRIDISSASGIHAIS
                     IPQWIISQTVSLYMHLYLQTFNLRTNQTWSRDIPQLPQLNGIKHGNSGKSLYGKTAGL
                     LGYGHIGRETARLLKAFNVNIIAANSNGQKRGDDGYLIPGTGDADGSIPSAYYSTSDE
                     ESFKTFLSKSDILIASLPSTPQTRYLLNQELLSLLPEGAVFLNVGRGDLVKSEDLLAA
                     LASGPLSGVALDVTDPEPLPDYHPLYSHPQVIITPHTSSNIEGYFDVGADLLIENVRR
                     VRKGGKAINKVDPEKGY"
     gene            19962..21794
                     /locus_tag="CNI00070"
                     /db_xref="GeneID:3259795"
     mRNA            join(19962..20128,20227..20387,20487..20655,20738..20880,
                     20987..21063,21143..21794)
                     /locus_tag="CNI00070"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567358|gb|CF713199.1,gi|41567363|gb|CF713204.1"
                     /transcript_id="XM_572759.1"
                     /db_xref="GI:58271205"
                     /db_xref="GeneID:3259795"
     CDS             join(19978..20128,20227..20387,20487..20655,20738..20880,
                     20987..21063,21143..21668)
                     /locus_tag="CNI00070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572759.1"
                     /db_xref="GI:58271206"
                     /db_xref="GeneID:3259795"
                     /translation="MSRPSIILHATPPLHPLPASDAESLYYAALLQLAAPDGWALTRG
                     DWGDNGGKLPFITHLAHPVPPAHLSSLPSFSDPDEELEDGEKLDAACWKAYIEGNVVD
                     IVNHTYYSLPPNYPSTVAKSQFAGLPFPMNQYIPQRIRSIVKSRLEFVGLWGLGGLNV
                     GDAEDEDRKRQEEQFIIGPGGTTAPRAWTGWRSGQETDKRRRKWGEQQLEQKIKAIFD
                     PLARRLGKKAYFFGERPTTVDLALFAQLAFVLTPTLPNPLLPNILRSSYPSLVGHHDR
                     LLERLFSSWSTVPMAVSQTPARTTWGETFASWLPGPSRSRTQPSSSSSTDSKENSKGG
                     SPSKPKTDKQKAFERGRWLWFAGAAVSMVTYLFVSGVIAFEFGDEEEDEDWVAYEEDG
                     EGEVGETTVLDYEEEE"
     gene            22009..29138
                     /locus_tag="CNI00080"
                     /db_xref="GeneID:3259463"
     mRNA            join(22009..22350,22426..22804,22886..23497,23533..23803,
                     23887..24061,24130..24184,24239..24461,24605..24718,
                     24801..24883,24945..25006,25075..25238,25328..25611,
                     25678..26004,26059..26896,27017..27063,27120..27175,
                     27282..27421,27493..27612,27666..27737,27794..27942,
                     27997..28111,28162..28275,28323..28436,28497..28586,
                     28640..28661,28723..28815,28867..28910,28971..29138)
                     /locus_tag="CNI00080"
                     /product="ATP-dependent bile acid transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546694|gb|CF692535.1,gi|41557370|gb|CF703211.1,
                     gi|41558090|gb|CF703931.1,gi|41558100|gb|CF703941.1"
                     /transcript_id="XM_572761.1"
                     /db_xref="GI:58271209"
                     /db_xref="GeneID:3259463"
     CDS             join(22478..22804,22886..23497,23533..23803,23887..24061,
                     24130..24184,24239..24461,24605..24718,24801..24883,
                     24945..25006,25075..25238,25328..25611,25678..26004,
                     26059..26896,27017..27063,27120..27175,27282..27421,
                     27493..27612,27666..27737,27794..27942,27997..28111,
                     28162..28275,28323..28436,28497..28586,28640..28661,
                     28723..28815,28867..28910,28971..29083)
                     /locus_tag="CNI00080"
                     /codon_start=1
                     /product="ATP-dependent bile acid transporter"
                     /protein_id="XP_572761.1"
                     /db_xref="GI:58271210"
                     /db_xref="GeneID:3259463"
                     /translation="MSMPSYNASTYASETETLLPRSPPSPRFPTSSDQYADDDHDLPV
                     QIDSFLRNVKICKSALGASLLGTFAMEVWHLSMSAAEVGHRRRSETQQKAVEASMWAD
                     ILGTTIICFLSILYLASLLKPITVPSVSLSPKIQNSSLHRSLCTTTFTSILFLLIAHS
                     SPGVAYTVWTHLSSPRLDDPMAEGVYHLRMVGLILVLSSVGFMRRGPKMYFPPPRLGT
                     GFGLNREPEWESKKKNGHDIGEYGEDGYQNGDEDRRKGVVIKLTPAQEIDDPLTSAAS
                     AITIERQRLPPKVPEEPKSNVFDYNNSSMINFVLLTYIKLSPSLTERSRQIAPLAIRS
                     AHVASLHQSDLPILEDETRNSGVYETAFASNSASHTKIIGLKRMVGSKTTTSWQLVKT
                     LWAGRGWTVFISFVLETTRNLISFIQIAALHEIIQSFNQSPGEDKSYAYLMCWAMFFG
                     QTVEVLLAAYCCVRENYMLHIPVRMSISSIILAKILRTTDAKALEAHNTIDSNSDDGH
                     VRKGTKEKKTSGAQGRSQVMNLLTIDTNTVASLATHTWGFTNGITTLIIGAGMLYGML
                     GVSAFVGIACVPLSTPLTWLVAKLIYRCDIEWARARDARTGALKEFLLGIKVIKLNAF
                     EPYFMHRISKLRAHEVKWQRWRFTLGTAFNVLADQLPILSILITFAFHTKIMGRPLDA
                     PTAFVALNMYVDVYGLQTFPQIIQTFLSCKVSLDRLSRYLSQPEIDDDRWESISRRII
                     CRDATITWPIGEGIDKGDTGRFKLEGLDLKVPEGRLSLLCGPLGSGKTLLLRAFLGEA
                     KVEKGSVLAPKSLPDATPILLDNEIEAAVHWTAQHWLNDSIAYAPQQSFIRHGTLRDN
                     ILFGQPMWRERYQEVLRQAALLQDLEILEDGDMTEVGENGVTLSGGQKARVNLARCIY
                     SRASTIYLDDILSAVDAHTAQFIYQECLQGSLLKNRTVVLVTHHVRLVLPAVSYVISL
                     NTEGRIDQACSPSQIDLNTLSESAPKSPINSEDITPAAQLEKKRLINVGALDAKTTRK
                     LYQEEQRAVGRVSGSHYFLIFRAAGGMWYWLILAILYGGHRALTMLRIFWLEHWSANP
                     SPEHLNYNLIVYAAIVSFGIVTGAFRWIWLYGISNVGFYSRGNRRVHDLIMARLFSAP
                     LQFFEKTPQGRLLNVFGQDMWRLDCNVADDFGSLAIVTSAAVVFFKEPLVTIIAVAFG
                     IPLFWFSGHSPLYSLYNEAIDGIVMIRAFGQDKLMMATMKVLNNRERTTYLADWTAFI
                     RILTNVVITATSFVLIERNISPSQAGLILNFALTVSGSLFGLMEQYSHLEQTFVSAER
                     INQYITMSEHESEEGVCPPPEWPQQGRIDVRKLSVRYAPDLPQVLKNVSFTVEPGMHV
                     GLVGATGSGKSTLALSLFRAIEYMQGEIMIDGVDVSSLILSELRGRLNMVAQDGMLCS
                     GTLREALDVTGGRSDQDIFDALRKVHLISNEMSQEELDENPFANLETYVAIEGTNFSQ
                     GQRQLLCLARALLKQSKILVMDEATSSVDFETDSKITAMIKECFRGTTMLVIAHRLAT
                     IMQYDMVLVLDQGQIIESGKPQELIHNNQSVFYGLCMAQGKEEYATLCKIAAITA"
     gene            complement(29416..31191)
                     /locus_tag="CNI00090"
                     /db_xref="GeneID:3259701"
     mRNA            complement(join(29416..29685,29777..29879,29940..30018,
                     30069..30129,30185..30286,30344..30537,30599..30753,
                     30828..31191))
                     /locus_tag="CNI00090"
                     /product="farnesyltranstransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535159|gb|CF681000.1,gi|41535161|gb|CF681002.1"
                     /transcript_id="XM_572774.1"
                     /db_xref="GI:58271235"
                     /db_xref="GeneID:3259701"
     CDS             complement(join(29474..29685,29777..29879,29940..30018,
                     30069..30129,30185..30286,30344..30537,30599..30753,
                     30828..30890))
                     /locus_tag="CNI00090"
                     /codon_start=1
                     /product="farnesyltranstransferase"
                     /protein_id="XP_572774.1"
                     /db_xref="GI:58271236"
                     /db_xref="GeneID:3259701"
                     /translation="MDYSNLRQTIADPKWSESQENILMEPYIYISQNPGKEIRSKLID
                     AFNQWLEVDKDDLKVITKVVRMLHNASLLMDDVEDNSELRRGLPVAHTIYGVPQTINA
                     ANYVYFLAFQELLQLRSGVMGKGKDKEVDLVAAVNEELLQLHRGQGMDLFWRDSLTCP
                     TEKEYIDMVLGKAGGLLRLAVKLMMAKSDSNVDYVPLVNLISVWFQIRDDYMNLQSPA
                     YKSNKGFCEDLTEGKFSFPVVHGVRADTSNRQILNVLQKRTSSIDLKQHIVDYLSNHT
                     KSFHYTRKVLTELEVQIMEEIKALGGNQRLENVVLALSLEESEEHL"
     gene            31877..34460
                     /locus_tag="CNI00100"
                     /db_xref="GeneID:3259581"
     mRNA            join(31877..32448,32548..32764,32854..32915,32975..33050,
                     33133..33384,33443..33501,33571..34029,34081..34460)
                     /locus_tag="CNI00100"
                     /product="multidrug transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533188|gb|CF679029.1,gi|41533195|gb|CF679036.1"
                     /transcript_id="XM_572746.1"
                     /db_xref="GI:58271179"
                     /db_xref="GeneID:3259581"
     CDS             join(31920..32448,32548..32764,32854..32915,32975..33050,
                     33133..33384,33443..33501,33571..34029,34081..34388)
                     /locus_tag="CNI00100"
                     /codon_start=1
                     /product="multidrug transporter"
                     /protein_id="XP_572746.1"
                     /db_xref="GI:58271180"
                     /db_xref="GeneID:3259581"
                     /translation="MISIITLRDIMSSSLQPALLSNQMSITASLPSLDDANPIDDPNP
                     RTACVTPNLSKLTLLKTPMSEYSPTTPPLSLPVRLDQPISPLSTSAKILSPPAYPGSG
                     TLSDPYVVDFLPSSPLNPYNWSKRYRWAITALIGVTALCPPFASVSYSTTVGEVVEAY
                     GISRELAIAGISLFILGFGLGPLFWAPISEIYGRQIAFAASYPIFTIFNLGTALSHNT
                     VALMVTRFFAGVFGSSPLTNAGAQVGDMWAVNERALATSVFALAPFLGPVLGPIVGGY
                     VTERCGYRWVYWIQFIYAAVMTILSIIVVPETYAPTILRRRARSLQAAALSEGREEYY
                     IAKYDTVKKSKREVILVGLCRPFEMLFTEVIVGCLSIYGALIYGILYLFFTAFPIVFQ
                     QTRGWTVGESGLSFLGMGVGLISGVILNPFLSSHFYSRSRSQLQSHLISSGHAHTHPP
                     PEARLPVCCIGAILAPIGLFWFAWTSAPPVHWIVPIIACLPFGLAFLLIFTSMTNYLI
                     DSYELYAASALAAQAVSRCMFGAIFPLFASQMYETLGLHWAGTLVAFLSLACAPMPFL
                     FHRYGPYLRRKSKYAPSIPSVALNKAGEIEQARTEDEKNEEHSAVNRRRRELEAGGIE
                     PEWAADAGLDAHTDGAGERERAWDVEKGI"
     gene            <34723..>36167
                     /locus_tag="CNI00110"
                     /db_xref="GeneID:3259678"
     mRNA            join(<34723..34887,35024..35206,35282..35367,35706..35936,
                     36101..>36167)
                     /locus_tag="CNI00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_572744.1"
                     /db_xref="GI:58271175"
                     /db_xref="GeneID:3259678"
     CDS             join(34723..34887,35024..35206,35282..35367,35706..35936,
                     36101..36167)
                     /locus_tag="CNI00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572744.1"
                     /db_xref="GI:58271176"
                     /db_xref="GeneID:3259678"
                     /translation="MSSFDPFETRIQFINLLRKLNASQQSIQKVTSFAINYGSRCGED
                     LWECVIEQCNKGTLNTRINILYFLDTLVEESLALGPSEAPYGVLLTRDLKTLVDSVVP
                     DTNAGKLNLKSARQILESWRLRRVVDPSVVGEVLKSLEGRKYDTSNASPATPASPHPS
                     ALVSFAQHPPQSLHLSASVSAGAGVEDDTAISENALDVEFEQIWDRVPEEGLDDDDIL
                     QMRADMRRAKLEIAPTSTAPIQTDV"
     gene            <36825..>37823
                     /locus_tag="CNI00120"
                     /db_xref="GeneID:3259681"
     mRNA            join(<36825..36890,37030..37142,37353..37702,
                     37792..>37823)
                     /locus_tag="CNI00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_572742.1"
                     /db_xref="GI:58271171"
                     /db_xref="GeneID:3259681"
     CDS             join(36825..36890,37030..37142,37353..37702,37792..37823)
                     /locus_tag="CNI00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572742.1"
                     /db_xref="GI:58271172"
                     /db_xref="GeneID:3259681"
                     /translation="MASPALQKSTTPGPLQNIYYERKVATEKPCYICRRPTTTVLATL
                     KMEDWLYACDGHLSDLASLIPPPTPASPTPAKPSPEDIRKVVAEYQAREAGRSKSAAG
                     KDKEGEGGPKDQDKGKEKGRESPKSPASPAPASTPTPAPTPTHRKFALHRAIFDMRRN
                     ELKRREMGVKAREVGRGLPQVPRTGF"
     gene            38022..40316
                     /locus_tag="CNI00130"
                     /db_xref="GeneID:3259609"
     mRNA            join(38022..38087,38140..38155,38275..38337,38411..38469,
                     38708..39213,39310..39975,40102..40316)
                     /locus_tag="CNI00130"
                     /product="polyadenylation factor 64 kDa subunit, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530901|gb|CF676742.1,gi|41530911|gb|CF676752.1,
                     gi|41532692|gb|CF678533.1,gi|41532698|gb|CF678539.1,
                     gi|41539227|gb|CF685068.1,gi|41539240|gb|CF685081.1,
                     gi|41544660|gb|CF690501.1,gi|41544669|gb|CF690510.1,
                     gi|41551988|gb|CF697829.1,gi|41551996|gb|CF697837.1,
                     gi|41556921|gb|CF702762.1,gi|41556934|gb|CF702775.1,
                     gi|41561106|gb|CF706947.1"
                     /transcript_id="XM_572946.1"
                     /db_xref="GI:58271579"
                     /db_xref="GeneID:3259609"
     CDS             join(38057..38087,38140..38155,38275..38337,38411..38469,
                     38708..39213,39310..39975,40102..40128)
                     /locus_tag="CNI00130"
                     /codon_start=1
                     /product="polyadenylation factor 64 kDa subunit"
                     /protein_id="XP_572946.1"
                     /db_xref="GI:58271580"
                     /db_xref="GeneID:3259609"
                     /translation="MPPNASKTVFVANIPYDVSEEQLANVFSEAGPVANVEIKFDANT
                     GRSKGYAFVQFYDEATALSAVRNLQDAPVNGRNLRVELSTDEPGPRRRGPGPGAVGVG
                     AAPGAGGPGVGGPSASLGGPRPMVPAPGPGGAPPFTSTGAGAPGYPPRAPFDPRYPQA
                     HSQSHENTPPPAGVGARRQGGDDIDLRMAPQGIDLLPGQKAVDTISKTLAGIAPGQMG
                     DVMTSMKSLIQTNPDQARQLLSQQPQLAYALFQAMLLLNLVDPSVLSSIQPLAASASA
                     AASGGAASVAPGPGGAGARAPNYPPYPPPTQTQGPPGGQQAFRPPPQALYGGAPPLPN
                     QNQNQNQNQNPPYPPYPSGPGVPGGVSGAGAGIPPPTSTPVPPTPHPAHAVPVGPPGG
                     PAPPAPGLASLPPAAQAALSTLPPDQQQMLLQVLQLSPAQIAALDPTQKASVMQLRQQ
                     FLGTA"
     gene            complement(40490..42003)
                     /locus_tag="CNI00140"
                     /db_xref="GeneID:3259440"
     mRNA            complement(join(40490..41008,41076..41448,41507..41618,
                     41698..41807,41952..42003))
                     /locus_tag="CNI00140"
                     /product="endoplasmic reticulum receptor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533729|gb|CF679570.1,gi|41533739|gb|CF679580.1,
                     gi|41546811|gb|CF692652.1,gi|41546825|gb|CF692666.1,
                     gi|41572671|gb|CF718512.1,gi|41572677|gb|CF718518.1"
                     /transcript_id="XM_572773.1"
                     /db_xref="GI:58271233"
                     /db_xref="GeneID:3259440"
     CDS             complement(join(40727..41008,41076..41448,41507..41618,
                     41698..41807,41952..41992))
                     /locus_tag="CNI00140"
                     /codon_start=1
                     /product="endoplasmic reticulum receptor"
                     /protein_id="XP_572773.1"
                     /db_xref="GI:58271234"
                     /db_xref="GeneID:3259440"
                     /translation="MATPANATSVVDAQKRAPQELKNVVDFLRAKAGPKVRLGILNGK
                     RVEYFKGKTAIRTLLSPHYQKLKKVPPVKDEDEAKELMVRLLPFAFFLRTDRPVPETP
                     IPSGQPKPLRLSPQQSFDPLAYYTWFYDGSPLYTYLGGLAMVLIMLAGVMFPLWPVKL
                     RIGVWYLSVGVLGLVGAFLGLAVVRLVFWCVTVLTMKRAIWIFPNLFEDVGFVDSFIP
                     GWDYDEPKKKKKSGTHAKGHTHIKKHKSGSGSASGKAKHGQGHAGGVEVSSPAPSSAL
                     PTAAEVGARTEGESEGVRKRVTVEDADEE"
     gene            complement(42222..>43461)
                     /locus_tag="CNI00150"
                     /db_xref="GeneID:3259652"
     mRNA            complement(join(42222..42352,42410..42512,42571..43031,
                     43112..>43461))
                     /locus_tag="CNI00150"
                     /product="mitochondrial protein required for respiration,
                     putative"
                     /transcript_id="XM_572772.1"
                     /db_xref="GI:58271231"
                     /db_xref="GeneID:3259652"
     CDS             complement(join(42259..42352,42410..42512,42571..43031,
                     43112..43461))
                     /locus_tag="CNI00150"
                     /codon_start=1
                     /product="mitochondrial protein required for respiration,
                     putative"
                     /protein_id="XP_572772.1"
                     /db_xref="GI:58271232"
                     /db_xref="GeneID:3259652"
                     /translation="MARPSIRLFSLAFTPRPLGTPRVARLSLRPRTTGAHRPFGSAPS
                     GVNSTASKYTPKSSSSSISILLRPTSLILILVPILTGFLGVWQLKRLRWKLDLIEEVD
                     RNLHKEPMLLPGNINMDALPEFSFRRVLIKGQFTGPPILLGPQTYEGFPGYHLILPFL
                     RPGDGGGSSGGGGSTILVNRGFITTTRANAIRAGSQVPPGLTRDKAGKLVGNGEEVVV
                     EGLLPKTGERTVWMHENKPETNEWFWKDVEKMAEVCGGEEKGVQPVLVDALAEPDQSP
                     TLLMQQGIPVGRPAHVELRNQHAQYAAIWLSLSASTTVMLGYILTRGRGKPKTRRPKL
                     Y"
     gene            complement(43627..>46176)
                     /locus_tag="CNI00160"
                     /db_xref="GeneID:3259392"
     mRNA            complement(join(43627..43827,43901..44066,44124..44239,
                     44298..44801,44855..45277,45355..45498,45557..45715,
                     45782..45893,45938..>46176))
                     /locus_tag="CNI00160"
                     /product="ubiquitin-like conjugating enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529911|gb|CF675752.1,gi|41529919|gb|CF675760.1,
                     gi|41558321|gb|CF704162.1,gi|41558332|gb|CF704173.1,
                     gi|41560047|gb|CF705888.1,gi|41574186|gb|CF720027.1,
                     gi|41574190|gb|CF720031.1"
                     /transcript_id="XM_572740.1"
                     /db_xref="GI:58271167"
                     /db_xref="GeneID:3259392"
     CDS             complement(join(43663..43827,43901..44066,44124..44239,
                     44298..44801,44855..45277,45355..45498,45557..45715,
                     45782..45893,45938..46176))
                     /locus_tag="CNI00160"
                     /codon_start=1
                     /product="ubiquitin-like conjugating enzyme"
                     /protein_id="XP_572740.1"
                     /db_xref="GI:58271168"
                     /db_xref="GeneID:3259392"
                     /translation="MAPLQFQPLASQPTPAFWAALAAHKLNHLKLDDSHLPITAQIEP
                     AKRVLINKERVDDTADVGIDGSLVVGGDAFEAERGRLPPNAVSVTGTLKIFNTIEEFK
                     DTSAKKRLFDDLVSQMLESFDTDRPVLNPFLLVTFADLKKYVYHYWFAFPALVSSPAW
                     VMDGEFMPVDEIEDIRKLAQSHFQHNTTAFLLKGAAPHLSAAPLSSCSTFYDKTQSEM
                     VTVVFHDTSSLPSNPGWGLRNVLYYLSAKHGITSLVVICLREGSSSTQASLSLSSPPS
                     TAPAKPPQAVGWERHPSGKLSPRVADLGPMMDPTRLAAQAVDLNLKLIKWRLLPALDL
                     DKISGTRCLLLGAGTLGCYVARILMGWGVRNITLVDSSTVSYSNPVRQPLFTFSDCLN
                     GGLPKAPTAAKKLQEIFPGVNAQGVVLGIPMPGHPISSSDDAVEKDVAKLEALVKSHD
                     AVFLLMDSRESRWLPTVLGRKWGKVVVNAALGFDSFLVMRHGAGAGAGARRIQSDEGG
                     VGEKGLGCYYCNDIVAPTDSLSDRTLDQMCTVTRPGVAPIAAAMAVELLISVLQHPLG
                     VHAPAERPDTAETSTSTKTSPLGCVPHQLRGQMYQWKTQIVEGEAFDRCTGCSDYVLN
                     EYETNGFAFLRRVFNEKDYLEKVTGLDELYRESEKVIEGMEGLDWDSEGEE"
     misc_feature    46310..46381
                     /note="C-rich"
     gene            46326..48591
                     /locus_tag="CNI00170"
                     /db_xref="GeneID:3259511"
     mRNA            join(46326..46541,46614..46976,47028..47335,47420..47660,
                     47726..48591)
                     /locus_tag="CNI00170"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533614|gb|CF679455.1,gi|41533624|gb|CF679465.1"
                     /transcript_id="XM_572738.1"
                     /db_xref="GI:58271163"
                     /db_xref="GeneID:3259511"
     CDS             join(46529..46541,46614..46976,47028..47335,47420..47660,
                     47726..48393)
                     /locus_tag="CNI00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572738.1"
                     /db_xref="GI:58271164"
                     /db_xref="GeneID:3259511"
                     /translation="MTVYLDDGDGKHTIAVTARLQASALAPSKPQIPPLETVKAHLGW
                     SSSSSLTAKQVSELKRKQWEMFTQDQAKYEAQRRSEGKPAVEGYDVRVGDTLRAVGVL
                     EEWSWKEGVIRQMVVSPSTGGSIQVVAPEEQYIHAQQVDHLHKTLYSRPFEMPNAKPP
                     AKTSTSLRNPTANSSNVQDVQDAEPPSSPGWHPKSDSTVLTLDDSVSDSRLASPSRST
                     SWPALVLGNSPKPKLRHPSRLPPASLTRPTFRRYILHTVISHVEAALQVLLTPEDEGA
                     DNSREGHGSDKGDGGHGDEEKKEKGKEGIERFPPSAPPPRKKTTNGQGNCRSPHPIHT
                     SLPARGPYIKPVGRAGSGAGSACEGKRAEEGNRLSFPTPTHPKRIHLPPPSLQTNILL
                     PYPFRKRTRTPGDGHHSAQGDGRGRRDCASPARDRFHAVPRRPGDASRQQHDGYIRLP
                     PPPTATLIPPPRSPSPLPPIPIPIPIPIPTQTPRKTRHTHPHHQAHQHPDSVGERRPL
                     GTDDVGNRSSWDALGPRTGLGG"
     misc_feature    48148..48206
                     /locus_tag="CNI00170"
                     /note="C-rich"
     misc_feature    48621..48652
                     /note="A-rich"
     gene            complement(<48772..>51052)
                     /locus_tag="CNI00180"
                     /db_xref="GeneID:3259385"
     mRNA            complement(join(<48772..49090,49162..49232,49324..49423,
                     49492..49617,49683..49786,49881..50041,50139..50255,
                     50312..50475,50530..50768,50831..>51052))
                     /locus_tag="CNI00180"
                     /product="nicotinamide mononucleotide permease, putative"
                     /transcript_id="XM_572736.1"
                     /db_xref="GI:58271159"
                     /db_xref="GeneID:3259385"
     CDS             complement(join(48772..49090,49162..49232,49324..49423,
                     49492..49617,49683..49786,49881..50041,50139..50255,
                     50312..50475,50530..50768,50831..51052))
                     /locus_tag="CNI00180"
                     /codon_start=1
                     /product="nicotinamide mononucleotide permease"
                     /protein_id="XP_572736.1"
                     /db_xref="GI:58271160"
                     /db_xref="GeneID:3259385"
                     /translation="MASTPRDGVIIPSDAVTDKELYGDVDIKETVEHVEDKSGGNIPV
                     QDGPLAAEIELLRSMPPEDLAIEERKLLRKIDFTLLPTLFVLLILNYLDRNALASARV
                     QGIEKSLGMVGTQFNSAISLLFVGYILGQIPSNLILSKTRPSIYLSVCVMVWAIVSLC
                     TGFVQNYHQLLAVRILLGFTESPYFPGALFLLSTWYTKKELAYRTAFVTLHWLFAVWS
                     VLRLDCRRRAKRFGWQTGYGVMAMALHPRVAIFVLPDYPATTKWLSTREKAVAVWRME
                     RDGGSRDEDDEGLFHSLKLALCDYRLYLLATVIITKTTAGAVTQFFPTVIATFGFNKV
                     ITLLLLAPPYLVTAVLSLLISRLSDRRPERCFHLALPLTVGMIGYIIAVSTLKTGPRY
                     FSLFLMLGGLFGSYNVALAWISSTFPRPRAKRAAAYAIINSLGNIAQIWSPYLYPSTD
                     APRYTVSLSLSLSFFSRGSTNPTLALTCELATDMGNQTAFATNSVMAAVAILFCFVLR
                     FFLKRGNAKMDREDAEAEARGEASEERVRYVL"
     gene            <52111..>53526
                     /locus_tag="CNI00190"
                     /db_xref="GeneID:3259572"
     mRNA            join(<52111..52382,52435..52533,52594..52745,52800..52994,
                     53063..53227,53285..>53526)
                     /locus_tag="CNI00190"
                     /product="tartrate dehydrogenase, putative"
                     /transcript_id="XM_572763.1"
                     /db_xref="GI:58271213"
                     /db_xref="GeneID:3259572"
     CDS             join(52111..52382,52435..52533,52594..52745,52800..52994,
                     53063..53227,53285..53526)
                     /locus_tag="CNI00190"
                     /codon_start=1
                     /product="tartrate dehydrogenase"
                     /protein_id="XP_572763.1"
                     /db_xref="GI:58271214"
                     /db_xref="GeneID:3259572"
                     /translation="MSPVRVPSHGDGWASTPQTKQVYSIASIPADGIGPEVVEAAITV
                     LKAIAKKRGTFQLDFTNFDWSSETYKKTGRYVPDNHLDILRKFDAILFGAVGAPDVPD
                     HISLWGLRLAICQPLQQYANVRRTRVLPGTESPLRNCKPGQLDWVIVRENSEGEYAGH
                     GGRSHNGYNHEVATEISIFTRVGVERIARFAFQLAQSRPRKKLTYVTKSNAQRNGMVM
                     WDEVVNEVAKEFPDVELDHMLVDAMTVRMVLHPESLDTIVATNLHADILSDLAAALAG
                     SIGIAPTANLDPSRQNPSMFEPIHGSAFDITGKGIANPVATFWTAVEMLEWLGEKEAG
                     QQLMEAVEAVCVDGIKTKDLGGSATTKEVTDAVVKRILQG"
     STS             54633..55422
                     /standard_name="Xba4"
                     /db_xref="UniSTS:470717"
     gene            <56426..>56876
                     /locus_tag="CNI00200"
                     /db_xref="GeneID:3259769"
     mRNA            join(<56426..56504,56636..56739,56817..>56876)
                     /locus_tag="CNI00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_572734.1"
                     /db_xref="GI:58271155"
                     /db_xref="GeneID:3259769"
     CDS             join(56426..56504,56636..56739,56817..56876)
                     /locus_tag="CNI00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572734.1"
                     /db_xref="GI:58271156"
                     /db_xref="GeneID:3259769"
                     /translation="MRRVSNQYCQIRLENEGQSRCQRNVLDAPRRAEIESMIEAAMEG
                     HIQLTGSTRREREQILELRAGIKTYIRTTPPPPRRT"
     gene            complement(<57232..>58368)
                     /locus_tag="CNI00210"
                     /db_xref="GeneID:3259685"
     mRNA            complement(join(<57232..57355,57413..57486,57561..58183,
                     58251..>58368))
                     /locus_tag="CNI00210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572771.1"
                     /db_xref="GI:58271229"
                     /db_xref="GeneID:3259685"
     CDS             complement(join(57232..57355,57413..57486,57561..58183,
                     58251..58368))
                     /locus_tag="CNI00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572771.1"
                     /db_xref="GI:58271230"
                     /db_xref="GeneID:3259685"
                     /translation="MVQQTAAFVLSQLARHRSSWNKETVCPPLIVGVQGPQGAGKSHL
                     TGLLPAYLEKHYDLRLATMSLDDFYLTHSDQVKLAQSEPDNPLLSGRGPAGTHDLPIL
                     EQCLAKLKSINDRVSAKSPTVTKGQSLQLPIYDKSLFKGEGDRSKEVVEVQGPIDVVI
                     FEGWMNGFGPLSNDKLEERYAEAGRQWPSSSLNDPARVMPTILLYSRSTLHSINQNLR
                     QYEVLWDQIDCFVQIRPLDLSYVWSWRLQQEHNMKAKNGGNGMTDEQVRHFINRYMPS
                     YELFQDGIDKETSSWSGKGLRFIVNIQREIVGTESF"
     misc_feature    58713..58736
                     /note="AT_rich"
     gene            complement(59067..59158)
                     /locus_tag="CNI00220"
                     /db_xref="GeneID:3259800"
     tRNA            complement(59067..59158)
                     /locus_tag="CNI00220"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:3259800"
     gene            complement(59343..61061)
                     /locus_tag="CNI00230"
                     /db_xref="GeneID:3259501"
     mRNA            complement(join(59343..59746,59809..60160,60224..60431,
                     60487..60619,60674..60736,60801..61061))
                     /locus_tag="CNI00230"
                     /product="eukaryotic translation initiation factor 2 alpha
                     subunit, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538049|gb|CF683890.1,gi|41538053|gb|CF683894.1,
                     gi|41541878|gb|CF687719.1,gi|41541885|gb|CF687726.1,
                     gi|41549010|gb|CF694851.1,gi|41549021|gb|CF694862.1,
                     gi|41550332|gb|CF696173.1,gi|41550342|gb|CF696183.1,
                     gi|41560213|gb|CF706054.1,gi|41560219|gb|CF706060.1,
                     gi|41564177|gb|CF710018.1,gi|41564183|gb|CF710024.1,
                     gi|41564906|gb|CF710747.1,gi|41564916|gb|CF710757.1,
                     gi|41566185|gb|CF712026.1,gi|41566190|gb|CF712031.1,
                     gi|41568351|gb|CF714192.1,gi|41568359|gb|CF714200.1,
                     gi|41569971|gb|CF715812.1,gi|41569981|gb|CF715822.1"
                     /transcript_id="XM_572732.1"
                     /db_xref="GI:58271151"
                     /db_xref="GeneID:3259501"
     CDS             complement(join(59633..59746,59809..60160,60224..60431,
                     60487..60619,60674..60736,60801..60833))
                     /locus_tag="CNI00230"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2 alpha
                     subunit"
                     /protein_id="XP_572732.1"
                     /db_xref="GI:58271152"
                     /db_xref="GeneID:3259501"
                     /translation="MPRFYENKYPEVDQLVMVQVQSIEDMGAYVKLLEYDNIEGMILL
                     SELSRRRIRSVQKLIRVGRNEVVVVMRVDPDKGYIDLSKRRVSAEEVVKCEEQYEKGK
                     AVDSIITQVAKKRGVTPESLYEKIAWPLHRQYGHAYEAFKLSISEPEAVFGSLELDEE
                     TLADLRSGIARRLTPKPVKVRADIEVKCFSYAGIDAIKRALTAGEAVSTPDVPIKVRL
                     VAPPLYVMSTTSTDKNAAIELMEKAVEVIGETVRKDKGDITIKMKPKVVSETEDAELK
                     ALMEQFEAANMDQAGDDESSEEDE"
     gene            61307..62459
                     /locus_tag="CNI00240"
                     /db_xref="GeneID:3259774"
     mRNA            join(61307..61627,61695..62114,62173..62256,62315..62459)
                     /locus_tag="CNI00240"
                     /product="enoyl-CoA hydratase, putative"
                     /transcript_id="XM_572730.1"
                     /db_xref="GI:58271147"
                     /db_xref="GeneID:3259774"
     CDS             join(61330..61627,61695..62114,62173..62256,62315..62364)
                     /locus_tag="CNI00240"
                     /codon_start=1
                     /product="enoyl-CoA hydratase"
                     /protein_id="XP_572730.1"
                     /db_xref="GI:58271148"
                     /db_xref="GeneID:3259774"
                     /translation="MLARTLLKPSQSTYRLTIRAMSTSAEQLVIPSRSPSNNVAILTL
                     NRPKALNALSTPLFNALNSELEKAETDESVRAIVITGGDKVFAAGADIKEMKDKEFAE
                     AYTSNFLGSWNQIASIRKPIVGAVAGYALGGGCELAMLCDILVASPTAVFGQPEITLG
                     IIPGMGGSQRLTSLIGKARAMDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKV
                     AENVSKFGKVAVQAGKEAVNGSLDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKR
                     KPTWSDK"
     gene            complement(62644..64271)
                     /locus_tag="CNI00250"
                     /db_xref="GeneID:3259702"
     mRNA            complement(join(62644..62880,62980..63064,63136..63393,
                     63477..63570,63636..63752,63808..64059,64139..64271))
                     /locus_tag="CNI00250"
                     /product="DNA-binding protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537060|gb|CF682901.1,gi|41538640|gb|CF684481.1,
                     gi|41576377|gb|CF722218.1,gi|41576386|gb|CF722227.1"
                     /transcript_id="XM_572770.1"
                     /db_xref="GI:58271227"
                     /db_xref="GeneID:3259702"
     CDS             complement(join(62799..62880,62980..63064,63136..63393,
                     63477..63570,63636..63752,63808..64059,64139..64228))
                     /locus_tag="CNI00250"
                     /codon_start=1
                     /product="DNA-binding protein"
                     /protein_id="XP_572770.1"
                     /db_xref="GI:58271228"
                     /db_xref="GeneID:3259702"
                     /translation="MSDKQQLIDMGFDPARIDWALRATNKAGLQPAMDHLLANSDKPI
                     PEAMDEQVDEDDEEAVAAHIKKLGGAVDDSDAVAKSIKCSECGKIFRSQATASFHAEK
                     SGHDQFEESTEEIKPLTEEEKKAKLQELREKLAIKRATQSKEDEKANRANEAIRRKAG
                     QDTGKVREDLKLKEALKDAEQKKREKLEDQKARAAIKAQIEADKRERAEKAAREKALR
                     EGKAIPTSSSPVPTIVPKANTGMKSSENPETRLQIRLATGGTPMTKTFPSDNTLIDVA
                     EWVASEKLEYNVDTIGFSMTFPRKTFSREDMKKSLKENGLTPSAVLIAS"
     gene            <64455..>65037
                     /locus_tag="CNI00260"
                     /db_xref="GeneID:3259696"
     mRNA            join(<64455..64706,64768..>65037)
                     /locus_tag="CNI00260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572728.1"
                     /db_xref="GI:58271143"
                     /db_xref="GeneID:3259696"
     CDS             join(64455..64706,64768..65037)
                     /locus_tag="CNI00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572728.1"
                     /db_xref="GI:58271144"
                     /db_xref="GeneID:3259696"
                     /translation="MPPFATRPLNSTKSHPIFAQIRRHPFILFGIPFIGIIVGSSFAL
                     QAFTQTRYDYQETKVKSVGKEEELGMKSGRRKIDLKEEYYRLNNPTGDDSSLENSLAM
                     PSSFSSPSSLDASLASAPTPPKKKKFSMASVSQDDYEPVRVPRPVGVPEWGGGRSGEE
                     APMKGYRKEDRWV"
     gene            complement(<65484..>68782)
                     /locus_tag="CNI00270"
                     /db_xref="GeneID:3259614"
     mRNA            complement(join(<65484..66150,66239..68081,68131..>68782))
                     /locus_tag="CNI00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_572967.1"
                     /db_xref="GI:58271621"
                     /db_xref="GeneID:3259614"
     CDS             complement(join(65484..66150,66239..68081,68131..68782))
                     /locus_tag="CNI00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572967.1"
                     /db_xref="GI:58271622"
                     /db_xref="GeneID:3259614"
                     /translation="MNRHTPTPSSHLTSSPPLSYTWSDTSGENDMRPREGNRAPSTST
                     SVWSDEGTAVPRHGDGDDDYGYADEDGHELKGNGVKEGKLIDYDDEPQPHQREMAPGD
                     KLRDLLRQMDEEVRRAAPSESKETVVARQWMGYTRPRQFQPDARDEEIEEEELEEDQE
                     EMREGASPARSSSVTEQESPPTPPPRFGNPYSRRSERRGSPAFAQGRLPSRAAVLLQS
                     TSHMDEGLRAVIEPEPEAKHQQKSPPSQLHAYIASHPELRSSSSSRTHQPVPQSSRSR
                     SKRKEKEIEQDYESEHEPSSPSRHHFEKELSQSASRRHYRTAYSPSRASPPSNALPST
                     ASSHRYPTSPRPLEPKYQHRPIPPTPRRSSIDPLPSTHDEFAMHLKGLEVRAEVELDL
                     DEGVSAVGWEESTVEGDEEEIMYEDGVDRSGHRDRSGTARPDSSRGENLYTHSQSRES
                     LYQAASRSHSSPLSRRLPTSSPSPPALPDLPSHSISGSEEEQEIDTYSLRRARMFSGE
                     RKGKMPMVGNGSDASASASASRSRSYSRSLSVRLNEDEDKEATKEYQMEDEAVKYNAP
                     GEKFLEEVWEGGGVTIEREQSNYHSSDRSSRTPLPTNHRHTPSPVRLPVRHSRARTPP
                     TTFQTGTTPSSTTTSPGQRQPQTLLSSRALSQSQSPTQTPKFPTPLPSSQSNANPVQK
                     QLATPSHSHSQTLALGPTPRPPGAWNITPFPQRPQREPEPPRHQDQIASESGSKTGRV
                     RFSPLRYEATIHREDYEREDEMEKKGKREEERGDVSILTLSLSPRHKNPKSPKSPKNS
                     KSRTSPERQIREGKMDGDIGDISWTAKLARSVTSRISIPMRSTTYNSHLPQLTSAHTH
                     TQTASSKLQTAQQSWLAALSSISTSHPHLHQHNQHAPSNSPTSLALRTSQTLGKGMNK
                     AVGWSRWVWWVLMEMVLLWAVFRVTLDYAGSGVYLGRDPFHPLSRPLGLGPPPSLSSP
                     PSFSVGGTPDMMERDRETNAQRQWAKASRYVNLEIPIPGSLKTLVGKQGSANFFDLVE
                     SWGWGTAFFGEGEPAGTWAGVPT"
     gene            68996..70323
                     /locus_tag="CNI00280"
                     /db_xref="GeneID:3259667"
     mRNA            join(68996..69700,69752..70323)
                     /locus_tag="CNI00280"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557300|gb|CF703141.1,gi|41557307|gb|CF703148.1,
                     gi|41568899|gb|CF714740.1,gi|41568905|gb|CF714746.1"
                     /transcript_id="XM_572948.1"
                     /db_xref="GI:58271583"
                     /db_xref="GeneID:3259667"
     CDS             join(69061..69700,69752..70314)
                     /locus_tag="CNI00280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572948.1"
                     /db_xref="GI:58271584"
                     /db_xref="GeneID:3259667"
                     /translation="MELSSNTDDDLRDVFKLLYADDDWALTSDSELDDSEQLGNADGS
                     EIDVADDEEQHTIRIYSGRITKKRLFSALDSLLSPGYETDTKRQRIYNPPAPSIPSLI
                     LSTQPMPALPLSKVYAPFSALSLLSRLMTFQPYTYSPQHPLTLSPVRAAMKGWVNEGR
                     EGLKCDVCGARWGLGGLEKVRDEAMKSNLGERLAKGFEERHEKNCAWRICASPGNLYE
                     QLRHLVHPPITSSLAPLASHLLLECLALPSLRLLSPLNPLQVERLVSLFKPSSTFSIP
                     SPATDVASQLALFGWFPYHPNYPTIQISLNTPSSRTEIVCCRICHRRIGLWNFSNEKD
                     GVKRFDVLNEHLVWCPVRIQDGEKEWWSESGLLDGQSTQAKRIGEGGIKGLVKVSEKM
                     EKRSWRRS"
     gene            complement(<70630..>72275)
                     /locus_tag="CNI00290"
                     /db_xref="GeneID:3259791"
     mRNA            complement(join(<70630..70724,70795..70893,70977..71029,
                     71236..71247,71310..71352,71490..71545,71707..71963,
                     72057..72151,72200..>72275))
                     /locus_tag="CNI00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_572965.1"
                     /db_xref="GI:58271617"
                     /db_xref="GeneID:3259791"
     CDS             complement(join(70630..70724,70795..70893,70977..71029,
                     71236..71247,71310..71352,71490..71545,71707..71963,
                     72057..72151,72200..72275))
                     /locus_tag="CNI00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572965.1"
                     /db_xref="GI:58271618"
                     /db_xref="GeneID:3259791"
                     /translation="MRPALTLLALLPYLGGTFANTCRAAGDVSGTSVIGDNLLAGSNT
                     AAGGDANTAKAASYYASSASSVVSASASSAQSAAYPQGSQMGTDLVLSNPSGDCKCGY
                     SISSLNDEYFPYKFAYTFSALSDGDATDGLAAAGWVVNDGEGVPDGGVAKWGGWDLPG
                     IPRRLIPMEFGTATGLLTETSTTRYYNGAKQDSPTENQPEHSMIFTINNWSNGGTGWT
                     QGPPTGEDSDLRVKSVLLYYRTQDVQDMATLDSSCTDSDVCKV"
     repeat_region   72156..72193
                     /rpt_type=tandem
                     /rpt_unit_seq="cag"
                     /satellite="microsatellite"
     gene            complement(72780..>74817)
                     /locus_tag="CNI00300"
                     /db_xref="GeneID:3259679"
     mRNA            complement(join(72780..73588,73645..73867,73922..74089,
                     74147..74349,74404..74601,74663..>74817))
                     /locus_tag="CNI00300"
                     /product="GPI-anchor transamidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41554176|gb|CF700017.1"
                     /transcript_id="XM_572769.1"
                     /db_xref="GI:58271225"
                     /db_xref="GeneID:3259679"
     CDS             complement(join(72874..73588,73645..73867,73922..74089,
                     74147..74349,74404..74601,74663..74817))
                     /locus_tag="CNI00300"
                     /codon_start=1
                     /product="GPI-anchor transamidase"
                     /protein_id="XP_572769.1"
                     /db_xref="GI:58271226"
                     /db_xref="GeneID:3259679"
                     /translation="MSLLARFRRRNPPPPPDPNSVNYTAEHVALAKTIARRQKLSRIF
                     WKNVSKIQAALTFIGVLWLLALPYEGLWKRTYVDEHALQPAQVAVYFDWANVHKADVY
                     LGELERLSSSNSTFTERTDYLQNAFSAAGLHTGNTTTATYAHVTPPRATGMETILVSA
                     NWLSRDGGENLRGVATLLAMGDFLRGQNHWAFDFVLVVGEECQSGLAQFMEQYHSLFS
                     GVIWTGLNIDYPGHSFSHLGVFYEGTNGRLPNQDVINTVSRVAQYTGQVPLRYHDIPD
                     EPLHGIAWLGKYLLGAKHLLHHFAYAALGRASAGHGSLAKYRIDSLTLYCTPATGPHG
                     FHTLGRTLESTLRSFNNLLERLHASYFFYLLPSPNHFIPVGNYLPAAVLLGASLTVGG
                     FDCPSPLEGLVYMSFAFGSALLLWVTGLPTYLFFPTFLFFPRPRGLAHKSLESMSLLL
                     YGALIPTLAMVNFPQSIFLAFLAHLYLRLPGKWPRLVTLAVTPLAIGLAMQGFGKVDL
                     EREWRELGNFGWVGFYVAWIPLWMLGTMLFLGKEKKASGGVVENK"
     gene            75196..78921
                     /locus_tag="CNI00310"
                     /db_xref="GeneID:3259521"
     mRNA            join(75196..75707,75765..77049,77099..77343,77414..77485,
                     77551..77890,77966..78015,78093..78921)
                     /locus_tag="CNI00310"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530524|gb|CF676365.1,gi|41530527|gb|CF676368.1,
                     gi|41540817|gb|CF686658.1,gi|41540821|gb|CF686662.1,
                     gi|41566784|gb|CF712625.1,gi|41566795|gb|CF712636.1,
                     gi|41571246|gb|CF717087.1,gi|41573701|gb|CF719542.1,
                     gi|41573704|gb|CF719545.1"
                     /transcript_id="XM_572764.1"
                     /db_xref="GI:58271215"
                     /db_xref="GeneID:3259521"
     CDS             join(75611..75707,75765..77049,77099..77343,77414..77485,
                     77551..77890,77966..78015,78093..78742)
                     /locus_tag="CNI00310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572764.1"
                     /db_xref="GI:58271216"
                     /db_xref="GeneID:3259521"
                     /translation="MWRTTKQWRPPPIHLLLWLVLVVVVGLLTPVDARSPHPAPLRRA
                     TTATSHLSILPRRPKNGLVPRHSTLLPPPPSTLKHSDTLVLTLDLPDLLPFEVKLFVK
                     PSEHMFHPDARIKHGEQVIGELREEDWRLYTGEVVHPSYIDRLTTLHAIGAHQPLSER
                     SQILGRASVIVHHPGDLDGHDAVWEGSFTVGGELYNVVTRENYERVKTWEDVNVQGMG
                     RMVIFRQSDMRHDQGTNKTIPSCSHDSLAFNDLSNPVFNTFSTHDTSSYSFLNPLGMF
                     WKRDDTGGMTGSSNYISTINDTSGCPDTQKIVYMGVALDCNYVAAYGSPDAARTQVLN
                     NWNQVSALYKSAFKISLGIIELQVQNITCPSTPVSGEEWNVGCDANITLDTRLGDFSA
                     WRGAKGDDGAGLWHLMSACPTDSEVGVAWLGTLCQTDSSEQSSGTVSGTGISTATKTE
                     WSLIAHEIGHGFGAIHDCTSGCSLSGSCCPLTTSTCDANGQFIMNPTTSTTEQTFSGC
                     TLGNICSNIGNRAVSTSCIETPGARDVISLQQCGNGIVEDGEDCDPGGNTTSTCCDSS
                     TCKFTSGAVCDPSNSACCTSSCQYSPSNTTCRPAVNDICDYAEYCTGTSASCPEDKTA
                     EDGTSCGSDGLECASGTCTSLDKQCSTAGATMGLSEACGQRDDTSCVVTCKDPNSTSS
                     CVVLQTPLVDGSPCGYGGHCYNQTCESGSWQATVAAWYRQNLQIAIPVTIIAGLIILA
                     ILFFIARCIYRSCCGRRGARAGGAARNTKYVPANGDAYYGPPPTQSGGGAMPMSAVAA
                     PQPALQRGYESRASVEPLMAGSGSGVGAGYGRPNTDYDHDHRQVYPPGQRYSQGYGDT
                     FEGQGYEYNQAPQYSSFAPGTGGGGGGGGVYGQTGGWVDDRTWNGQYYGRQEAYGR"
     repeat_region   78634..78659
                     /rpt_type=tandem
                     /rpt_unit_seq="gga"
                     /satellite="microsatellite"
     gene            complement(<79003..80640)
                     /locus_tag="CNI00320"
                     /db_xref="GeneID:3259480"
     mRNA            complement(join(<79003..79145,79228..79500,79577..79669,
                     79729..79792,79850..79921,79972..80053,80108..80402,
                     80451..80640))
                     /locus_tag="CNI00320"
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     putative"
                     /transcript_id="XM_572768.1"
                     /db_xref="GI:58271223"
                     /db_xref="GeneID:3259480"
     CDS             complement(join(79003..79145,79228..79500,79577..79669,
                     79729..79792,79850..79921,79972..80053,80108..80402,
                     80451..80577))
                     /locus_tag="CNI00320"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /protein_id="XP_572768.1"
                     /db_xref="GI:58271224"
                     /db_xref="GeneID:3259480"
                     /translation="MTNPLLAHFQDTFFPPCRVGINGFGRIGRAAFRASLERDDLIVV
                     AINHTAPSIDYLLHAIKYDSTHGTSRHANDLSIKDGALYYKDRRIELFSQRDPLLLDW
                     KSAGVEYVVESTGKMTTVATASAHIKSGARKVVISAPSKDAKTIVVGVNRKDYDSSMS
                     VVSNASCTTNCLAPLAKVLNRAFGIEFGMMTTVHASTSSQPILDGYSKKNRRLGRGVG
                     SNIIPTTTGAATAVQLVLPELAGKFTGVSVRVPVDNVSMVDLTVRLNKPVASKEELFR
                     PIREASTGLSSLGPLANVLCVNDDELVSRDFLGWQHSCIVDSAASVMLNDRVFKIIAW
                     YDNEYGYACRLLDLVRFIHEYDNGKVPTPTPSGVQTPSGVHTPILRSI"
     gene            complement(81166..81257)
                     /locus_tag="CNI00330"
                     /db_xref="GeneID:3259801"
     tRNA            complement(81166..81257)
                     /locus_tag="CNI00330"
                     /product="tRNA-Ala"
                     /codon_recognized="GCU"
                     /db_xref="GeneID:3259801"
     gene            <81883..>82702
                     /locus_tag="CNI00340"
                     /db_xref="GeneID:3259420"
     mRNA            join(<81883..81942,81999..82102,82179..82251,
                     82370..>82702)
                     /locus_tag="CNI00340"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_572765.1"
                     /db_xref="GI:58271217"
                     /db_xref="GeneID:3259420"
     CDS             join(81883..81942,81999..82102,82179..82251,82370..82702)
                     /locus_tag="CNI00340"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_572765.1"
                     /db_xref="GI:58271218"
                     /db_xref="GeneID:3259420"
                     /translation="MRLQAKSLKSAPPIDVLINNVSFAVAANAPFWEQDLDNVASVMD
                     VNLSGAYDYYSMMQRKPRPTGTILNISSITGHQAHAGVEGFTNVLRHELVGTNIRVLL
                     NRPGTTRTEFHARRHGYDREKTDATYSGSCPLVADDIAVSCLYQCLQPERISVVLLET
                     LGTAQRSLYSVDQEYESRNGQSECRKWSE"
     gene            <83152..84844
                     /locus_tag="CNI00350"
                     /db_xref="GeneID:3259568"
     mRNA            join(<83152..83175,83312..83467,83565..83686,83769..83870,
                     83936..84319,84419..84844)
                     /locus_tag="CNI00350"
                     /product="expressed protein"
                     /transcript_id="XM_572766.1"
                     /db_xref="GI:58271219"
                     /db_xref="GeneID:3259568"
     CDS             join(83152..83175,83312..83467,83565..83686,83769..83870,
                     83936..84319,84419..84740)
                     /locus_tag="CNI00350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572766.1"
                     /db_xref="GI:58271220"
                     /db_xref="GeneID:3259568"
                     /translation="MEKYSNWRPFLPPVSPRSGSSLFVAFLAPLCVVHSLVRGVLLAV
                     LGTLHVLFVDWLCLLFVPIPPLYRAVNGCLTALTCRLALALMGYWWISTEMVSPRRGK
                     TGVSQISKRAPRRGDLILANWTSYVEVLYLAFRHNPTFLLPVYSNDIFQELPKTGRHT
                     GTGSAAINTPTAVVQPPFLGYLPYTLTSLLARTGLPPAQYDVPPNGVYKTLREARRKE
                     KRPVVLFPEGTTGNGRAILKFGEGILAEGDVGGDDEGIVWVKFFSATCPLPTPLKHLF
                     FSQLYTPTPYSRRSLHIRTLHPAASPSSPSFLPGEILNNQPGGLDAAGKDHKSVWREA
                     CAVVLAEVGKVRRVKGMGWAEKKAFLEYWARGGRR"
     gene            85649..>87422
                     /locus_tag="CNI00360"
                     /db_xref="GeneID:3259731"
     mRNA            join(85649..85732,85834..85926,86250..86725,86786..87277,
                     87341..>87422)
                     /locus_tag="CNI00360"
                     /product="oxidoreductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530959|gb|CF676800.1,gi|41530965|gb|CF676806.1"
                     /transcript_id="XM_572726.1"
                     /db_xref="GI:58271139"
                     /db_xref="GeneID:3259731"
     CDS             join(85679..85732,85834..85926,86250..86725,86786..87277,
                     87341..87422)
                     /locus_tag="CNI00360"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_572726.1"
                     /db_xref="GI:58271140"
                     /db_xref="GeneID:3259731"
                     /translation="MPTALRNVIVVGGSYVGSKAAQELAVVLPPTHRVLLVEPHSHFH
                     HLFAFPRFAVVPTHEHKAFIPFTSVFNDSAIPNPSIHAVVRAKVNAVYPTHVSLDRAW
                     QGETDISYDFLAIATGTRLPAPGSMQSEDKSNSVEYFKTYQEGVKEAKDIVIVGGGAV
                     GVQMACDIKEVSPEKNVTLVQSRDRVMPKFHPKLHEIISNRFKELGVNLVTNNRVTVP
                     AEGFPNDGSTFSVALKDGTSIPAQLVIPATGQIPNSQLLSTLPPSSTDSLVNPANGFI
                     RVRPTLQLQDTKYSNIFAVGDIADSGAHKAARPAMQHVKVLARNIVAMIDGKQPEEKI
                     EVEPAAIHMTLGLIQNIVFRNPNIATGDTEPFYKFRDDGKPDMGIEDVWARRGVVVND
                     PSEYFL"
     gene            <89783..91870
                     /locus_tag="CNI00370"
                     /db_xref="GeneID:3259516"
     mRNA            join(<89783..90067,90146..90361,90409..90527,90575..90756,
                     90803..91098,91150..91389,91441..91870)
                     /locus_tag="CNI00370"
                     /product="D-aminoacylase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41567847|gb|CF713688.1,gi|41567858|gb|CF713699.1"
                     /transcript_id="XM_572724.1"
                     /db_xref="GI:58271135"
                     /db_xref="GeneID:3259516"
     CDS             join(89783..90067,90146..90361,90409..90527,90575..90756,
                     90803..91098,91150..91389,91441..91776)
                     /locus_tag="CNI00370"
                     /codon_start=1
                     /product="D-aminoacylase"
                     /protein_id="XP_572724.1"
                     /db_xref="GI:58271136"
                     /db_xref="GeneID:3259516"
                     /translation="MSLVQSSSDILFISPTVISGEEYVQPFIADVLISGGRIARIAQP
                     GTLSDQLGAEVRKVEATGYVLCPGFIDLHAHSDLYLLTHPDHEAKISQGCTTEVVGQD
                     GISYAPVQTKAQMKAIREQITGWNGNPNEEDHPGVGLFEWNTVGEYLDCLERNKTATN
                     VAMLVPQGNLRLLACGPWDEVATADEITVQEKLLRQAMLEGAVGMSSGLTYTPGMYAS
                     TSELARLCRVLGEEFPGAFYAPHHRSYGFKALESYAEMLGLGRDTGCPIHLTHATLNF
                     SENKGKAPLLISMIDAARSDGCDISLDTYPYLPGCTTLAALLPSWASSGGPAETLKRL
                     RDEISREKIRRAVEDTGCDGGHGIPTNWDEIQIGSTTHPDLASYSGRRVSEVARSLKV
                     PSIKVFFDVLIKDKLATSCIMHIGNEENVREIMCHETHCSGSDAILHGKTLHPRAYGT
                     FPRFLGHYARDLGIMPLPAMVAHLTSRPAKRLGVYPSRGLIAEGSVADIVVFDPEAIR
                     DKATYEKPKQKAEGIRFVLVNGEVAVDETRLTGMRGGKVLRRREGGKVW"
     STS             89939..90747
                     /locus_tag="CNI00370"
                     /standard_name="Xho2"
                     /db_xref="UniSTS:470721"
     gene            92371..94077
                     /locus_tag="CNI00380"
                     /db_xref="GeneID:3259405"
     mRNA            join(92371..92694,92745..92878,92935..93128,93220..93317,
                     93371..93581,93639..94077)
                     /locus_tag="CNI00380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538677|gb|CF684518.1,gi|41538685|gb|CF684526.1,
                     gi|41566419|gb|CF712260.1,gi|41566425|gb|CF712266.1,
                     gi|41575872|gb|CF721713.1,gi|41575877|gb|CF721718.1"
                     /transcript_id="XM_572767.1"
                     /db_xref="GI:58271221"
                     /db_xref="GeneID:3259405"
     CDS             join(92499..92694,92745..92878,92935..93128,93220..93317,
                     93371..93581,93639..94065)
                     /locus_tag="CNI00380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572767.1"
                     /db_xref="GI:58271222"
                     /db_xref="GeneID:3259405"
                     /translation="MSTFTPLSLYSLPSKSALVDEFVGQPLSALRTPALIVDRKKFKD
                     NCERVASNAKERGMKFRAHVKTHKTTEGTRMQVEAAGGVKATIASTMVEVWQIVEAGL
                     VNEGLVNDILYSMPISADKLEDINSVQEIVGAQATIRLMVDHAEQIRILQSFSQKIQR
                     PARWSVFVKVDGGGKRAGAPAESEQMKELIQALVESQDYVEIFGFYSHFGQSYASDSL
                     SAGSSYFAGEINCVQTAAKIARNLGAKGKWTLSVGATPTAHAAVQEAVKEHGPLEGEL
                     ELHAGCYCMCDLQQCATSLVSYSDVAISVLGRVVSVYPLRKEAMCDVGALSVSKDTGR
                     FTGFGRVVKPDYATGWDLGRISQEHGTLVHRQGEDIKEGNELKIGNSVQIIPQHACLV
                     CACFPWLYVVDDGGNEVVDVWVPWKGW"
     gene            complement(<94327..96918)
                     /locus_tag="CNI00390"
                     /db_xref="GeneID:3259482"
     mRNA            complement(join(<94327..94611,94660..94817,94863..94912,
                     94965..95082,95136..95394,95523..96068,96115..96680,
                     96734..96761,96839..96918))
                     /locus_tag="CNI00390"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541985|gb|CF687826.1"
                     /transcript_id="XM_572722.1"
                     /db_xref="GI:58271131"
                     /db_xref="GeneID:3259482"
     CDS             complement(join(94327..94611,94660..94817,94863..94912,
                     94965..95082,95136..95394,95523..96068,96115..96680,
                     96734..96761,96839..96904))
                     /locus_tag="CNI00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572722.1"
                     /db_xref="GI:58271132"
                     /db_xref="GeneID:3259482"
                     /translation="MEPDMFGFKCAHPGCQKTFTRKDHLLRHAANHSQTSYNCPTCRR
                     EFKRYDLLQRHEKRNICGEDPTGSNPFKRSRSESGSQEESAVQRASLPPPINTTTGQQ
                     PGPSSSQTAIFPITSSSTAVPMNAPYDGSLQIPNSSNPPVSDFSVGDIMGDWGFSLWA
                     PEQWEALLHETLAPPFNEPMVDMPWDMPMLPRVQQQESAERGQDNVASAMLVARLQSS
                     FPEFDVPLSWVIEALQTYWTRTAPTFPFIHRGTFDLDTAPTELVLMMAIIGSVHMTPR
                     RDFSHLVQKIRGVLVQECGLDMPISTLQTFCLCHVHDTWYSTAESQFVAQCMWPVMVA
                     HSRKKGIGVVGKPENEIHQEEAWAAWAKEEGESETLKQNTDIQNDDALHTAFSSLIPN
                     FPPFGTNIALSNARSGYLPGLHPEFQVSTVSDGYSSAILAALALEKLSFKVDLENSLT
                     VQMVLIGLIAIAWDCRTRGGMGIRFREGTKHWRSIVFKAVINMRATYEAEVIRMGDAI
                     ESRDLRDTFAICNISILSDIPMLCVAAGATTFCGSTIGPRQYSDAKRRLKLWAKTEDA
                     WTCVWQCARYLRQALFADWGLYTPWAVFLTTLVCRAYNWTSATPESTSQRRQHPTTYS
                     TAHLPIIDRQATIIAWLDKILQTPGRHESTDGEVDALIEYVAGQLELGESTARENAAM
                     LRMLIGHKR"
     gene            complement(98167..100329)
                     /locus_tag="CNI00400"
                     /db_xref="GeneID:3259747"
     mRNA            complement(join(98167..98309,98363..99799,99860..100001,
                     100073..100329))
                     /locus_tag="CNI00400"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534397|gb|CF680238.1,gi|41534409|gb|CF680250.1,
                     gi|41547355|gb|CF693196.1,gi|41547360|gb|CF693201.1"
                     /transcript_id="XM_572950.1"
                     /db_xref="GI:58271587"
                     /db_xref="GeneID:3259747"
     CDS             complement(join(98420..99799,99860..100001,
                     100073..100224))
                     /locus_tag="CNI00400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572950.1"
                     /db_xref="GI:58271588"
                     /db_xref="GeneID:3259747"
                     /translation="MALELLYHSSSPSLYPTNTSSSLLVIRFSGPVRVSSVRITPEGV
                     RCPDGSGVTYPSNWTGQLLFNVSPSNPVNALLSTNITYNAALHPVDYPIDMPQGTTSR
                     MMMLRAPVEKLSISVYGNTDESPGDDPEQENAVKEQRPSELALEKEDPSWLWRWAGDS
                     PDCLIDLLNAYTRPEVISRTLECLDLLSDLDDSIIPSLLERPNALEYLFRIPTSTFSS
                     KIKNNYKWAFHPSVEPLLATDHPFVPLLGPDTSARHAAAWQRLSLGKAALACLIDLGA
                     SVREDDLMRVEKGEEKSNLARLLEMGEKFAQGEDGEGLDMVLDLLDSAELEIVDSIIA
                     QEYLARTIPRLSVIAIALSKNGNRRGNGAIRSLKIGEEHARLVVNALLLCSTEIINGK
                     LTFSIARKLAEPYLPRLESSDPLRIVFTTSHPSPTADALSDPDPTARALARLSHAISS
                     SSSSLALDTSIVPSFSPPLSSSSITHILPPSTILTFLAPHFTSILSTAISPPFGIQPS
                     ATYTSPEMQGANVWAGKVYTSHEFRSRELVGLGIGPGGRAASKHVDEYA"
     misc_feature    100400..100427
                     /note="AT_rich"
     gene            complement(100489..102438)
                     /locus_tag="CNI00410"
                     /db_xref="GeneID:3259649"
     mRNA            complement(join(100489..100722,100798..100968,
                     101027..101402,101480..101639,101700..101771,
                     101821..101920,101983..101990,102085..102280,
                     102342..102438))
                     /locus_tag="CNI00410"
                     /product="MAP kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531316|gb|CF677157.1,gi|41543177|gb|CF689018.1,
                     gi|41543190|gb|CF689031.1,gi|41545587|gb|CF691428.1,
                     gi|41555624|gb|CF701465.1,gi|41555629|gb|CF701470.1,
                     gi|41558233|gb|CF704074.1,gi|41558247|gb|CF704088.1,
                     gi|41560080|gb|CF705921.1,gi|41564242|gb|CF710083.1,
                     gi|41564254|gb|CF710095.1,gi|41566854|gb|CF712695.1,
                     gi|41566858|gb|CF712699.1"
                     /transcript_id="XM_572813.1"
                     /db_xref="GI:58271313"
                     /db_xref="GeneID:3259649"
     CDS             complement(join(100572..100722,100798..100968,
                     101027..101402,101480..101639,101700..101771,
                     101821..101920,101983..101990,102085..102280,
                     102342..102388))
                     /locus_tag="CNI00410"
                     /codon_start=1
                     /product="MAP kinase"
                     /protein_id="XP_572813.1"
                     /db_xref="GI:58271314"
                     /db_xref="GeneID:3259649"
                     /translation="MDNTPRHLFQTPNNVYILQQPWQFVKELGQGAYGCVSSARNSST
                     GETCAVKKVTNVFQKKILTKRCLRELRLLHHFRGHKNITCLYDMDIVFDPPGSGQFRE
                     VYLYEELMEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLV
                     NADCELKICDFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSID
                     MWSVGCILAELLGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLP
                     IKPRVKFETLYPNASPLALDLLSKLLTFDPAKRYGCEEALEHQYLAVWHDPADEPLCE
                     VPFDFSFEEEDSVSGMRDLILEEVRSFRYLVRQQSMPPARKDSHELPPAPPAPQHPGA
                     GVGPAFHERANSEGDMEEHPGSALEKQLERQKLS"
     gene            102727..106830
                     /locus_tag="CNI00420"
                     /db_xref="GeneID:3259518"
     mRNA            join(102727..103012,103061..103602,103825..106020,
                     106070..106295,106349..106657,106712..106830)
                     /locus_tag="CNI00420"
                     /product="DNA-directed RNA polymerase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41561586|gb|CF707427.1,gi|41562408|gb|CF708249.1,
                     gi|41575397|gb|CF721238.1,gi|41575405|gb|CF721246.1"
                     /transcript_id="XM_572718.1"
                     /db_xref="GI:58271123"
                     /db_xref="GeneID:3259518"
     CDS             join(102947..103012,103061..103602,103825..106020,
                     106070..106295,106349..106657,106712..106762)
                     /locus_tag="CNI00420"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase"
                     /protein_id="XP_572718.1"
                     /db_xref="GI:58271124"
                     /db_xref="GeneID:3259518"
                     /translation="MKQQYGDKKGADWYSKGVKTVEDKWQLLPAFLKVKGLVKQHLDS
                     FNYFVNVDIKAILAANSLVISDINPKYYIRYTDIRVGRPARHDANQVASALSPMECRL
                     TDSTYSAPIYVDVEYMGEEKRSKQRGVQIGMLPVMLRSDLCNLKGKNEAELARMGECP
                     MDPGGYFVVKGTEKVILVQEQLSKNRILVMKDKKDEVMAEVTSSTHDRVVKTYVVSKA
                     NRLYLRHNSFKEFIPIVIALKAMGLTADKEILQLICGSDERYQEAFGVSLEEAAKEKT
                     FTRRQALEWIGARVSPNQAKDDSGSNQKLTPSDIAQQALAAMVLGHVPVRNMNFRPKC
                     IYLATMARRVLMAMIDDHMVDDRDYVGNKRLELAGQLLSLLFEDSFKTFNSELKKRMD
                     KILEKPNRAGPFDAGTLIRQGGDPITQAFVRSISTGNWSLKRFHVERAGVTHVLSRLS
                     FIAALGMMTRISSQFEKTRKVSGPRALQPSQWGMLCPSDTPEGEACGLVKNLALMTHI
                     TTDVPETPLVKMAFMLGVEDISLVTGNELYRPGVHMVQVNGTLIGVTNMAKRFVRQFR
                     KLRRAGRMSEFVSIFINHHHKIIYIASDGGRICRPMIIVEKGRSRVTTEHVRLLKEGK
                     VTFDHFLRAGLVEYLDVNEENDSFIACYENEIEEGTTHLEIEPFTILGAVAGLIPYPH
                     HNQSPRNTYQCAMGKQAIGAIAYNQLNRIDTLLYLMTYPQQPMVKTKTIELIGYNKLP
                     AGQNATVAVMSYSGYDIEDALILNRASVDRGFGRCHVLKKVTTPMRTFHNGSHERTAY
                     PDPPPRPDAYTFVDKADGMTAPGATINQYDVMIHRETPVDTRGGGADTQLYKPMPVTH
                     KTPEPILVDKVMLTEGEDGALIKILTRQTRRPELGDKFSSRHGQKGVCGLIVPQADMP
                     FNDQGIVPDIIMNPHGFPSRMTVGKMIELLSGKAGVVAGKLQYGTAFGGSKVVDMSQI
                     LIDNGFSYGGKDMLTSGITGQPMEAYVYFGPIYYQKLKHMVMDKMHARPTGPRANLTR
                     QPTEGRSKDGGLRLGEMERDCLIGYGATQLLLERLMISSDAFETQVCESCGMLGYNNW
                     CPKCKSGKGVVGLTIPYAAKLLIQELMGMNIMPKLCLEDTV"
     misc_feature    106971..107061
                     /note="CT-rich"
     gene            complement(<106980..>108018)
                     /locus_tag="CNI00430"
                     /db_xref="GeneID:3259599"
     mRNA            complement(join(<106980..107813,107863..>108018))
                     /locus_tag="CNI00430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572716.1"
                     /db_xref="GI:58271119"
                     /db_xref="GeneID:3259599"
     CDS             complement(join(106980..107813,107863..108018))
                     /locus_tag="CNI00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572716.1"
                     /db_xref="GI:58271120"
                     /db_xref="GeneID:3259599"
                     /translation="MASASGYNHHRFARAVLKKSRKWEPSLTVQLFSNHWRFENSPLN
                     FQYDGPMKPFLLAIRSQVIPASLIPFLYDIQPPISFVDGCLVVELQDYRRSPESRSRV
                     VMRPAAETLAQTIDVMLERKGHGWDEQLAMELESRIITATSPPLYLGTSIMATRNATL
                     ALALTSPAHPNLSADGALRQPMAMESDAQSSLEKMRKLIAAGSRAGAGAAPFQPDWLV
                     LRAKEQYEAVRLHRERGGFLPQGSQGPAPSTAGGDDAPRPPATDDKKKKGKKRSNEEE
                     EEKPKPKKKKKQPAASSATAAGDAADGEKKKPAVKKEKGAASEKKKKVEKKKD"
     misc_feature    107109..107180
                     /note="CT-rich"
     gene            complement(108166..108254)
                     /locus_tag="CNI00440"
                     /db_xref="GeneID:3259726"
     tRNA            complement(108166..108254)
                     /locus_tag="CNI00440"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:3259726"
     gene            complement(<108569..109582)
                     /locus_tag="CNI00450"
                     /db_xref="GeneID:3259782"
     mRNA            complement(join(<108569..108581,108688..109109,
                     109209..109582))
                     /locus_tag="CNI00450"
                     /product="expressed protein"
                     /transcript_id="XM_572789.1"
                     /db_xref="GI:58271265"
                     /db_xref="GeneID:3259782"
     CDS             complement(join(108569..108581,108688..109109,
                     109209..109553))
                     /locus_tag="CNI00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572789.1"
                     /db_xref="GI:58271266"
                     /db_xref="GeneID:3259782"
                     /translation="MLPTHSPLSPVSTYPPSFPQLISPRTSQSLPSSQPPHRPPALPQ
                     NLSQRSWRRKRKRFTLTTFQSFLYHSSFWLCIVIEMALLVGAAWGLGEQAWHTGPQQG
                     WNVVVLSAAYAVFIMKTMPKPYIPIKPDDLPEKVSRHITTEYSRTAVISHISQATQGE
                     QDGWGRPNTKWEARWLRGYILGTVGVMKEALGAKDGPPLSLEPFYEAADRVNDSGGVR
                     LLVNSWAKYVEKARYGKKEPNEREAGAVERLVEIVVLTTGV"
     gene            <109752..111552
                     /locus_tag="CNI00460"
                     /db_xref="GeneID:3259663"
     mRNA            join(<109752..109775,109831..109887,109936..109980,
                     110028..110037,110095..110593,110641..110871,
                     110920..111139,111206..111422,111495..111552)
                     /locus_tag="CNI00460"
                     /product="ATPase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533415|gb|CF679256.1,gi|41533419|gb|CF679260.1,
                     gi|41537520|gb|CF683361.1,gi|41537525|gb|CF683366.1,
                     gi|41540473|gb|CF686314.1,gi|41547930|gb|CF693771.1,
                     gi|41547936|gb|CF693777.1,gi|41560028|gb|CF705869.1,
                     gi|41560037|gb|CF705878.1,gi|41562828|gb|CF708669.1,
                     gi|41562834|gb|CF708675.1,gi|41576027|gb|CF721868.1,
                     gi|41576039|gb|CF721880.1"
                     /transcript_id="XM_572783.1"
                     /db_xref="GI:58271253"
                     /db_xref="GeneID:3259663"
     CDS             join(109752..109775,109831..109887,109936..109980,
                     110028..110037,110095..110593,110641..110871,
                     110920..111139,111206..111422,111495..111511)
                     /locus_tag="CNI00460"
                     /codon_start=1
                     /product="ATPase"
                     /protein_id="XP_572783.1"
                     /db_xref="GI:58271254"
                     /db_xref="GeneID:3259663"
                     /translation="MSNSNFLDKAIALVQKAIDEDVKQNYAEAYKQYQDALDYFMMAM
                     KYEKNDKLKELIRKKFTEYLDRAEKLKEHIAKSEEKRSKAKVSATGAAGGSTAGGPDV
                     KGDDGDDPEIKKMRQGLQGAILSESPNVKWEDVAGLAQAKESLKEAVILPIKFPQLFT
                     GKRTPWRGILLYGPPGTGKSYLAKAVATEAKSTFFSVSSSDLVSKWMGESERLVKQLF
                     QMAREQKPAIIFIDEIDSLTGARGEGESEASRRIKTEFLVQMNGVGNEETGVLVLGAT
                     NIPWQLDPAIKRRFEKRIYIPLPDIQARRRMFEINVGSTPHGLTPADFTHLAEQTEGY
                     SGSDIAVIVRDALMQPVRKVLSATHFKEVEVDTPEGPQIKLTPCSPGATNAIEKTWTD
                     IESSELLEPLLGLKDFEKAIAVNRPTVSAKDIEKHIRFTDESGGEGA"
     gene            <111862..>113122
                     /locus_tag="CNI00470"
                     /db_xref="GeneID:3259803"
     mRNA            join(<111862..112243,112298..112609,112745..112875,
                     112940..>113122)
                     /locus_tag="CNI00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_572782.1"
                     /db_xref="GI:58271251"
                     /db_xref="GeneID:3259803"
     CDS             join(111862..112243,112298..112609,112745..112875,
                     112940..113122)
                     /locus_tag="CNI00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572782.1"
                     /db_xref="GI:58271252"
                     /db_xref="GeneID:3259803"
                     /translation="MSDYLRVPYAVNPSHKFGYFDRNPEVPIPLTSPIPPTPPGPPIP
                     PFAREPLSPPWPTTRSELRRGNQEVTAKLQEQIEVEIERERERKRLMSDYVVVHNDFD
                     SSPIAPAELFNLSLLEPSTRFNFFPTDDDEERSRATLMNRMSTQGSPSSIASSSTSSL
                     TETANLMANVSLFGQANSSKTAQDLSPFPESARGSIDPSSRAIDVKVNRKPVDYHLVS
                     NVPKPFRGNASEDQKMFWRTSELEGRIRNCAYVGEGWELRPVMSRLNGKTVPEGCDVD
                     EYIRTKQDIDMLSLEELSAWLELYGIEGFEQEGDRRPDRRRLWAFLVYGTFTDECHFR
                     H"
     gene            complement(113697..114905)
                     /locus_tag="CNI00480"
                     /db_xref="GeneID:3259787"
     mRNA            complement(join(113697..114105,114168..114299,
                     114353..114506,114560..114905))
                     /locus_tag="CNI00480"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41570929|gb|CF716770.1,gi|41570936|gb|CF716777.1"
                     /transcript_id="XM_572781.1"
                     /db_xref="GI:58271249"
                     /db_xref="GeneID:3259787"
     CDS             complement(join(113731..114105,114168..114299,
                     114353..114506,114560..114657))
                     /locus_tag="CNI00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572781.1"
                     /db_xref="GI:58271250"
                     /db_xref="GeneID:3259787"
                     /translation="MAKYTLYQLIGKAEHPDGRVISPHVWKTKLDLAYFDQEVKAEGK
                     TFPQIRGELVETTKNSAVTVPTIVDDEGLVITDSWKIAEYLEAEHGSAEKSVFGGQVG
                     KEFAKFVEIWSNTTLANEFRPLIAPAIFEHFDEPSKNYFIKSKFGDDLSRFEAHKSKF
                     SDPSNLNAQLAAARTRLNVIETLLGYKKEKGEPLWLSGKPSHADFCLFGWYAASRINP
                     AVERGVWRHEENPLVGEWLDLILGSGLVDQTQLN"
     gene            <116202..117580
                     /locus_tag="CNI00490"
                     /db_xref="GeneID:3259638"
     mRNA            join(<116202..116529,116581..116748,116802..117335,
                     117398..117580)
                     /locus_tag="CNI00490"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554404|gb|CF700245.1,gi|41575083|gb|CF720924.1"
                     /transcript_id="XM_572791.1"
                     /db_xref="GI:58271269"
                     /db_xref="GeneID:3259638"
     CDS             join(116202..116529,116581..116748,116802..117335,
                     117398..117468)
                     /locus_tag="CNI00490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572791.1"
                     /db_xref="GI:58271270"
                     /db_xref="GeneID:3259638"
                     /translation="MFSSTTPLFVAAMALALPATAGTIFTKSNAAMTLYAFSSTVNSL
                     FTADQKPSSYYDVSEGTSSSEACGSSADDPVQSGWATSSGINGGIPYCERSRGYSLKE
                     IDTNNIVAFNSALVAANPAKWCGREVKIYNADGGEFAYSGGSLYIWDGCDACSSSDSG
                     ILDLSAPTFVELKGGTCAGNNPTGLTYEVLDNYIVNPSVGLGSGYSEEVGSDDMGVGS
                     TTAAASGSAVAVTSASRPVVTSAQSEVVISAQQTATATAILSLQYSYSSVVQGTDISP
                     FSTDEIALVAVETDANSAGSSALDAVETSAAATSTGTACGDSTCAFGAWQCSGLELQI
                     CNYLTIDSLGWETIETCGATCLITNSGSVDCE"
     gene            <118047..>119533
                     /locus_tag="CNI00500"
                     /db_xref="GeneID:3259449"
     mRNA            join(<118047..118150,118217..118241,118319..118436,
                     118513..118671,118723..119406,119466..>119533)
                     /locus_tag="CNI00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_572780.1"
                     /db_xref="GI:58271247"
                     /db_xref="GeneID:3259449"
     CDS             join(118047..118150,118217..118241,118319..118436,
                     118513..118671,118723..119406,119466..119533)
                     /locus_tag="CNI00500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572780.1"
                     /db_xref="GI:58271248"
                     /db_xref="GeneID:3259449"
                     /translation="MPTLFTVLTILNSLLALGVEAYEVLYELQGATGTVYYDYGWENT
                     GDQCAARFGAGWASDQTAYPGCEQNGPTQTDLKTNRIVAMNQSWMEGDKSAWCGKEVK
                     VFKEDGTELVYDEPLVLWDTCAECAIHVKIDFGVGPYVLLDSEDCGTTAMNPTGLTVQ
                     VVDNQIWAPAPGSDSYSPTSASTLYTGGLYNFPSSGTLSKPWGATISGDAAGDPVVIA
                     TADSQGVAPTGGDIEDVSVTATATGLAKSATGAATSAGMSSAKITSQPEATSDLSTSS
                     TPITSAWFASDEVSVTAIITSAAAAVLSVTSAALDQTSDVVALQSVSSTETITCTDNE
                     GTGYNAGDHICEGNQLMICANTQSGSSAVNWVVQNTCLSRCLVCDTTIVCN"
     gene            119969..120057
                     /locus_tag="CNI00510"
                     /db_xref="GeneID:3259771"
     tRNA            119969..120057
                     /locus_tag="CNI00510"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:3259771"
     misc_feature    120057..120079
                     /note="AT_rich"
     gene            121340..123801
                     /locus_tag="CNI00520"
                     /db_xref="GeneID:3259662"
     mRNA            join(121340..121486,121765..122289,122339..122523,
                     122574..122913,122963..123042,123090..123243,
                     123296..123408,123473..123801)
                     /locus_tag="CNI00520"
                     /product="G-protein alpha-subunit"
                     /note="supported by cDNAs and ESTs:
                     gi|41530135|gb|CF675976.1,gi|41530143|gb|CF675984.1,
                     gi|41532640|gb|CF678481.1,gi|41532653|gb|CF678494.1,
                     gi|41537064|gb|CF682905.1,gi|41537070|gb|CF682911.1,
                     gi|41538933|gb|CF684774.1,gi|41538944|gb|CF684785.1,
                     gi|41543379|gb|CF689220.1,gi|41544144|gb|CF689985.1,
                     gi|41544153|gb|CF689994.1,gi|41548540|gb|CF694381.1,
                     gi|41548545|gb|CF694386.1,gi|41556404|gb|CF702245.1,
                     gi|41566356|gb|CF712197.1,gi|41566369|gb|CF712210.1"
                     /transcript_id="XM_572793.1"
                     /db_xref="GI:58271273"
                     /db_xref="GeneID:3259662"
     CDS             join(121935..122289,122339..122523,122574..122913,
                     122963..123042,123090..123243,123296..123408,
                     123473..123544)
                     /locus_tag="CNI00520"
                     /codon_start=1
                     /product="G-protein alpha-subunit"
                     /protein_id="XP_572793.1"
                     /db_xref="GI:58271274"
                     /db_xref="GeneID:3259662"
                     /translation="MGGCMSTPEAPKKTAETKQVPSTSTSSRPPQASTSATATAAGAG
                     TSAANGTANGIKGDTTATNRVGTSGGQGLAAALASTEPPGAQDSKGNKDRSNQIDRQL
                     EDDQKKFRKECKILLLGSGESGKSTIVKQMKIIHQNGYSKDELLSFRGVIYKNVLDSA
                     QALIMAMRKIGVDPEDANNRSYADRILEYRMDAGLDAVIPSEILYNIESLWHDPVIPS
                     VMDRSSEFYLMDSATYFFANIRKIAGPDYVPDEADVLRARTKTTGISETRFNMGQLSI
                     HMFDVGGQRSERKKWIHCFEAVTSIIFCVALSEYDQVLLEESGQNRMQESLVLFESVI
                     NSRWFLRTSVILFLNKIDLFKQKLPKVPLVQYFPEYTGGADINKAAKYILWRFTQTNR
                     ARLSVYPHLTQATDTSNIRLVFAAVKETILQNALRDSGIL"
     gene            124671..126967
                     /locus_tag="CNI00530"
                     /db_xref="GeneID:3259458"
     mRNA            join(124671..125513,125570..125744,126016..126967)
                     /locus_tag="CNI00530"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547456|gb|CF693297.1,gi|41547471|gb|CF693312.1,
                     gi|41553741|gb|CF699582.1,gi|41573450|gb|CF719291.1,
                     gi|41573454|gb|CF719295.1"
                     /transcript_id="XM_572779.1"
                     /db_xref="GI:58271245"
                     /db_xref="GeneID:3259458"
     CDS             join(125157..125513,125570..125744,126016..126731)
                     /locus_tag="CNI00530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572779.1"
                     /db_xref="GI:58271246"
                     /db_xref="GeneID:3259458"
                     /translation="MTIRRLLTSLAAHQPSGSQSASRLIPPYSHVYSATAPSTLRPPY
                     SYSASPAQGLPLGAHEVRGRSLKAKVKYEIYHREGKVDGWSAWAENVLGNEEQRREVE
                     AAWVDILAGLESIKSSGNQIPQIAFHSLAGHLASESTVDAIRNVGAVVIRDVVPDAEA
                     IGWAREILQAINDAGERGIYWNPALIAARANTSVLSANAQLARSLLGQEVYIQAETVR
                     EGIAPFRTTPSPYNPWSCPRALLAHLTLTPTMSSPTGAAPQPTRLPPSVHAATYTLLR
                     PLFRPLKSKIAFYDSSSYLDPANWVLDPTISHRPSPAPDFPHLAGTEVVLPELLPGDV
                     LFHHTALPFSTQPVGQIFLPINPVEKKGNEAWIARQREAFEKGVPPPGASEVGDDLCV
                     VESKGKRSDISSRAGREAMGYGY"
     gene            complement(127491..127579)
                     /locus_tag="CNI00540"
                     /db_xref="GeneID:3259772"
     tRNA            complement(127491..127579)
                     /locus_tag="CNI00540"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:3259772"
     gene            128881..132628
                     /locus_tag="CNI00550"
                     /db_xref="GeneID:3259631"
     mRNA            join(128881..129225,129283..129495,129544..129720,
                     129772..129857,129918..129935,129976..130056,
                     130110..130188,130234..130290,130342..130390,
                     130509..131246,131303..131572,131623..131925,
                     131977..132169,132241..132628)
                     /locus_tag="CNI00550"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533979|gb|CF679820.1,gi|41533989|gb|CF679830.1,
                     gi|41556955|gb|CF702796.1,gi|41557465|gb|CF703306.1,
                     gi|41567148|gb|CF712989.1,gi|41567162|gb|CF713003.1"
                     /transcript_id="XM_572778.1"
                     /db_xref="GI:58271243"
                     /db_xref="GeneID:3259631"
     CDS             join(128951..129225,129283..129495,129544..129720,
                     129772..129857,129918..129935,129976..130056,
                     130110..130188,130234..130290,130342..130390,
                     130509..131246,131303..131572,131623..131925,
                     131977..132169,132241..132398)
                     /locus_tag="CNI00550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572778.1"
                     /db_xref="GI:58271244"
                     /db_xref="GeneID:3259631"
                     /translation="MPSKRTSSGVSSPTAKSSSTRKSKSTPKKTLPRPITSPPPPPHH
                     HVPAPAPMHLPVHKAGRLSWSLLGFILVVLPFWFSRLHYGLPEPLPPYDADGRPQPSE
                     EIVLSHVQALENIGYRTVGTHEALAGEQYVLNQVLELVEKCNAGGILNCEWWHQKGSG
                     FHAFEIIDHEVLKGYGGISNIILRIAAFHPPSYNISQPKVEKDAILLGSHIDSTMPSP
                     GASDDGIGVGVMLDTARILVERNEAFDGAIIFMWNGGEETLQDGSHLYSTEHSTAPTV
                     KAMINLEAAGSTGGALLFQATSKEMIEAYVHAPFPRGTVIAADVFASGILMSDTDFGQ
                     FEKYLGVSGLDLTTPRDTIKHLEKGTAQHFTSNIQAIVDHLLSPSSPLLSPAPFSPPH
                     VVYFSLFDRVFFHFPMSRADGWYVSIAAVATAFAFRHLSNKKAKAIVVAAVGTPLGIL
                     GGLVGANAFAAVLSATDNGLLWFPHEHLPLLLYVPVSYISLFSIHLMLTHFLSPVERT
                     QLEVTHYYIQLLLSSWYMLLLQSFRVRSAYLYAMITALLLVGAVGNELGRMGRRGLWE
                     GMSFKMTYLVPSACLMALAVEAVTTALDIFTPLAGRMGKEAPAEHIVASLSVICGFVF
                     FPTVLPLFHRVSRMTQRKVVLGLVLSVLGTVVAMVGPWYFPYDEMHPKRVGVIYNYNH
                     TSDKHVAHLAFMDRGPVADIVPSLYSRYGTPDLPLEHTSLTDYDSDWDVLYPVSTFLD
                     TYRFDLPVSEETKKFTWPEMKWGVKDTKWENGVRKMVLTFNFTGLVWPTLAFEASVLD
                     WSFHFDPPPKKMQHHIKIATSVDEPVVNLRLDIRADEGERLRIHWSAFDINQMVPGTA
                     ARDGPDMPASKMLLDLASWSREKYNDDLDLVMSGVVCGVIEV"
     misc_feature    130595..130670
                     /locus_tag="CNI00550"
                     /note="CT-rich"
     STS             132939..133091
                     /standard_name="CCG5"
                     /db_xref="UniSTS:470718"
     misc_feature    132995..133016
                     /note="AT_rich"
     gene            133133..135581
                     /locus_tag="CNI00560"
                     /db_xref="GeneID:3259660"
     mRNA            join(133133..133303,133356..133526,133572..135581)
                     /locus_tag="CNI00560"
                     /product="anthranilate synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537310|gb|CF683151.1,gi|41537316|gb|CF683157.1,
                     gi|41546388|gb|CF692229.1,gi|41546395|gb|CF692236.1,
                     gi|41548408|gb|CF694249.1,gi|41549479|gb|CF695320.1,
                     gi|41549482|gb|CF695323.1,gi|41556395|gb|CF702236.1,
                     gi|41556401|gb|CF702242.1,gi|41561742|gb|CF707583.1,
                     gi|41561745|gb|CF707586.1"
                     /transcript_id="XM_572795.1"
                     /db_xref="GI:58271277"
                     /db_xref="GeneID:3259660"
     CDS             join(133178..133303,133356..133526,133572..135533)
                     /locus_tag="CNI00560"
                     /codon_start=1
                     /product="anthranilate synthase"
                     /protein_id="XP_572795.1"
                     /db_xref="GI:58271278"
                     /db_xref="GeneID:3259660"
                     /translation="MGFTLLIDNYDSFTWNIYADLASVGGNPYVVRNDKITLKEIEGM
                     FSDGELERIVISPGPGHPRTDSGVSRDVIAWGMGKLPILGVCMGLECIVDLLGGEIAY
                     AGEIKHGKTSLVQHDSIGVFHNLPQFLSSTRYHSLSAQIQSLPSVLQVTSTTKESGVI
                     MGVRHRTYTVEAVQYHPESCMSEGGRGLMANFIQMKGGKWGGENAWCGVPAEGEEEQP
                     KAKTNGAPSLPTILNRIHAQRLLDVEQAEKVPATSPANVSTSLSLYASPPLINFRDRM
                     VSTPHTAVMAEIKRASPSKGDIAPTASAPEQALKYALAGASVISVLTEPTWFKGSLLD
                     MLAVRNAVDSLPNRPAILRKDFVLSKYMIDEARLYGADTVLLIVAMLEPQQLKELYDY
                     SVSLGMEPLVEVNNPTELSLALEIGSKVIGVNNRNLHDFNVDMSTTSRVNAALNGRDV
                     VLCALSGISSHEDVEKYVKEGVKGVLVGEALMRASDTKAFLRSLIGLPPLEVVPKSRP
                     LVKICGIRSTDDAKLAISAGADLLGVILVPGTKRCISTSTAREISALVQSARSQSSSK
                     PLEPSLSSPWFTTQSDLLSSRRKPLLVGVFQNQSLSDILSAVEEIGLDLVQLHGDEPQ
                     AWAKFIPVPVVKVFRVSPEGIVRGGEFRRPGLNQAILLDAGGVSGGGGEGKAFPWEHA
                     KRLIQSGEVGSEGHMPLPVILAGGLTPENVGQAIEQAGEGVWCVDVSSGVEGEGGKVK
                     EKVEAFVKAVRG"
     gene            complement(135625..>137954)
                     /locus_tag="CNI00570"
                     /db_xref="GeneID:3259672"
     mRNA            complement(join(135625..136624,136677..137712,
                     137773..137830,137870..>137954))
                     /locus_tag="CNI00570"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533099|gb|CF678940.1,gi|41533112|gb|CF678953.1"
                     /transcript_id="XM_572777.1"
                     /db_xref="GI:58271241"
                     /db_xref="GeneID:3259672"
     CDS             complement(join(135644..136624,136677..137712,
                     137773..137830,137870..137954))
                     /locus_tag="CNI00570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572777.1"
                     /db_xref="GI:58271242"
                     /db_xref="GeneID:3259672"
                     /translation="MDRRKDPSRIFYPHGWRELVNGSLEEGFAPIALATIDNLTTEYY
                     VPQNEHLQFLLYLAINPYDHGLSSYEPFTVLYRLLKLHNPRLFAGSIPSHPSASYYRA
                     PPLPSITSDGGSSGGRGRKSLNHQDTSEHPQDDAPSWLTWEKGRSFLHRNVYKYMKRC
                     KDQGVWPLLWTDPAKENRVAGRVRRARKAKDGMGNIKVKEEHKEARRSQSPSKHDDHD
                     EDRPPENVIDAELDIDLDLEQELEHDNEREKPPTPQGWLLLEWLVAVWEKDEMVRRGP
                     YDNPQLEWSPLFLRQLARPYDRTGQLQWSDAGMVMGILKAAFAEPFPDDDEDEDEDED
                     ENENEGEEEEEDEDMIDIEEDEETRVAKEEVKIAKTLRREEGKEMLARRRSTAVRLFR
                     LLLDTAIAPFPPPPSSNLPSRPPSSSPGPEIGPSTSSFPSSPGIGTGTSTRAPTPPTS
                     MSYPPSPSRSAPSVHPPFNPPSLTSSLIHTLAPLPLSSLQSFFMLLIPSPFPSSSPSF
                     SFSHGTDINMSHAAVDTPTTTILPPVPLAPITHIITLLLEHFAGTSRRKGEERRERRR
                     RRLPEPDFEPGYNGLGKPTVEYLCREVLALNPPLQAPAPKGRNGRTKRGKTVQVKVEK
                     GTEKEGQDEKVGMKMAHLKLVLLQTLLRQERNGEKPYSSEQVELETLRSEKGWRRDVE
                     TSFVVSETRSDEDPEGSTALLRVGRMVLLSVDRLVGI"
     misc_feature    136270..136441
                     /note="G-rich"
     repeat_region   136807..136887
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            <138174..>139265
                     /locus_tag="CNI00580"
                     /db_xref="GeneID:3259604"
     mRNA            join(<138174..138297,138345..138873,138934..139031,
                     139150..>139265)
                     /locus_tag="CNI00580"
                     /product="clathrin light chain, putative"
                     /transcript_id="XM_572797.1"
                     /db_xref="GI:58271281"
                     /db_xref="GeneID:3259604"
     CDS             join(138174..138297,138345..138873,138934..139031,
                     139150..139265)
                     /locus_tag="CNI00580"
                     /codon_start=1
                     /product="clathrin light chain"
                     /protein_id="XP_572797.1"
                     /db_xref="GI:58271282"
                     /db_xref="GeneID:3259604"
                     /translation="MSDDPMADFLAREKAALGDDADFFANPTPSAASGIDAFPDLTSP
                     AVEPESTPVKPPTPQYQGIDAFPDIDTPAVDGTQIKVTGPAGTGEDEDVMKFESAFPD
                     LSGETGSQPASKPIFNALSPQPYGASPYPPTATTAVSRSPHPSILPAPTFNNILPTAD
                     EDTEPIKAWKARQAEEIQKRDEADKKRRDEMSDRAEKAIDQFYEEYNKMKEKNIRENK
                     ESEAEFLEKLQEGVAKGTAWERISDLISLENSQSKTIRPSVPGGSDLARMKEILLALR
                     REGDKAPGAAGF"
     gene            139526..139615
                     /locus_tag="CNI00590"
                     /db_xref="GeneID:3259779"
     tRNA            139526..139615
                     /locus_tag="CNI00590"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:3259779"
     gene            140151..143890
                     /locus_tag="CNI00600"
                     /db_xref="GeneID:3259733"
     mRNA            join(140151..140625,140678..140700,140779..140844,
                     140907..140987,141085..141255,141334..141565,
                     141675..141911,141998..142588,142705..142817,
                     142904..143112,143179..143295,143357..143890)
                     /locus_tag="CNI00600"
                     /product="alpha-1,2-mannosidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530597|gb|CF676438.1,gi|41531071|gb|CF676912.1,
                     gi|41531090|gb|CF676931.1,gi|41548695|gb|CF694536.1,
                     gi|41548704|gb|CF694545.1,gi|41572893|gb|CF718734.1,
                     gi|41572900|gb|CF718741.1"
                     /transcript_id="XM_572799.1"
                     /db_xref="GI:58271285"
                     /db_xref="GeneID:3259733"
     CDS             join(140168..140625,140678..140700,140779..140844,
                     140907..140987,141085..141255,141334..141565,
                     141675..141911,141998..142588,142705..142817,
                     142904..143112,143179..143295,143357..143797)
                     /locus_tag="CNI00600"
                     /codon_start=1
                     /product="alpha-1,2-mannosidase"
                     /protein_id="XP_572799.1"
                     /db_xref="GI:58271286"
                     /db_xref="GeneID:3259733"
                     /translation="MDGLRQRDRPILAQPIPHPPRQNPNPPAPAPQRTIRNVHRFVQR
                     YINPLRPLIFAFVLAVFSLILAVSIFFSPLAFVHRHLSLQDPTNIQDVQNGWVVKYRL
                     GEEESERHLRDGEVIGHADFGDGRKRVCKEEFVQPESQALGWVNVMLGNGGPEPNLSG
                     GMIPAVAPPFGMTRWSPQTRKNYVSMCPYNQTDTKLHGFIATHQPAIWMGESGPVEIS
                     PGLGTAIVTDFDKRGLPFKGEDEYASANYYRNLLDAGDNGEIEVEMSATSRVGHLRFT
                     FNPSLSPPSYSNPSGPTAIPYITLQSSRATYLVHGDKPEARVPYFPKGFVEIDVEKQE
                     VRGWNDERQDHILLGAALPASNFKAYYVARFSKPFKTFGISHHGHIERGVGETRGEGE
                     VLAGWVSFEEEAVTVDVKVGVSFISVEQAGRNIDLEIPRTQSLSTTSYQTRSSWAEKL
                     DRLSVSGATPQNLTVLYTSVAHTLVYPYEIHEFVPVDQDAEGECEGEGRGKGEWQYFS
                     GYLNHPTRGLSYSGFSLWDTFRAQTAWLLLLAPSIVPSMLASMLQDFREGGRLPMWKN
                     LVETNIMVGTHADAVLAQAMEVGVNDFGGFGKNEVWEAVREDAFTPPERDTELREEGT
                     PQEARAGLTEYMALGYVAADLHSEAGSRTLDYAYDDHAAAIIASHLSLPSSTIDLLRN
                     RSLSYKNMWNAETNFMESRNSDGSWAGEDAGWTEGDHWAYSLDVMHDVPGLIELMGGN
                     QSFIDFMNRHFDEGHNLHTNEPSHHIPYLYIFAGAPYKTQEWVRSLGQSEYNHTATGL
                     SGNEDCGQMSAWYIFSALGVYPVDPASAKYVLGAPFFDKITLRLPKAPWYDGDDTGTE
                     MVWEVVAKGASQGKVYVKSLKIDGQEMEGVEVGHDVLVRGGKWVWEMEETPQVWGM"
     gene            complement(143499..145238)
                     /locus_tag="CNI00610"
                     /db_xref="GeneID:3259744"
     mRNA            complement(join(143499..143980,144046..145238))
                     /locus_tag="CNI00610"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530423|gb|CF676264.1,gi|41536089|gb|CF681930.1,
                     gi|41549527|gb|CF695368.1,gi|41554756|gb|CF700597.1"
                     /transcript_id="XM_572775.1"
                     /db_xref="GI:58271237"
                     /db_xref="GeneID:3259744"
     mRNA            complement(join(143499..143983,144046..145238))
                     /locus_tag="CNI00610"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530415|gb|CF676256.1,gi|41530423|gb|CF676264.1,
                     gi|41536082|gb|CF681923.1,gi|41536089|gb|CF681930.1,
                     gi|41554756|gb|CF700597.1"
                     /transcript_id="XM_572776.1"
                     /db_xref="GI:58271239"
                     /db_xref="GeneID:3259744"
     CDS             complement(144077..145222)
                     /locus_tag="CNI00610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572775.1"
                     /db_xref="GI:58271238"
                     /db_xref="GeneID:3259744"
                     /translation="MTHPLAMPMDEHAIPMNNLQTVPPSPSNSLNHNLSIAFSRIYDQ
                     IESLKQTQAQNHLQALTDLERTVRLANAGVAEQVRQAVNEGITGMVQQAVRQAVNESM
                     GMMVQSAVRQAMQGIIFSMNYTDGNIQAQAQPLSQQQQQSQLAHPQSQPPNGAPNSNT
                     NNVHATPQGWGMPPAVNGYMSAPNVGAPPGSDPTSSLPNTLHSSLFNFAQGSASTSTL
                     SSNHTHPHQQPAHQPSQPAAHAPPPSEPLVGHAQTKSQASTSQTHPSPGSSNSCFTMS
                     REVKTVPDLWREYTVGLEGQPPVRSVYEGSEKKRKKGKRFKDDSERKFYRRRKRVLDL
                     VETLIKKGIPEDQAAKRVEKLREDRKVTLNKLGEIIPELSPEQLAMI"
     gene            complement(<145719..>149401)
                     /locus_tag="CNI00620"
                     /db_xref="GeneID:3259467"
     mRNA            complement(join(<145719..145966,146020..146115,
                     146169..146485,146542..146756,146806..149266,
                     149325..>149401))
                     /locus_tag="CNI00620"
                     /product="Rab GTPase activator, putative"
                     /transcript_id="XM_572811.1"
                     /db_xref="GI:58271309"
                     /db_xref="GeneID:3259467"
     CDS             complement(join(145719..145966,146020..146115,
                     146169..146485,146542..146756,146806..149266,
                     149325..149401))
                     /locus_tag="CNI00620"
                     /codon_start=1
                     /product="Rab GTPase activator"
                     /protein_id="XP_572811.1"
                     /db_xref="GI:58271310"
                     /db_xref="GeneID:3259467"
                     /translation="MPYLDLRELNALTQLANRGGLGSAIALTDCVAEEPDQLMYIQND
                     HLIILRDLGDVLIASCEGVVGWVRRENLRFVTLASGSANVSPVLDKPQGESLPITVLT
                     APSPPPPTSPPQGIKPEQNDALDTPLIEFKRNSDPFELESEYPQISPALSLSSPGSSS
                     PRSDSFFPPPRPPKSRYRQSPSSSVNGKAGDGGKEDRERKDSGTSNEDVGGIGGSMMD
                     IPTRQPSPDLLSPSLPPDREESEYDSDRSWDIYGDYARESMYGPLMKIGERSPSSARG
                     GGSPLHRTAGWSSEGEVDDENIKEKVVDALRSAQAVIAPEEVQKAKELKVDEMTPRGP
                     DYPSPITPSALNVFEDTPKNPVVESQASEGTSSGEAAQAPVTAEPIEMVKTSSKCSST
                     NSCSVVTPVSENDDPHSSVHRDTKPIPTPAFIPPRHPNFSPSPSLSQSPFPSPSLNSP
                     WMPGSPSSPHSITATRSAVEASRERQQEGRKSKGLTLVGRMNGDLSSAHGPVPITFLI
                     NKDGIPTAVPMPHGVQSTGAPGVGLGFPLPNQEKRVISPLASPVNLETPAMPAHIHPP
                     APGRSFTEPTARTTSPTTISSSLSGHDTVQDEIPIPSMRPRSRSFSSSVAKTLGVGRK
                     SSTPSALSINTSNSQGSSSPSPNLQQSNHRKLFKSSFGPSTTSLSPQSPHSPGMSVLS
                     RGNSTKHSVVSPIQPPASSQSATFPISSKSSKSSRPTKKMSSRTLPSPVSHKDFAEET
                     VKADGMDFQLIHPQKSSFSPTGSPNLDTIYRISSSEFQGQRNAPKGAVEDLKRRPTMC
                     SVSSSSAYSSRALYDTDEWGFLKEKSPTPEIFQSRSAPGNHRAIESKWLSITSSPLPA
                     NGPPKKVRKLVLEAGIPNSLRGKVWAWFMAKALLARVPGLYHELLEHDKRPEDERIEQ
                     DVLAAYPDHSIFAESNCPGQQDLRYILRAYSHFAPDGYRPEMALIAGALLIHCVAEDS
                     FWLLSGLVNSVLKDFYGKEKVGLKIEAGVFEKLLSSAEPKLAKLFKEIGLQPVEFLGK
                     WFGQLFIRCLPWPTALRVIDAVVCEGTRFLLVASLAVLSLSRDRLLRLPPNHDIILNY
                     LHNLPQDSLLLPAHFMKACEEIKFEEKEYRKIRNAMEKDHVPLAWMKEA"
     gene            complement(151613..152622)
                     /locus_tag="CNI00630"
                     /db_xref="GeneID:3259503"
     mRNA            complement(join(151613..152232,152301..152524,
                     152574..152622))
                     /locus_tag="CNI00630"
                     /product="U1 small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_572762.1"
                     /db_xref="GI:58271211"
                     /db_xref="GeneID:3259503"
     CDS             complement(join(151826..152232,152301..152524,
                     152574..152605))
                     /locus_tag="CNI00630"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein"
                     /protein_id="XP_572762.1"
                     /db_xref="GI:58271212"
                     /db_xref="GeneID:3259503"
                     /translation="MGKYYCDYCDIYLTHDSMNARKAHNSGRNHVANVRDYFAGLGGN
                     QAQSLIDQIIQQHESGGRNQMMMAPSMRLGAGFMNPLATQPGYPGPPPPGAFPTFPPT
                     AGTPPFRPPFPPSSAPGAPPPTMPPFLPPNASAGAAPGIGMGSTPPFPPNTASPNPGM
                     PPFRPPMGMGMPPAPAQAQAQGSPMGMPQQGQQGTFTPTQEVPQGAGAGIHPDRLRML
                     GQ"
     gene            152846..>157420
                     /locus_tag="CNI00640"
                     /db_xref="GeneID:3259495"
     mRNA            join(152846..153183,153225..153332,153387..153461,
                     153521..153648,153700..153845,153898..154217,
                     154269..154610,154698..155557,155641..155754,
                     155819..156389,156596..156967,157053..157161,
                     157218..>157420)
                     /locus_tag="CNI00640"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553465|gb|CF699306.1"
                     /transcript_id="XM_572952.1"
                     /db_xref="GI:58271591"
                     /db_xref="GeneID:3259495"
     CDS             join(152902..153183,153225..153332,153387..153461,
                     153521..153648,153700..153845,153898..154217,
                     154269..154610,154698..155557,155641..155754,
                     155819..156389,156596..156967,157053..157161,
                     157218..157420)
                     /locus_tag="CNI00640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572952.1"
                     /db_xref="GI:58271592"
                     /db_xref="GeneID:3259495"
                     /translation="MVKALPKPCQDWDWVGTEVRTPGQITLEHRRRAAGLVTSVVCPR
                     DLTHLGRETTKDDSEVKGNGKGTGEKKGTGCRAKNCKSNYMCYNNLGTEKLLEPDAKA
                     EFVISNLGDVPQERNGPAGLRNLGATCYANAFLQLWFHNVPFRNAVYACVTTETTPLY
                     QLALIFAKLEYGEKNVVDPMGLIDALRLNMGDQQDAAEFSKLFMSLIASEFSKHSDPK
                     LKTLVKDQFEGTMQYITQCECGYESISETTFLEIELSLKDNTTLQSRLDEFTCPEILD
                     GDNKYSCPSCLSKRRATRRQLPVTLPPVIHFSLLRFVFDLKSMSRKKSKASIKYPKEA
                     VLGNSVYELKGIISHQGTSAYHGHFVCETYDESNDTWYICNDELVQPKPVRPHKKIKL
                     EKPGDDKGKLESSKDAYMLVYKRRDGHVSPQFPPAIVMEKVKEENRGLREELNKVGVR
                     KEVLEDEWEHLKGAKVDTDYIVPRDALAKWIQSPSFQDLYKPFDYSSILCAHSQVDPL
                     KSSDIRTISALAHDKLLLYTSLPEIDVCLICVAEGFVARSSITEQQSALEAFDELNAK
                     AELEEGGEEERWCLPKTWLIHWRTGKLPPQTLPTHSSYTLLCPHNAPLPSSSAPPVTF
                     ITSSALSLLHSIFGSFPSFQPGTPPCPECSFEADQNAESLAQWKTDVKLDKSIKRHLD
                     PRPPAFGLDYYVLPKEFIEKWEVYMKTPAGEKPELDMGLGRGRCEHGLLDWDPQMEKQ
                     RVISEIGWEMLCQKYGEKEPIKVQFGANPPEGKKVNIASFTPAVCEPCRIIRLSSYDE
                     LEIPIVFAPGPPTSYSTPASTGNTSGSKSGSGSSRNTSRTLRSRLKTLYIQATRQSTI
                     KDLKVSILSQTGITPLLQKIYYKRRTQPQEQEECSGKGNEEEKELDNDLTIGKLGYLK
                     GEELILVEVKEEGNLDDDDDTVDGGNGGKGKNGKNEGFGGTALLARIACPDCTYENDG
                     AAECCEMCMRDMYDSIRTCSLYTPGSDYAQEENRRVTILDLASNSIECSALQAWVGTT
                     GGMTEEDGESGWEEWIVAFKDAAMSLEWTMKEFRSLYRLQFNNLVYFQSQATQHRRHL
                     MGTDLYPSDKNMADFYRTLEVSKYLEAKKEQPAPTRAKAHNPVTPQTQPTPGSPSGKH
                     IREIFTNKNRCNDCSQVGHNYKTCPKRLYSPGIIRPIKIVQILVTHLQRHHPFTSTSL
                     SASSF"
     gene            complement(<158356..>160409)
                     /locus_tag="CNI00650"
                     /db_xref="GeneID:3259459"
     mRNA            complement(join(<158356..158403,158546..159518,
                     159576..160219,160278..>160409))
                     /locus_tag="CNI00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_572760.1"
                     /db_xref="GI:58271207"
                     /db_xref="GeneID:3259459"
     CDS             complement(join(158356..158403,158546..159518,
                     159576..160219,160278..160409))
                     /locus_tag="CNI00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572760.1"
                     /db_xref="GI:58271208"
                     /db_xref="GeneID:3259459"
                     /translation="MSTPSVTFPTASASAGPHQRHGDDSSPSRWSGGNTKASDGYSAL
                     FTSGLFHESPTKRSQSQSQCKLSPTTPSRRHRRSSIMHTTPSTSSPRTIKSQGLDGGV
                     ERALDSVMRSLKTMAMGATPRRVDPPPMNQSRWSAWSSDSEGSKSISRLGTPAPGQQQ
                     DGYGYGDGDDGFFKPRKFNDTTRSKNTIRSIKPTKSSRSRNGRKGEATVDRMELDGED
                     VPAVPAMPIMAVPATPGRSRRMINGLVRRLGLTPRKNKPSLPPSQLLPDLPSSPPTVP
                     VTAAEDRTIPRKSSLSTLRSALTKKGSSTTLRSVRSILSTNNASMTLNHFSTDDHPLP
                     LPLPRTHREVSTSSPRTTPGKRLRTPKSSIGQPKLQPGTSPSAFLRDMPRRAPETPKR
                     ESFALDHEGCEATPELSAGNARTGEDMWFGEENGEDIVMADETMDVMEVFTPPPAPVP
                     GTTVRIPESHPFVSSVSIPSSQSCLSPEPDSSNSQGSIKSIESFSLPSPPVSLSSRVT
                     SASASTFISIPTSLSILPAGFTDHSPIPLPNVQKEIVAREKTIPILTVKARRGANGKD
                     KDQTVDGYGKNRLLNGLVYQSHLVHLWMALSV"
     gene            complement(161749..161830)
                     /locus_tag="CNI00660"
                     /db_xref="GeneID:3259724"
     tRNA            complement(161749..161830)
                     /locus_tag="CNI00660"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:3259724"
     gene            <162012..163579
                     /locus_tag="CNI00670"
                     /db_xref="GeneID:3259427"
     mRNA            <162012..163579
                     /locus_tag="CNI00670"
                     /product="pseudouridylate synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41547121|gb|CF692962.1,gi|41547124|gb|CF692965.1,
                     gi|41552168|gb|CF698009.1,gi|41552181|gb|CF698022.1,
                     gi|41572669|gb|CF718510.1,gi|41572676|gb|CF718517.1"
                     /transcript_id="XM_572802.1"
                     /db_xref="GI:58271291"
                     /db_xref="GeneID:3259427"
     CDS             162012..163556
                     /locus_tag="CNI00670"
                     /codon_start=1
                     /product="pseudouridylate synthase"
                     /protein_id="XP_572802.1"
                     /db_xref="GI:58271292"
                     /db_xref="GeneID:3259427"
                     /translation="MIITFILRRANKMSRYANLTREQLIQKLEALECTSLVPSQEPLP
                     PQTATATKQERRSKKKAEKPFHFPAHPTRHIALLISYHGWPYSGLALQAPATPDGPPV
                     PTVEAELLAALEKTRLIAEGKGWEGCGFGRCGRTDRGVSGEGQVVNLWVRSSRKRGDG
                     GGELGDGWRDAVEPEVEKMEKTVIVQEDEEKGVKEKKSKVIQPPRQPSEFPYPKLLNS
                     VLPPSIRILAWSPIPASFDSRFSCTYRHYRYAFHTRPTPTSPELDLELMRQGAQLLLG
                     EHDYRNFCKLDGSKQIENHTRGVLKAWFEGGKSQGVGDGMMVFNLIGTAFLWHQVRHI
                     IAVLFLVGAKLEPPSIVSDLLDVKRFPSKPNYTMGHPLPLTLHHCGYPDDLIDWRFGG
                     YDGPWQRLSEDEKEKKYNLAMGGREGLDRQLEVARQEAQLRSWQISGSLRKLDSIFGP
                     SRAEKYAGALWPIGGGDYMMSGKYKKVEDRPRGETPDEVNRKWREGKGKIRKEAREAK
                     GMDVDE"
     gene            <163820..>165090
                     /locus_tag="CNI00680"
                     /db_xref="GeneID:3259399"
     mRNA            join(<163820..164045,164124..164235,164303..164622,
                     164768..>165090)
                     /locus_tag="CNI00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_572758.1"
                     /db_xref="GI:58271203"
                     /db_xref="GeneID:3259399"
     CDS             join(163820..164045,164124..164235,164303..164622,
                     164768..165090)
                     /locus_tag="CNI00680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572758.1"
                     /db_xref="GI:58271204"
                     /db_xref="GeneID:3259399"
                     /translation="MAPKLRVLVSSSSGYPPKAPIPVNSPAPTPISTPGFEGNVWVFV
                     KDYAGDHKEGDGSEYFGKDGRGGMTYGIVVKGKFLEDLTADEVMFGNTFEKPIKDSLP
                     WGTSVATKFMYFIDPTLELDIYADKPWALSPALATMNYLSLEDGSKVGKDLVVKEDSL
                     EFIKSKAKDEGIAVPTPREGDEKTEINARRKWLADKKNREKIKLGKDVVVGMEFANGL
                     LDFNTLSAALPPPFNAQFPLVKYWDGQPVTYVCQRKAPKGQSPVGQDVFWSVAFEIID
                     EDLKNELEKRGAKGAAGEKGTKDDREEEQGKEKGKGNGNNENEKVSDDVD"
     misc_feature    163874..163920
                     /locus_tag="CNI00680"
                     /note="C-rich"
     gene            complement(165149..166684)
                     /locus_tag="CNI00690"
                     /db_xref="GeneID:3259634"
     mRNA            complement(join(165149..165511,165566..165808,
                     165895..165977,166045..166167,166254..166416,
                     166478..166684))
                     /locus_tag="CNI00690"
                     /product="ketoreductase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41566931|gb|CF712772.1,gi|41566941|gb|CF712782.1"
                     /transcript_id="XM_572756.1"
                     /db_xref="GI:58271199"
                     /db_xref="GeneID:3259634"
     CDS             complement(join(165233..165511,165566..165808,
                     165895..165977,166045..166167,166254..166416,
                     166478..166672))
                     /locus_tag="CNI00690"
                     /codon_start=1
                     /product="ketoreductase"
                     /protein_id="XP_572756.1"
                     /db_xref="GI:58271200"
                     /db_xref="GeneID:3259634"
                     /translation="MVADTVHVGQHLAGHPSVHLFGHEIVLDVSIPALILSTVGAAFL
                     LRYTLSIFRLFLELTVLPGKDIKSFQSRKGETWAVVTGCTSGIGLEFARQLAAKKFNI
                     ILVGRRQSALTDLSKEIESKYDVHTKSVTVDVSTPGSARDDALTQLELLAQNLDVGIL
                     INNVGASHSMPVAFHETERSEMSRIIETNVTWTYLVTRSILPSMVARSKQKGAPKSLV
                     ITIGSLSGRIPSPLLASYSGTKAALATWTKALAEEVKPQGVIVELVQAAFVVSNMSKI
                     RKSSPFVPTPAPFVRSTLNSIGLPRGAQGRPHERTPFWSHAILDYVVGFAGYVSEMAG
                     IKVILGMHKDIRKRALKKAARDEKKAE"
     gene            166903..168918
                     /locus_tag="CNI00700"
                     /db_xref="GeneID:3259519"
     mRNA            join(166903..167253,167303..167799,167851..168918)
                     /locus_tag="CNI00700"
                     /product="transcription regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537044|gb|CF682885.1,gi|41537049|gb|CF682890.1,
                     gi|41565466|gb|CF711307.1,gi|41565471|gb|CF711312.1"
                     /transcript_id="XM_572804.1"
                     /db_xref="GI:58271295"
                     /db_xref="GeneID:3259519"
     CDS             join(166937..167253,167303..167799,167851..168797)
                     /locus_tag="CNI00700"
                     /codon_start=1
                     /product="transcription regulator"
                     /protein_id="XP_572804.1"
                     /db_xref="GI:58271296"
                     /db_xref="GeneID:3259519"
                     /translation="MVTLVEHRAFLNSILDRQAERRRLIDPEAVFPTQPVIRGRIPRA
                     IHHRTPGDDEGERDGWISKENVANYVKEEETIRNDYCEWYGATGECGSNFIMGAEGED
                     ICSEYPALKKLMNLKAQLVSSNSHPPLYFPLSHEPLRDSLLSTFSNFRFDVIRINPLL
                     DWADIAELPIKQISSDPAIVFLWVGRGDQEGLERGRECFARWGFRRAEDIVWVKTNRN
                     KNSGERAAANGALFANQKEHCLMGIKGTIKRSVDVRFAHCNVDTDIIVWEDSGDHEGP
                     RYPPYLYTLIENFCLGTRRLEIFGRPNLARRGWVTAGLEPFSSSSSTADQNNVQLFDP
                     QSYPSLVPESDGKPILPFSPEIDQLRPKSPVRKPPRYNNPSGGNPNNLAGGGIGNSGS
                     RNQGGLAVGGRPSPAPRFAQNGGTSGSGTPMGNRPNLVMPNQTSPIDYSQTQGRMSPV
                     NPMMMQGPTMEQMVAANMGMGGIGVGMNGPMGMPMGMPIGNQYAYGMGINGGQPGFGP
                     PFGAGMGMPVGMGVGMGMGMPMGMDMGMGHMGNMGFDGMMPGQGQGFGQQQLPQMFGN
                     PQMGPRFGGWHGQGGQGQWQ"
     gene            170879..173536
                     /locus_tag="CNI00710"
                     /db_xref="GeneID:3259396"
     mRNA            join(170879..171007,171061..171373,171433..171797,
                     171857..171907,171957..172159,172214..173536)
                     /locus_tag="CNI00710"
                     /product="long-chain-fatty-acid-CoA-ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530904|gb|CF676745.1,gi|41532452|gb|CF678293.1,
                     gi|41532670|gb|CF678511.1,gi|41532697|gb|CF678538.1,
                     gi|41534905|gb|CF680746.1,gi|41545612|gb|CF691453.1,
                     gi|41546124|gb|CF691965.1,gi|41553518|gb|CF699359.1,
                     gi|41559995|gb|CF705836.1,gi|41562480|gb|CF708321.1,
                     gi|41568947|gb|CF714788.1,gi|41569895|gb|CF715736.1"
                     /transcript_id="XM_572754.1"
                     /db_xref="GI:58271195"
                     /db_xref="GeneID:3259396"
     mRNA            join(170879..171007,171061..171373,171433..171797,
                     171857..171907,171957..172159,172214..173171,
                     173226..173536)
                     /locus_tag="CNI00710"
                     /product="long-chain-fatty-acid-CoA-ligase, putative"
                     /transcript_id="XM_572753.1"
                     /db_xref="GI:58271193"
                     /db_xref="GeneID:3259396"
     CDS             join(170893..171007,171061..171373,171433..171797,
                     171857..171907,171957..172159,172214..173287)
                     /locus_tag="CNI00710"
                     /codon_start=1
                     /product="long-chain-fatty-acid-CoA-ligase"
                     /protein_id="XP_572754.1"
                     /db_xref="GI:58271196"
                     /db_xref="GeneID:3259396"
                     /translation="MAPRKNKEPASWEVDADKPKPDGETRVRRAYCVKDLVTQPAPGI
                     DTVHDLLIYAAKTHGSKKGFASRDILKVITEEKEVTKRVGGKEHKETKKWNYFKLSPY
                     NWMSYEGFLGKVKEIGAGLRVLAADDGRESEKFFNIYSQTSRNWMLVAQACAFNAVPI
                     STAYDSLGPEGLKHAIQETEVHSMFTNADLLPTLLKVIGDTETVKVIVYDGEADPKII
                     EDLKNVREGMKVVTLDEVVEIGKKNPVEAIKAKREEVYCCMYTSGSTGTPKGVLLTHG
                     NVVSAVASVWTLLYEYLTSKDSYLAFLPLAHILEFVVENSFIFAGLPVGYGRVKTLTD
                     ASVRECKGDIAEFKPSIMVGVPAVWELIRKGILTKVDQSGALKKSIFNFALKAKQAAH
                     HYSIPFLAGLTDTIVFDAVRAQTGGNLKILFSGGGAVSKSTQQFLCTALVIMIQGYGL
                     TETTAMATILNPAFMQFGAVGGPVPAAEVKLIDAPEAGYFSTNNPPQGEILVRGPAIF
                     KGYYKRPDLDKEAFTEDGWFRTGDVGQWNKDGTLSIVDRLKNLVKLAGGEYIAIEYLE
                     SIYKSCPLVANGAILANGDHNQPAMVVVAHPHNLPAFAKKNGLGDGEDLEHLCTDDKV
                     TDAALKELNNIGKKAGLKGMELLEAIVLVADEWTPESGFLTAAQSKFYLFIFTARTMA
                     NNIAELQRRVIEKHYEDRIKAVYD"
     CDS             join(170893..171007,171061..171373,171433..171797,
                     171857..171907,171957..172159,172214..173171,
                     173226..173287)
                     /locus_tag="CNI00710"
                     /codon_start=1
                     /product="long-chain-fatty-acid-CoA-ligase"
                     /protein_id="XP_572753.1"
                     /db_xref="GI:58271194"
                     /db_xref="GeneID:3259396"
                     /translation="MAPRKNKEPASWEVDADKPKPDGETRVRRAYCVKDLVTQPAPGI
                     DTVHDLLIYAAKTHGSKKGFASRDILKVITEEKEVTKRVGGKEHKETKKWNYFKLSPY
                     NWMSYEGFLGKVKEIGAGLRVLAADDGRESEKFFNIYSQTSRNWMLVAQACAFNAVPI
                     STAYDSLGPEGLKHAIQETEVHSMFTNADLLPTLLKVIGDTETVKVIVYDGEADPKII
                     EDLKNVREGMKVVTLDEVVEIGKKNPVEAIKAKREEVYCCMYTSGSTGTPKGVLLTHG
                     NVVSAVASVWTLLYEYLTSKDSYLAFLPLAHILEFVVENSFIFAGLPVGYGRVKTLTD
                     ASVRECKGDIAEFKPSIMVGVPAVWELIRKGILTKVDQSGALKKSIFNFALKAKQAAH
                     HYSIPFLAGLTDTIVFDAVRAQTGGNLKILFSGGGAVSKSTQQFLCTALVIMIQGYGL
                     TETTAMATILNPAFMQFGAVGGPVPAAEVKLIDAPEAGYFSTNNPPQGEILVRGPAIF
                     KGYYKRPDLDKEAFTEDGWFRTGDVGQWNKDGTLSIVDRLKNLVKLAGGEYIAIEYLE
                     SIYKSCPLVANGAILANGDHNQPAMVVVAHPHNLPAFAKKNGLGDGEDLEHLCTDDKV
                     TDAALKELNNIGKKAGLKGMELLEAIVLVADEWTPESGFLTAAQKLQRRVIEKHYEDR
                     IKAVYD"
     STS             170927..171502
                     /locus_tag="CNI00710"
                     /standard_name="Sca4"
                     /db_xref="UniSTS:470720"
     gene            complement(<173589..177348)
                     /locus_tag="CNI00720"
                     /db_xref="GeneID:3259506"
     mRNA            complement(join(<173589..174799,174869..175202,
                     175264..176316,176366..176794,176839..176886,
                     176934..177056,177110..177348))
                     /locus_tag="CNI00720"
                     /product="transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530333|gb|CF676174.1,gi|41531165|gb|CF677006.1,
                     gi|41531454|gb|CF677295.1,gi|41533544|gb|CF679385.1,
                     gi|41538603|gb|CF684444.1,gi|41539391|gb|CF685232.1,
                     gi|41554874|gb|CF700715.1,gi|41558987|gb|CF704828.1,
                     gi|41561150|gb|CF706991.1,gi|41568408|gb|CF714249.1,
                     gi|41571296|gb|CF717137.1,gi|41573123|gb|CF718964.1,
                     gi|41574928|gb|CF720769.1"
                     /transcript_id="XM_572809.1"
                     /db_xref="GI:58271305"
                     /db_xref="GeneID:3259506"
     CDS             complement(join(173589..174799,174869..175202,
                     175264..176316,176366..176794,176839..176886,
                     176934..177056,177110..177310))
                     /locus_tag="CNI00720"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_572809.1"
                     /db_xref="GI:58271306"
                     /db_xref="GeneID:3259506"
                     /translation="MSTQQLTSLFGSRLSSAYNQLRGDLGAPQTATDTIGKLVDKIQT
                     SAAVEDRRTAVLGLKGLSRDWKEDVGRRALPSLIAVLEHDAPFDSEIARATLETLMQL
                     CETVEKPTKDDLGLFFTDAFLEVPKPLHSLVNLISASPSFYPRYFAVQFLIQLTTARP
                     AVAQSYIMSSPPPGIDGILAVLDTKSPSATPSMMGGGAAEMLRNEALLLLPPMLAGNQ
                     DLQKIVAFSGAFEKLFQIIDQEGGADGGIVVQDALAAVACLLRFNVSNQNYFRELTLI
                     PQIPRILDFPAPLPADEPTPDEFALQYWSDQKIHNTGLVLGLIRMLVGGPGGGNQNAM
                     VSSGVTRCLLELSLASNAPPSIKSQCLSTLTPILTASSTNQDLLSSLLVSPLLAVQAD
                     DEHPGGGFVRVPAKSAVEALVASIIDGDPTTGGKGLKARAAGVNMFEAYLSSNDEGRI
                     TILSALVTPIADNLNVDPISNAGSLILSGVLELPHSSITPSFDPYRPLFSCLLLSHLI
                     RNSEHAKKLAREISFPSGDTDLDHDPDSAIETEEDKIPLLQLVVGNLMLASREQTESV
                     NRAARSGGAEATREEEEWTRVMVGYLALLCTWLWDSPKSVKEFLSESNNLQALIQPIT
                     QNTSIDPLVQGLSAFLLGVCYEFNREPGEITRATLHPILHSRIGPDQFVSRMARLRED
                     PRFRAVQPDEFELTSLLSSQAPMGEEEEEDMEVWFDWAFVDFWKNHYYTIQRSIAIDP
                     DAPRNVPPADDAETAAIIMSLRSKLKTQTDEVTNLTNKIESLQKEAKGEKGQLIEEVE
                     SLSSQVASLSTQLGESVKRTEELEGELNTLKQSYSDLEKTAAAAQSTATELESVKEEL
                     KQVKEAHEKASSELSLAKMSAKGREGKFKDLENKVKELEEELGEAVKAKEAAEAQAGA
                     AAGADADAGTGRGDSASKAEEEVRKLEEENKKKEEELKKLGEEAKKRKEEATMKEEEA
                     KKQEEEVKKKEEEWNTKQREWEAQVKAREDRVKQLEQNSKSSEEKAKSAEEKTATLES
                     KIKELEEKLATAASASTAAPAETAGGSNKQAKKRAAELDAKVKELEASLVEEKTKREE
                     EAKEHEDLLVLLDELTGKRTRDKRLMKEKGLEVSEDEEGEDEEE"
     misc_feature    174033..174193
                     /note="CT-rich"
     gene            178131..180885
                     /locus_tag="CNI00730"
                     /db_xref="GeneID:3259544"
     mRNA            join(178131..178189,178264..178564,178629..180885)
                     /locus_tag="CNI00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_572751.1"
                     /db_xref="GI:58271189"
                     /db_xref="GeneID:3259544"
     CDS             join(178312..178564,178629..180670)
                     /locus_tag="CNI00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572751.1"
                     /db_xref="GI:58271190"
                     /db_xref="GeneID:3259544"
                     /translation="MLDTTHTRDIRVSPKNGPSYTRPSPSSHSLSNLSTAELHEQLDI
                     DLDDIDVWSEESEDTEDYKGTKPLRVKKKKINFTTGRVVANRRHRRSTISGPRSPHSP
                     RSFTFASPRSPKLPAPKRNPSAATPSSAHAHISQLFFALPAISPSPTMPGPYPFASAL
                     GTKRSSGSSLHLGLGRFTSYDPICPGPSPPVSPAPSPTTRYTFSNVHEHNANYSSSAC
                     TYERKTLPTIPGSPLTPSRAPRKAAELLGAIPPTTISKAGMRKHTASALKPGKHFRPL
                     PNAAITEIERFFGDVPRKPSKTPPGLKSKSNKSKSKPSSHPFAMKPSSHSSSSRSGED
                     VHRKSDRETIGQGETVKHRAPDGSMWLDVEEEQEFAWLMGDALAAVPPAPLPSVAAVE
                     AKVKAKGEAEAKPVEGIVRFIERKEERQRMKQLDEMDVLCGSDGESEKWGMEAFTSIL
                     SIPKPKSSSTKSKPKSKFSRKNPPKTDITASFLEMETPKRRDFSSDISSRDITNLHPW
                     NRHVRSHSNPTPDSPKYEISDPIPLFEDIPLDFTVPRDISAIMRADSGAGSSKLRNGR
                     GLSSSPPRVKNRPPPITLPQSAINARLPVLTATSPSDLAFHRPPSSTVQVQAEPIAAP
                     AHTASGTMPTTPFVRPRAAPAAPALRHRPRATGSSPPPPVPLNSLIPMSPVPPIPPLP
                     TVSATDISKPSNNGKLGPSATTVSISITGSGKPNDMREIRKGEKEDKVSISFFEPVTP
                     VNPTPPAGVKGKGWLKRVVKPLMS"
     gene            complement(180897..183332)
                     /locus_tag="CNI00740"
                     /db_xref="GeneID:3259528"
     mRNA            complement(join(180897..182294,182343..182514,
                     182561..183332))
                     /locus_tag="CNI00740"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552144|gb|CF697985.1,gi|41553189|gb|CF699030.1,
                     gi|41556635|gb|CF702476.1"
                     /transcript_id="XM_572954.1"
                     /db_xref="GI:58271595"
                     /db_xref="GeneID:3259528"
     CDS             complement(join(181013..182294,182343..182514,
                     182561..183119))
                     /locus_tag="CNI00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572954.1"
                     /db_xref="GI:58271596"
                     /db_xref="GeneID:3259528"
                     /translation="MSLFFANSDTPQPDPISGADYLSKLHKFLKSNAPRLAPSAPRNT
                     SRNLTPSIWQQGYTVLTLGLDPNSAPVRNTKGSMGLGFGMPSTKRTPPPKPLLLRLPP
                     DRLLYLLLRWQALPQSLPHVGRTDIPIEEGVVIAARGTEGEGRGKEGDVRSVRSWVGS
                     IRSVSGTLVGGGQNRGWWGSKQAVNEDELLLSLYSMFTLIPALLIHPPNISEPPIAEL
                     VEAGGYTQLGGIDVRVPLDVLRNLQILELEHYDPRALLIPSNPGMRSLTVRDVSDGDE
                     WIYELLTIPSNNSTEPQPRFPNLHHLSLLSASLLTFPTLPLESLTHLDLSYNLLDAIP
                     STLSSLTNLKSLNLSHNLITSLRNAPASVGQISSINLSHNRIDCIVGLDRAMALSRVD
                     LRSNVIYDVGEIGRLALLPEIHEIWCASNPFDAPTAYPPEPAESWRVELGRTFREEGK
                     DIILDGIAWTWSEERKIEAGLISRGIGANGLGGRGYERGWAKPHYGTQTHEDVSPGRP
                     PVAHRRSATHTHTTARSSSPTLPPSQSSSPRTRSPHVLPSPSFPHGPSQLRETSTVSH
                     PASGKSGKGRKKGRRRVINLEGDGNEDDSGAENVRERERNLGDVLEKGLGDDNVKNGG
                     EFQGSNGSAHENGREQSSAPAAVTEVKVVKKKKNKKRSKEPSTAGG"
     gene            complement(183423..183511)
                     /locus_tag="CNI00750"
                     /db_xref="GeneID:3259584"
     tRNA            complement(183423..183511)
                     /locus_tag="CNI00750"
                     /product="tRNA-Ile"
                     /codon_recognized="AUU"
                     /db_xref="GeneID:3259584"
     gene            <183896..>185028
                     /locus_tag="CNI00760"
                     /db_xref="GeneID:3259469"
     mRNA            join(<183896..183947,184109..184453,184690..184773,
                     184787..184968,185017..>185028)
                     /locus_tag="CNI00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_572749.1"
                     /db_xref="GI:58271185"
                     /db_xref="GeneID:3259469"
     CDS             join(183896..183947,184109..184453,184690..184773,
                     184787..184968,185017..185028)
                     /locus_tag="CNI00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572749.1"
                     /db_xref="GI:58271186"
                     /db_xref="GeneID:3259469"
                     /translation="MLAPTYTSSLLFALSATVLAFDSSSLTYLLPGTYSSTSYSPTSP
                     LNASISTSSSSLTISTPDSPVGFTSYSYSGSGNVWTDNDWGMGNWKSIYLPDGWYAVL
                     GQGKVLWGAIPEKSLLPMSISSMGISYAGSSGPSNCTIWDDGYTGTGKCIGTATSASD
                     ACYYLAWADSVLKSVDATMEHVLLPQSVLVQLDGRPTLPHLHPCATLALKGSFKMFPV
                     TVLLAL"
     gene            185408..187155
                     /locus_tag="CNI00770"
                     /db_xref="GeneID:3259383"
     mRNA            join(185408..185433,185487..187155)
                     /locus_tag="CNI00770"
                     /product="expressed protein"
                     /transcript_id="XM_572807.1"
                     /db_xref="GI:58271301"
                     /db_xref="GeneID:3259383"
     CDS             185794..187041
                     /locus_tag="CNI00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572807.1"
                     /db_xref="GI:58271302"
                     /db_xref="GeneID:3259383"
                     /translation="MSAHSGSCIPSTSCPSSTVSINGTCVTCPLDCATCSTASTCSTC
                     PSDRPILKNGRCIAYCATDTYYDTSTGTCQACDWTCKNCVGEGSAMCSSCSDGYMLKD
                     GVCVDALCGDAGFANGFGMCFSSFVHKSQKRYLGLLALVGVAIIAGIASWWYVRRERR
                     KTRQATKEFGKRLDERNVNDRLSALRLEKVFGFNRVTFGRGGDRSARTTQEDGGKKNK
                     LRELLLPSKRRSGNEEMEMKKSNFAPDKERDCYDSWRTSNFGKDNWVAPPPYVPSQGV
                     PTPVDVKHTFNKRDSLDSIPTPSHQTFAPSSSTSSFTITRPATPPRKLQNPYLGSTII
                     HSMSTPSPPPHSRSLMPPPRPGMGRRESGNSFSSGSLWTPMTGMTSITKITADKERDV
                     RRYSGRQDRQMDVERRPTDYDLL"
     gene            complement(187155..188890)
                     /locus_tag="CNI00780"
                     /db_xref="GeneID:3259554"
     mRNA            complement(join(187155..187338,187402..187506,
                     187567..187657,187709..187848,187905..188010,
                     188062..188890))
                     /locus_tag="CNI00780"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539450|gb|CF685291.1,gi|41539456|gb|CF685297.1,
                     gi|41562618|gb|CF708459.1,gi|41562626|gb|CF708467.1"
                     /transcript_id="XM_572747.1"
                     /db_xref="GI:58271181"
                     /db_xref="GeneID:3259554"
     CDS             complement(join(187237..187338,187402..187506,
                     187567..187657,187709..187848,187905..188010,
                     188062..188870))
                     /locus_tag="CNI00780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572747.1"
                     /db_xref="GI:58271182"
                     /db_xref="GeneID:3259554"
                     /translation="MALQRTPPQRVQRLSPNPMVTADEVLQSGASPFQPRNPAVMRSP
                     PAGSQPHSQYQLAPSPTPQSRPPPKQPEAGPEAPQDSAEEVPAEEVGQEQEDEPATHK
                     SLIVDDRPIRPAPAIVIEPEVSMEVDELEIAPAPEPEAGPSTASQQVPEQTGDVEMEE
                     VEPEPELEPQPESAQPSEPIKPPNSSTPPPSESPALAPAPKSPSLPPAPVTPAAKTPR
                     SRTRRQTNQLPAPPAPIQVDDASQAVSQYGKRYQVTYDALERAVKAGTQRWTADNLKD
                     CFPHLAAQMPKAMENAWMSTSHTMRTKIMSNAQELLKHYKAGPALQIIDEIAQEAREH
                     AKLHGGNGNVYTRPDAWRPNLAPHALVAATNLPVLDETYERLRDEYLGLHKDCQERYA
                     SILAKQAQLKQLEENVGDGVVELDKTLKALDGLPVEDMMIWTEAAETKMETRAPEYGE
                     "
     gene            189106..192568
                     /locus_tag="CNI00790"
                     /db_xref="GeneID:3259633"
     mRNA            join(189106..189167,189243..189324,189375..192353,
                     192408..192568)
                     /locus_tag="CNI00790"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535907|gb|CF681748.1,gi|41556163|gb|CF702004.1,
                     gi|41565325|gb|CF711166.1,gi|41565327|gb|CF711168.1,
                     gi|41571527|gb|CF717368.1,gi|41571528|gb|CF717369.1"
                     /transcript_id="XM_572745.1"
                     /db_xref="GI:58271177"
                     /db_xref="GeneID:3259633"
     CDS             join(189323..189324,189375..192353,192408..192423)
                     /locus_tag="CNI00790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572745.1"
                     /db_xref="GI:58271178"
                     /db_xref="GeneID:3259633"
                     /translation="MSDSTTPPDSISRSSSPGQAGPQRRVVSGSLRDRIAKFNNPSAP
                     PPVPKQHVPSAPVSRGMVGNRIPSLDRKSAGILGVTPDKRVPESKGMIGNRIPSVTGG
                     GYSPVPYQNTGSSSGGISTNPAPAVVARDASPAGSASGSVDSSAASATVDSSASPITS
                     RSSTPPSSPGTAGTAATGDVPPSLVAATLPSLNANLGTSTPSSTRAEAGDAVSEFSLS
                     VPSTPMGNSTPPLPAPEYDLVAPNLKLATGSIPHPMAPGITSQSAKFAPSVSSSLATQ
                     SVGSEEEIQMMADVSGVSTPMGTPRAERRGLGEGSVAGEGSVGGDGSVAGDEEGSVND
                     VSGKIDKLDLGENTPPSDETLSTPVKDIKAPTVHEPLESAATDKDLEGPPTPKSAASS
                     SDPSKAQDLVALKQGQLHSSPSNVPSRDIDDMAASVMARNFGEYTIAPEEKKVQGGEA
                     GQFIEDVEIPDEILVPPAQTKQEYGGQEELPIQEVGKEGDKDVIKTDEEKAAEQPDVV
                     VAGKDVPATQSAESEEPGPIKTDSEKAAEEPDVVTVGEDVPPTQSAEGSEPIKTDSER
                     AAEAPDVVLAGDDVPATSSGETANKGVIKTDAEKAAEAPDVVTVGKDVPATQSASQGD
                     EEKVVKTDEEKAAEAPDVVVVGKDVPEVQSAEQDGSTIKIDEEKAAAAPDVITVGEDV
                     PVVQYGDAEDGAGLIKTDEEKAAEKPDVVVVGQDVPATQSAEDNTPITETKVDQPQVA
                     AVGSEILPGDVISSDRDKDVKQFEVEPAPTAPSIQPSAPTFLDVPSPVEIVDEEKTPT
                     GEEAAPDFPTPPAADPDVVDPISETTSSTELESPQQSAVAAFNEPSDAPETPIDKSML
                     KYFPEVPDEEKPRVEVHVSSPAVTPAKSKKESIGNPKSPTGLPASSSERSLGGESDVA
                     DLQGQSKSISHPTLDNITPSKSSLYAVEGDSSDQLDTMTPEAAKRLSKSNSMRKSPKS
                     PLLDDEDPGDFEPGEGWAVVTKGRDA"
     gene            192827..195791
                     /locus_tag="CNI00800"
                     /db_xref="GeneID:3259442"
     mRNA            join(192827..193011,193061..193982,194045..194480,
                     194546..194716,194780..194835,194886..195055,
                     195108..195152,195210..195274,195325..195354,
                     195407..195428,195493..195574,195633..195791)
                     /locus_tag="CNI00800"
                     /product="peptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530929|gb|CF676770.1,gi|41530946|gb|CF676787.1,
                     gi|41541883|gb|CF687724.1,gi|41541887|gb|CF687728.1,
                     gi|41561810|gb|CF707651.1,gi|41561817|gb|CF707658.1,
                     gi|41564388|gb|CF710229.1,gi|41564391|gb|CF710232.1"
                     /transcript_id="XM_572743.1"
                     /db_xref="GI:58271173"
                     /db_xref="GeneID:3259442"
     CDS             join(192839..193011,193061..193982,194045..194480,
                     194546..194716,194780..194835,194886..195055,
                     195108..195152,195210..195274,195325..195354,
                     195407..195428,195493..195574,195633..195713)
                     /locus_tag="CNI00800"
                     /codon_start=1
                     /product="peptidase"
                     /protein_id="XP_572743.1"
                     /db_xref="GI:58271174"
                     /db_xref="GeneID:3259442"
                     /translation="MRATVLTLLGLSASAWATPAPFTVEDMLAAPRPFPAIASPDKQH
                     AIAVVDYWEPRDDSMRREAYLATLNRPEVKHPISLFNTTPSAAADFFWLDDVTIAYLD
                     GSNLFSYPVEYAFSQSNFKPKHNPPRSPRHQKILSFPHGVNPTSLQYEASTKTLAFTG
                     QVWSDGSFYQTRHHDKLYEKKRDSAQVYDDLMVRHWDTWRVSGKVWTLGVVKLININD
                     EWAELDNDINKHHKRRAEFINILNGTDLVSQTDPIDAGSYSISSEHIAVAVKPPYLQT
                     ATHTREDIYLFPLPSSYDSASILPKHVTPHAHGAISEIKFSPDGKKLSWLEMKKDGYE
                     SDRRVVVVYDLMSGKSERWTEVWDRSPKSISWAVDSQSIFLLAEFRGRTLPYHLTHPN
                     HLPTPLLFNGTTVSLTPLNETDILIARQSFRTPTVEWILTLPDPAEDGNAVGDGDGDK
                     IPAVEPLRQLTRWNEHFIRGRLDVQTGEEFWFKGAEGKDVMGWALKPRGWKPDQKAKY
                     PLAFLIHGGPQSAWDDSWSTRWNPALFAAQGYFVVAINPTGSTGYGQEFTDAIQGDWG
                     GKPFKDLLAGYHYVLENYPEIDPERTAGLGASYGGYMVNWINGHNDHFGFKALVCHDG
                     VFDTVTTFFSTEEIYFPTQDFAGTPWTNRATYEKWNPVNHVIEWNTPELVIQGGKDYR
                     LENSQGLGAFTALQLQGVPSRFVYFPDENHWILKPHNSIKWHHEVFRWLEEWIGKPTD
                     ESEAFVVQRE"
     gene            196833..200109
                     /locus_tag="CNI00810"
                     /db_xref="GeneID:3259543"
     mRNA            join(196833..197143,197199..199234,199282..200109)
                     /locus_tag="CNI00810"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531493|gb|CF677334.1,gi|41531505|gb|CF677346.1,
                     gi|41570705|gb|CF716546.1,gi|41570712|gb|CF716553.1"
                     /transcript_id="XM_572741.1"
                     /db_xref="GI:58271169"
                     /db_xref="GeneID:3259543"
     CDS             join(196952..197143,197199..199234,199282..200020)
                     /locus_tag="CNI00810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572741.1"
                     /db_xref="GI:58271170"
                     /db_xref="GeneID:3259543"
                     /translation="MGPLRRQPAMLDLHSASRAVSVEWDDWDKDPWGQEEINHGSLKR
                     QSTDVLGETEDRKRIKEVRQSDKYRKASSIAKRSEPLLRRPVRSSNSPDTTTIVLEPR
                     SRSFSSARFEKTVTYDHASAISPCSEYGEGISLVLGISKPPQRFHASEYPESAYSTER
                     PDLAVFGQPASQPMVREYTSMGWDGENVENRCDTGKVLEGLPLINTSRLERTRKGNSK
                     SPWHQVSRKYSRASPLSNSTGDHDARTHTLLHTMKRGKSKSYQGGLSLNFQSVSLSPS
                     PIAPTPSPTSSSHSSQSFLSASMSDHSVRILTTITAQTRPHMNFLANASDVSILAPST
                     IGIGYSSSADTGSPGSLPESLEAECVDLTETGRRASHASKRDKRHSWMSHTNTVDPET
                     VEIITEELPSTQPLKSDPVYLRPCYILPVGSQTPLHTCSSAQGPKLKRAHTYANLKDL
                     WKLASFPGGLIEVQKDEEPVKQENQGLSSQILEPPAIIQPPSLGPPIDILSRPVSSAI
                     SRDTTTTARGPPTTHSYSPFRSVSMCSPPDTVEELFPESPFNSPQPGNIGKIKRSPFQ
                     ATRNSLKGMLNKSFKGRSLAHAFDNAEQNSQQRESSLKSKISGPLLIRGMRGEMDRKK
                     SDKEWREEVLKDVVGRTLSSQFKLLEEVAKQQRESLLDKEKISQKTPSFGIGLKNRSP
                     IPETLLSAVSICDKENPITADSHADRMKMKSGTRPSMESSLSLRMVTDETFNNPKTEG
                     LTSGHLANSIGRKNLTNQTPPHRLSGKGRPTSAPLLSAWSPPRPKSEKLSQVINPPIV
                     VNHATPRPEESPKTNPHHPPSSPSPSPKAGKSKSGRISRRSSILNLLKSKDSKHQNAS
                     QSPPRPKKMASGTFTLTGSIRSSFLAIIKNHIQTMQQEKRGKYSRTPCIIPPSTLPLR
                     TPIHQHTELYRPLSRARSSFELTLNLEPAKPLLDELLARDDALGFLEGRNKREQRVEV
                     DIEKVLEWRKEVEEDI"
     gene            complement(200186..201799)
                     /locus_tag="CNI00820"
                     /db_xref="GeneID:3259403"
     mRNA            complement(join(200186..200357,200409..200464,
                     200524..200720,200777..200886,200948..201054,
                     201119..201138,201200..201329,201381..201799))
                     /locus_tag="CNI00820"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41565958|gb|CF711799.1,gi|41565971|gb|CF711812.1"
                     /transcript_id="XM_572972.1"
                     /db_xref="GI:58271631"
                     /db_xref="GeneID:3259403"
     CDS             complement(join(200211..200357,200409..200464,
                     200524..200720,200777..200886,200948..201054,
                     201119..201138,201200..201267))
                     /locus_tag="CNI00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572972.1"
                     /db_xref="GI:58271632"
                     /db_xref="GeneID:3259403"
                     /translation="MVQKTRPSEKRIHLTRHAQAEHNVADDYTIADAPLTALGQEQSR
                     QLNEATKNGVQKTAELLVTSPLRRPLETMLLGYPELKSRLEKSGKPVILLDILQEVGP
                     YPCDTPTHPISALKASNGGIFSSLDFSTLSPDYASKEGIFSPANGAARAKLARKWLRE
                     RPEKEIVVVAHGDILRYIADGQQSSRPWNNAENKVFTFRSDDDSDDSMVEADYNVEAR
                     DATEAPTSSEIKAGKF"
     gene            205746..>207378
                     /locus_tag="CNI00830"
                     /db_xref="GeneID:3259455"
     mRNA            join(205746..206233,206289..206385,206443..206491,
                     206542..206910,206963..207244,207299..>207378)
                     /locus_tag="CNI00830"
                     /product="monocarboxylic acid transporter, putative"
                     /transcript_id="XM_572815.1"
                     /db_xref="GI:58271317"
                     /db_xref="GeneID:3259455"
     CDS             join(205824..206233,206289..206385,206443..206491,
                     206542..206910,206963..207244,207299..207378)
                     /locus_tag="CNI00830"
                     /codon_start=1
                     /product="monocarboxylic acid transporter"
                     /protein_id="XP_572815.1"
                     /db_xref="GI:58271318"
                     /db_xref="GeneID:3259455"
                     /translation="MSEEVIELRNLNTLTERTTTVQRFEENREDNESVGSRKADDTPS
                     ERSLAQEDEENQGHEEAVIQYALPPADCGIRAWLFLAGATMMELLIWAIPTSVGVLHV
                     YWTNELFEGRGTATLTLAATLHSGLVYMSTALLGPLVVRATTWQKTIQVVTWIISAAG
                     LIASAFATQPWHLIVTFGIIYPVCGAAYLPCATLLFEWFVKARGTAMGIVYAGMGVGG
                     AVCPFIIDGLLKRYSYKTTMISIGVGFGIIGLISLIPIRHRIPPTSRSHHSEKRWHAA
                     DWSFMKSTALMAGLATILLTSLGNFVPSLWLPSFADDLSLTKPSGTGLVAILNAASVP
                     GNAILGVMSDHISLRVVILISCIGSGLACAFLWGFGTNDGMLVAFTIVFGLLGPSFSA
                     LWTKMNAVISKDNPFAITIVLSLFTFIRGVGNLTSG"
     gene            complement(208651..211642)
                     /locus_tag="CNI00840"
                     /db_xref="GeneID:3259460"
     mRNA            complement(join(208651..208716,208764..208869,
                     208936..209148,209292..209342,209401..209571,
                     209641..209792,209853..210006,210081..210106,
                     210186..210640,210708..211054,211115..211642))
                     /locus_tag="CNI00840"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533007|gb|CF678848.1,gi|41533019|gb|CF678860.1"
                     /transcript_id="XM_572739.1"
                     /db_xref="GI:58271165"
                     /db_xref="GeneID:3259460"
     CDS             complement(join(208765..208869,208936..209148,
                     209292..209342,209401..209571,209641..209792,
                     209853..210006,210081..210106,210186..210640,
                     210708..211054,211115..211300))
                     /locus_tag="CNI00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572739.1"
                     /db_xref="GI:58271166"
                     /db_xref="GeneID:3259460"
                     /translation="MEIGGGTMVRGAGNEGWAMERTTVQKGQTDPSPLNGTSLSPSDF
                     LGDGTSRMGISPGDPLNFSTTDFSFLNEFIPFVSPPSLSNAQASTSPNNPTSISNSTS
                     NNTVLPLNAVASASASSSKHAPLPQFGNFSKSLLLNRRKIKVGGSELLGQSDGTRTPS
                     VPPYAIHPRLQMVDSFLQAFAHDEALFEFGPSHRHRNLSNNTLTAGSIDVLSNAFPSP
                     TARTLFHHYFNTASRILITMGNIGPNPLLAVCTPLKLLDTNSAASAAIRMSMLSVGVA
                     HFTHETKDAVGKNELGRNWETQRKKLKEMGSKFKKAALSNITLAARAQNGPDQTCTLL
                     CIRDVISADPTWRDNLEFALYLIGKQGGPQAMLQGTGYSFTRRYLLENLATHDVFASF
                     ITGKEPAVLGNYDTWWFDSVETSQTRWEWESVERSFGISRAMVDLVARIAVLDSQKRR
                     LGVTLQGGIEEMWDVAQHFERESHCLLLELDIWGNSLNALPQHVRVTCGDYIYKYMAV
                     VFILADILEQPISTPRIVKCIDHILELLSEASAMRMSVMLIWPLLIAGVFALPEKRDK
                     VRGLFDAFQGDYCEDLEVARELMDEQWRGIDNGEGKQPWDKVMNKLGKYVLLI"
     gene            complement(212585..214351)
                     /locus_tag="CNI00850"
                     /db_xref="GeneID:3259434"
     mRNA            complement(join(212585..213078,213143..213788,
                     213846..213984,214047..214175,214254..214351))
                     /locus_tag="CNI00850"
                     /product="membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536657|gb|CF682498.1,gi|41539070|gb|CF684911.1,
                     gi|41539079|gb|CF684920.1"
                     /transcript_id="XM_572852.1"
                     /db_xref="GI:58271391"
                     /db_xref="GeneID:3259434"
     CDS             complement(join(212752..213078,213143..213788,
                     213846..213984,214047..214175,214254..214311))
                     /locus_tag="CNI00850"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="XP_572852.1"
                     /db_xref="GI:58271392"
                     /db_xref="GeneID:3259434"
                     /translation="MADAISGLGGGGQATPYTVNAATCASYCAVAVISLLGGPLASRM
                     GIKGMLIAGAATFAINGSAYYVNSKYGVQWYLIFGRFLYGAGFGFWYVAEAAIILSYP
                     EEGRRGKYLAIWVGSRNLGQLVGGSISLARNAKTAAAGAIATSTYLIFVAIEAIGFPI
                     SFLISPPHKVRRSDGVPIVLAAKKPWKYEFLDLYRAIISPRMLLLMPIGFYSYFYGGV
                     LSTYLTNYFSVRARALSSFIVPTGIIVFTGIYGKFFLDNKHWTQRRRAQIGFAIFMIP
                     SLASFGWLCANQAKFLNTSPKYDWNSAGWANAYVPFYIMQVCGYLCQTYIYWLISCFT
                     TDVGGNARNGGIFRCVEAVGQAVSYGINSNAKTRFIPLGINFGLAVLCIPSTYVIIQQ
                     VPHYRADDVNRPIPYGQEEGTGSVAEEIDDELKKDAELRK"
     gene            <215244..217124
                     /locus_tag="CNI00860"
                     /db_xref="GeneID:3259593"
     mRNA            join(<215244..215523,215584..215961,216017..216556,
                     216612..216701,216765..217124)
                     /locus_tag="CNI00860"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41570844|gb|CF716685.1"
                     /transcript_id="XM_572737.1"
                     /db_xref="GI:58271161"
                     /db_xref="GeneID:3259593"
     CDS             join(215244..215523,215584..215961,216017..216556,
                     216612..216701,216765..217027)
                     /locus_tag="CNI00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572737.1"
                     /db_xref="GI:58271162"
                     /db_xref="GeneID:3259593"
                     /translation="MTVSPTYPNQEDRLLPVQNRTESFWLSERDPLLQNAHTTPELPR
                     SADVVIVGSGLTGAMMSYHVYENARKAGRDIKIVMLEADEFCGGATARNGGHCKPMTI
                     FGYRAEAAKHGPKIANQLLTFEAAALQQYAAIVKKEDIDCDMHVTRAFDVCFRKEDAE
                     AGKKDYEARKAAWGEDMAKHDLRVVEDPKELEALTGVRGGYWGASYPAGHLWPYKLAS
                     ALTHIGLSRGLNFQTHTPALSLERSPSQPSQWVVTTPRGSITTTSVVVATNAYTSGFL
                     PEFKSLIFPVRGTACSITPAPSHSHGSIPGPIKYTFGFRHGPGEVDYMIPRQGRGRIP
                     GSGDRSLILGGAKGCFLSNIDQWYDNKNDNEHMPGAQKYFEGFMKKYFVGWNGNKHGN
                     VDRVWSGILGYSSDLLPYVGEVPNKPGVFICAGFTGHGMPRIPGCTAALSSLAFSYLS
                     NGTTTPDANKAFQDALPQPYWLTKERFESKINLIKAAMGQRDKAKLDTTNQADEAILA
                     AKMGDAKL"
     gene            complement(<217514..>218426)
                     /locus_tag="CNI00870"
                     /db_xref="GeneID:3259472"
     mRNA            complement(join(<217514..217683,217743..218267,
                     218411..>218426))
                     /locus_tag="CNI00870"
                     /product="haloacid dehalogenase, putative"
                     /transcript_id="XM_572850.1"
                     /db_xref="GI:58271387"
                     /db_xref="GeneID:3259472"
     CDS             complement(join(217514..217683,217743..218267,
                     218411..218426))
                     /locus_tag="CNI00870"
                     /codon_start=1
                     /product="haloacid dehalogenase"
                     /protein_id="XP_572850.1"
                     /db_xref="GI:58271388"
                     /db_xref="GeneID:3259472"
                     /translation="MPSVVFSYDNGAEALQARLGPKLAKYGIPSKLLFYSWVCSTERD
                     YSYLSQIKQYKAFFAILSNTLTRVLFQAGVPVEALDDFFTADDVDYIMNEYKKLKARP
                     GLAEMMQTLRDGGFEVWCCSDANVDRVKGYFDNAGVEMPLDHILSADMVKAGKPEAAV
                     YKFAREKAGSDQPGEVSVFAASHAWDCAAAKAAGFLTAYTTTYEYDECEVIFGKSDLV
                     APDLVSLGKGIVEKWGKK"
     gene            219066..220892
                     /locus_tag="CNI00880"
                     /db_xref="GeneID:3259375"
     mRNA            join(219066..219267,219332..219635,219694..219764,
                     219816..220068,220117..220283,220337..220522,
                     220581..220892)
                     /locus_tag="CNI00880"
                     /product="ornithine-oxo-acid aminotransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558789|gb|CF704630.1,gi|41558799|gb|CF704640.1"
                     /transcript_id="XM_572817.1"
                     /db_xref="GI:58271321"
                     /db_xref="GeneID:3259375"
     CDS             join(219082..219267,219332..219635,219694..219764,
                     219816..220068,220117..220283,220337..220522,
                     220581..220844)
                     /locus_tag="CNI00880"
                     /codon_start=1
                     /product="ornithine-oxo-acid aminotransferase"
                     /protein_id="XP_572817.1"
                     /db_xref="GI:58271322"
                     /db_xref="GeneID:3259375"
                     /translation="MPSFEPAVSSHIAPLPSASKPLPLTTSTEGLQALADKHITKGLG
                     RLRDHVFKEGKGLRVLTTENQKLLDFTSGIGVTSLGHAHPDVTAAIISQAQSIIHVQC
                     AIGLSEPYVQLVESLLTMMPDPSLDSFFFWNSGSEAIEAAIKVSRTKTKRNNIVVMQG
                     GYHGRTSGAAALTRSKTSFFRGTGPLMPCVYTTPFPYWHAMGLPKDTPEEVLIEQAIL
                     GIENLLQQQTAPEDTAAIFLEPVIGEGGYIPAPTAYVKHLRKLCDKYGIMLVIDEIQT
                     GFGRTGKTFAIEHTGVTPDIMVYAKGFANGMPISGIVTRKEIMDVMAPGSLGGTYSGN
                     VVACAAALATTRYMRTHDILGNVQARSEQLFKGLREIQEDEANGGWMIEEVRGKGLMI
                     AIEFKDPNSKLTSSHNRGDISLPGNLNKLVQDACYDRGLLVLTTSIYPVLRLIPALVL
                     SEEEVDEALKIIKESVKEVASVIEGN"
     gene            complement(221216..222853)
                     /locus_tag="CNI00890"
                     /db_xref="GeneID:3259775"
     mRNA            complement(join(221216..221548,221605..221681,
                     221740..221820,221872..222311,222361..222462,
                     222516..222853))
                     /locus_tag="CNI00890"
                     /product="tartrate dehydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543055|gb|CF688896.1,gi|41543061|gb|CF688902.1,
                     gi|41548734|gb|CF694575.1,gi|41548740|gb|CF694581.1,
                     gi|41569026|gb|CF714867.1"
                     /transcript_id="XM_572848.1"
                     /db_xref="GI:58271383"
                     /db_xref="GeneID:3259775"
     CDS             complement(join(221218..221548,221605..221681,
                     221740..221820,221872..222311,222361..222462,
                     222516..222564))
                     /locus_tag="CNI00890"
                     /codon_start=1
                     /product="tartrate dehydrogenase"
                     /protein_id="XP_572848.1"
                     /db_xref="GI:58271384"
                     /db_xref="GeneID:3259775"
                     /translation="MPSNSRQHNIAVIPGDGIGIEVTASTLKVLRAVQKKVGGFELSF
                     DELDYGSARYKAQGSYTPAGWLDHLRKSDAIFFGAVGDPDVPDHISLWELILPMRQTF
                     QQYVNIRPSSILPGIPSRIVGTKPGDLDWIIVRENTEGEYAGQGGRTHVGTEWEVATE
                     LAVFTRKGVERVMRFAFETAQSRPKKFLTVVSKSNAQRYGLLLWDEVAEIVSKDFPDV
                     KWDKMLVDAMTVRMVAKPTSLDTIVTTNLHGDILSDLAAGLSGSIGIAHSASLDPTRT
                     SPSLFEPVHGAAFDIMGKDLANPIAAIMSAAEMLRWLGENEAADLVEKACKQSIADGQ
                     TTGDLGGKLKTSQVTEAVCKILETL"
     STS             222800..223059
                     /standard_name="AAC22"
                     /db_xref="UniSTS:470722"
     gene            223100..225202
                     /locus_tag="CNI00900"
                     /db_xref="GeneID:3259397"
     mRNA            join(223100..223214,223277..223438,223514..223725,
                     223776..223868,223935..224147,224206..224319,
                     224368..224461,224511..225068,225125..225202)
                     /locus_tag="CNI00900"
                     /product="succinate-semialdehyde dehydrogenase (NAD(P)+),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531458|gb|CF677299.1,gi|41532254|gb|CF678095.1,
                     gi|41534446|gb|CF680287.1,gi|41534453|gb|CF680294.1,
                     gi|41555475|gb|CF701316.1,gi|41555478|gb|CF701319.1,
                     gi|41561470|gb|CF707311.1,gi|41561474|gb|CF707315.1"
                     /transcript_id="XM_572819.1"
                     /db_xref="GI:58271325"
                     /db_xref="GeneID:3259397"
     CDS             join(223182..223214,223277..223438,223514..223725,
                     223776..223868,223935..224147,224206..224319,
                     224368..224461,224511..225068,225125..225148)
                     /locus_tag="CNI00900"
                     /codon_start=1
                     /product="succinate-semialdehyde dehydrogenase (NAD(P)+),
                     putative"
                     /protein_id="XP_572819.1"
                     /db_xref="GI:58271326"
                     /db_xref="GeneID:3259397"
                     /translation="MPSLTQTKDLASLLSDASHFKQKGYINGEWVSASDGATFPLYNP
                     ATGAKLADMPHMPRSQVAEAINAAKAAFPAWAALTAYQRQNYLLKLFKEMEEHSEDLA
                     IILCTENGKPLAESRVEISYGASFLTWNAAEALRTYGQTIPSPFPGTRNTVIKQPIGV
                     CGLITPWNFPNAMITRKMAPALAAGCTVVIKAPAETPLSALAMCVLCERVGIPPGVVN
                     VVTMDKGQREMAAGLELCENVKVSKISFTGSTPVGRLLMKQSSGTLKKLSFELGGNAA
                     FIIFDDADLDLAVNGVILSKFRAAGQTCICANRIFVHSKIYDDFARRLVERVKAFKVG
                     NGIEEGVTIGPLVSQRGVEKVERHVQDAVGLGAKVLVGGKRIDKGEGSCFYEPTVLVD
                     VPRQCAVSNEETFGPLAPLFKFDDEDDVVERANSSEVGLAAYFFTKDLARTHRVAEKL
                     EVGMVAVNTGAIAQSCVPFGGVKQSGFGREGGPSGIDEFMVEKLITIGGL"
     gene            225592..>227991
                     /locus_tag="CNI00910"
                     /db_xref="GeneID:3259688"
     mRNA            join(225592..226363,226418..226915,226970..227229,
                     227285..227809,227863..>227991)
                     /locus_tag="CNI00910"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41558537|gb|CF704378.1,gi|41558544|gb|CF704385.1"
                     /transcript_id="XM_572821.1"
                     /db_xref="GI:58271329"
                     /db_xref="GeneID:3259688"
     CDS             join(225634..226363,226418..226915,226970..227229,
                     227285..227809,227863..227991)
                     /locus_tag="CNI00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572821.1"
                     /db_xref="GI:58271330"
                     /db_xref="GeneID:3259688"
                     /translation="MTSSKPLHQLPFAARTLQSSVPQLPLSSQPSAQRRSTIFKSSTP
                     GIWARVNPMWAPWPIRVSKEEAEDLGINVEKGEKIDAEDIMKSWEPCEVLEQGAENGL
                     DVKSSKRRVKLDPVILGISPSALKDSLPHLDVGDLLEICKTGEQPTSGDPAREIFIDV
                     LSGRKILASDSYGPWATRYSGHQFGGWAGQLGDGRAVSVLETESEQGGRQEIQLKGAG
                     RTPFSRADDGLAHLRSGVREFLGCEAVAALGIPTTRALTLLTIPLPYLPVFREGTIHP
                     SSLLTRVAPSFIRVGHFEALNPPSSAAGGKQFFVGGGGWVDDQTDEEGEDEGNGNFEG
                     LRDLGEWMKEIMEVKEGWKSWVDEVIKKNAEMVAKWQVYGYMNGVINTDNVTLMGITI
                     DYGPYAFMDVFDQKHISNQSDPTGMYAYRNQVSRVQFALSKFIDSVSPLLGYESIHGD
                     IPKGWSEGKTKEDIKEWSEKGKEVMKGWEKSFEEYEEESEMNGWYQRFGLKTKQQFDQ
                     RDIKYDFLNYLQLHNLDFHTAFRGLCEFSPTKASQESGDKYIKEFVPHWVKSAVDESA
                     SDDSLKLVEGDFVQWFGMYAKRANLEDEKFAWGTTDDWEPARAANMRKKNPTFVLRQW
                     ILEELLGKMEEALTDPYKAAQSKDDVDKQKVEEGVRTARRELWKILEMATKPFENWGQ
                     GEGSREELEAQRRLCGVGAKEMFGYQCGCSS"
     gene            complement(228034..229558)
                     /locus_tag="CNI00920"
                     /db_xref="GeneID:3259395"
     mRNA            complement(join(228034..228126,228176..228744,
                     228796..229011,229061..229282,229338..229454,
                     229504..229558))
                     /locus_tag="CNI00920"
                     /product="small nuclear ribonucleoprotein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532126|gb|CF677967.1,gi|41532138|gb|CF677979.1,
                     gi|41551221|gb|CF697062.1,gi|41552780|gb|CF698621.1,
                     gi|41552788|gb|CF698629.1,gi|41556576|gb|CF702417.1,
                     gi|41556590|gb|CF702431.1"
                     /transcript_id="XM_572846.1"
                     /db_xref="GI:58271379"
                     /db_xref="GeneID:3259395"
     CDS             complement(join(228084..228126,228176..228744,
                     228796..229011,229061..229282,229338..229454,
                     229504..229542))
                     /locus_tag="CNI00920"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein"
                     /protein_id="XP_572846.1"
                     /db_xref="GI:58271380"
                     /db_xref="GeneID:3259395"
                     /translation="MGRLAEAQRRLLEQMMGPEAMGIQAVNLDWWNEKVCRNFLFGTC
                     LHTLFGNTKMDLGPCPKVHSDRILKQFREHAEANPNDPRLSAFRQEHENSLYSFVEDC
                     DRRIRASQRKLEKTPEENRKTVDLMREIGEIELSIQGGTEEIEALGEAGKVEESMEKL
                     AAVDALKAMKAEKEKDLQHLNENAGASGHQKLRVCETCGAMLSVLDSDKRLADHFGGK
                     LHLGYHELRKILSAFSEARMTGRPIPIIPPKSPRADGDEPLPFSAPAIPATAPAAPTG
                     PRSGLNPPMGPSGNEPHTPHHARVPPVEEMPVVGHGDKVKREAGELVEDLKEERAMEE
                     RDKERERYRERERDRDDRHDRNRYDDRDRDRYRDRDRERDSRYGGDRDRKKSYDRERS
                     RSPVKRRVL"
     repeat_region   228191..228279
                     /rpt_type=tandem
                     /rpt_unit_seq="tctctg"
                     /satellite="microsatellite"
     misc_feature    228290..228339
                     /note="CT-rich"
     gene            <230016..>230937
                     /locus_tag="CNI00930"
                     /db_xref="GeneID:3259438"
     mRNA            join(<230016..230109,230644..230703,230768..>230937)
                     /locus_tag="CNI00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_572735.1"
                     /db_xref="GI:58271157"
                     /db_xref="GeneID:3259438"
     CDS             join(230016..230109,230644..230703,230768..230937)
                     /locus_tag="CNI00930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572735.1"
                     /db_xref="GI:58271158"
                     /db_xref="GeneID:3259438"
                     /translation="MSDLLDETADGINTDSNGLTCIEPSAWDTILSVSNSGDSTCLEQ
                     WLVITVCITVCLLICALFTFTTLSIREIWLIRQSRRGKDKEEDEKEQLVDIADEVGVT
                     HKKTE"
     gene            <231584..>232075
                     /locus_tag="CNI00940"
                     /db_xref="GeneID:3259715"
     mRNA            join(<231584..231638,231788..231890,232012..>232075)
                     /locus_tag="CNI00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_572733.1"
                     /db_xref="GI:58271153"
                     /db_xref="GeneID:3259715"
     CDS             join(231584..231638,231788..231890,232012..232075)
                     /locus_tag="CNI00940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572733.1"
                     /db_xref="GI:58271154"
                     /db_xref="GeneID:3259715"
                     /translation="MGCRRHGMRLISAVTRKKKKNSLDRSSAIFSVSVLPCFTLNIKV
                     ANNTISLPCGNESKYNMPNMPMYIHTIQQ"
     gene            complement(<232397..>232977)
                     /locus_tag="CNI00950"
                     /db_xref="GeneID:3259462"
     mRNA            complement(join(<232397..232556,232619..232699,
                     232754..>232977))
                     /locus_tag="CNI00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_572731.1"
                     /db_xref="GI:58271149"
                     /db_xref="GeneID:3259462"
     CDS             complement(join(232397..232556,232619..232699,
                     232754..232977))
                     /locus_tag="CNI00950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572731.1"
                     /db_xref="GI:58271150"
                     /db_xref="GeneID:3259462"
                     /translation="MSLDHQHLPSPAPTPSAAPPNPAVGPAMTGAPPDQAAIRTAVEN
                     QLLQLSQDLYEMEISAGHVKENRETAVADYMENINKAFINLSNLAGQMTDSVPHQIIE
                     NVDRYKNPHVYTRQTITRATGENQYALGRVLGLEVSPFASCNMFGDMIADVK"
     gene            233175..235286
                     /locus_tag="CNI00960"
                     /db_xref="GeneID:3259563"
     mRNA            join(233175..233722,233781..234387,234441..234471,
                     234528..234540,234592..234658,234707..234952,
                     235011..235112,235164..235286)
                     /locus_tag="CNI00960"
                     /product="F-box domain-containing protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542304|gb|CF688145.1,gi|41542311|gb|CF688152.1,
                     gi|41545985|gb|CF691826.1,gi|41562612|gb|CF708453.1,
                     gi|41562622|gb|CF708463.1"
                     /transcript_id="XM_572729.1"
                     /db_xref="GI:58271145"
                     /db_xref="GeneID:3259563"
     CDS             join(233176..233722,233781..234387,234441..234471,
                     234528..234540,234592..234658,234707..234952,
                     235011..235112,235164..235191)
                     /locus_tag="CNI00960"
                     /codon_start=1
                     /product="F-box domain-containing protein"
                     /protein_id="XP_572729.1"
                     /db_xref="GI:58271146"
                     /db_xref="GeneID:3259563"
                     /translation="MFTQVSTPSTPSFPNTPDVVEEMEKLQMNPSQEPTSTSLQINDE
                     EELERFRAQWREELKAKKTGVTSGVNVGNVIWKSKGQGVEREHEDSNGHATLTSPKTS
                     RMAHTLPAFEDDDDVPRAGPSKAVPAMAIIKGANHSKTHSKKFRTDKERAVQTYAKAV
                     ESEQSGQLNEALILYRRAFKMDDDVDKLYTRSVAKATAQQVLEQQGTSENPLPAIPNS
                     ADIVQPSAPVEEPYSFQRHIQLHPDYVKSSAAPIASSKTSSKSALTAILDSLPIAPYE
                     FTFLPEDEDLPIPIASLPAELIDPILAHLDVIWVERFAATCWRARYLTQCSNVWRRLA
                     CRIYREPAILPPGGLTVKDLMQRHAGEWRTTLIEEERVRMDGCYIAVCHYIRPGAGDE
                     WIAITHLITYHRFLRFYPDGSVISFLTTDHPSEIVPVLRPSLRGKGLHFGRWRLIRSD
                     AIHNPEIDSEWVPSKSGEKRPARIIISDLLEPGVEKPKYEFEMELALRQTSRGRWNKL
                     DILEYRSINLTTGETLALSLKNQKPFFFSKVRSYNPPF"
     STS             234783..235573
                     /standard_name="Hind26"
                     /db_xref="UniSTS:470723"
     gene            complement(235197..241576)
                     /locus_tag="CNI00970"
                     /db_xref="GeneID:3259475"
     mRNA            complement(join(235197..235355,235418..236197,
                     236249..236314,236407..236523,236565..236636,
                     236683..236880,236929..237027,237068..237342,
                     237395..237518,237562..237603,237651..237797,
                     237825..237932,238130..238166,238214..238287,
                     238405..238507,238549..238660,238706..238790,
                     238897..238936,238984..239067,239121..239231,
                     239282..239429,239487..239574,239635..239800,
                     239849..240106,240150..240233,240282..240361,
                     240412..240628,240687..240754,240807..240929,
                     240984..241295,241349..241576))
                     /locus_tag="CNI00970"
                     /product="DNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530282|gb|CF676123.1,gi|41565802|gb|CF711643.1,
                     gi|41565805|gb|CF711646.1,gi|41571221|gb|CF717062.1,
                     gi|41571234|gb|CF717075.1,gi|41573965|gb|CF719806.1,
                     gi|41573972|gb|CF719813.1"
                     /transcript_id="XM_572727.1"
                     /db_xref="GI:58271141"
                     /db_xref="GeneID:3259475"
     CDS             complement(join(235288..235355,235418..236197,
                     236249..236314,236407..236523,236565..236636,
                     236683..236880,236929..237027,237068..237342,
                     237395..237518,237562..237603,237651..237797,
                     237825..237932,238130..238166,238214..238287,
                     238405..238507,238549..238660,238706..238790,
                     238897..238936,238984..239067,239121..239231,
                     239282..239429,239487..239574,239635..239800,
                     239849..240106,240150..240233,240282..240361,
                     240412..240628,240687..240754,240807..240929,
                     240984..241295,241349..241460))
                     /locus_tag="CNI00970"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="XP_572727.1"
                     /db_xref="GI:58271142"
                     /db_xref="GeneID:3259475"
                     /translation="MDFEEDQPLWDGSRQEEEDVYFGKFGYAEGYESPYHPNNSPTPR
                     YDIGLSSRSLNPGQNLTGFSASQFNPSRHTPFPLISDSHSLLTDLALNRSTRQFTPEN
                     SLARDHSAILQRQQSENYGDEIWEDEEFVEAVNESFNHEIDNAKEYDPVITAETIRSR
                     EELRNKAVFNKNGKPLVPLSRLPIDQRKLFKFPCFNNVQSEVFDDVYQSDENLVVSAP
                     TGSGKTTIFELAFLHNLSFRTPDDSLKPLAVYIAPTKALCNEKAKDWQERLSQALPDV
                     ICNEITGDYGNTSTIYNSIRTADLMVTTPEKFDSMTRRSRNLENMSQRLRLIMIDEVH
                     ILRESRGATLEVVISRLKGLGRGIRFVALSATVPNIDDIARWLGPTRNEYGQLSRGVL
                     VGREVISAKEKRAPAVDDMPMAKVYKFGEEYRPVPLQRETYGIESTGNDWALANRLDK
                     ELFPILLRHAAGQPVLVFCPTRKSCQATAESIFQSYEEARAKGLKLPWQHPPGVRLEL
                     QDKKLTELSTCGIAVHHAGLDYGDRRAIEDGFRDGKLHMIASTSTLAVGVNLPAHTVV
                     IKGVMAWQGASSGFQEYSDIDIQQMVGRAGRPQYDTSGVVVVMCERSKVRKYQSMLNS
                     QTVLESSDSLRSDINSEIGQGTIRSVSSAQEWLRNSFFHIRIQQNPKHYALSDAKDKP
                     VEGAWEEWLDHYVEKALINLEKDGFIERADDDTLIPTETGKIMSSSMIYVLDQGNVSW
                     IDRTRPVRDFGWIHRVPRLANQARREWLTFGNIILEDIAKKTELTSPIQTLMAIYNHA
                     PRIVKVLTSKEAIVQFTLNREYGIAARSALELHRVVVGKAWEDLPTIFRQIPSIGPKS
                     IRVLGQNGITNFDQLLDVESEKIQLWLNRGHDFARAIHEQARRMPRFHVTMEEENMDY
                     DGTYNVLNLRVNITPKAKVIATESRGKRGGFITQYNLSTLFLNQSGGFIGYRRLELKK
                     LIKNKDNSFIIAVTLSKRCDSVAAIVGVDEVAGCSTVIHYNTNLDDSVYPEDLEDDEN
                     VEEPPSQRTLVEPTPELEEELLPNGNVKCHHSCKDKLACQHVCCKSGVPPRKRNKAGA
                     RASGRSNVRTAADRIRETQYCVESPREELRPVGKAVRRIRQGSQMSRSPSPASNVQAA
                     NHKAAIVSEMQPNTRVAIEPRSRSTTPIVPPKAVKNENIASGQIKEPLFLPGSDDDYN
                     ARHHENDPSRKAIARSKAMSGSTSRYFDQPKTSGKAKNALSRKPPTMPVTSSASHPSI
                     LDLLPGQATIKNNSDANSHDLGPIHGNFSDDGYETVRESPEMKHSRVFPHSKPSIDWY
                     TEEIVQDDPEKSTEANKSHVVTNAQAPENWEFNIEEMFADISGSPSSPKQLEEEPKSV
                     LNINPSPSLKQPARLIIGGFGRPSIKRQRLHEDQHSSNYSLAQPFAQSDNPDILRANE
                     NGPTAQGPSASMPQNEMDEFEDWYMGEGG"
     gene            complement(241710..243678)
                     /locus_tag="CNI00980"
                     /db_xref="GeneID:3259713"
     mRNA            complement(join(241710..241950,242009..242184,
                     242234..242601,242640..243194,243254..243489,
                     243542..243678))
                     /locus_tag="CNI00980"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530288|gb|CF676129.1,gi|41533013|gb|CF678854.1,
                     gi|41533023|gb|CF678864.1,gi|41535126|gb|CF680967.1,
                     gi|41535130|gb|CF680971.1,gi|41537727|gb|CF683568.1,
                     gi|41537733|gb|CF683574.1,gi|41540703|gb|CF686544.1,
                     gi|41540713|gb|CF686554.1,gi|41542016|gb|CF687857.1,
                     gi|41542032|gb|CF687873.1,gi|41542400|gb|CF688241.1,
                     gi|41544749|gb|CF690590.1,gi|41544757|gb|CF690598.1,
                     gi|41549609|gb|CF695450.1,gi|41549618|gb|CF695459.1,
                     gi|41551353|gb|CF697194.1,gi|41551359|gb|CF697200.1,
                     gi|41553181|gb|CF699022.1,gi|41553184|gb|CF699025.1,
                     gi|41559612|gb|CF705453.1,gi|41563361|gb|CF709202.1,
                     gi|41563367|gb|CF709208.1,gi|41568089|gb|CF713930.1,
                     gi|41568108|gb|CF713949.1,gi|41574314|gb|CF720155.1,
                     gi|41574322|gb|CF720163.1"
                     /transcript_id="XM_572725.1"
                     /db_xref="GI:58271137"
                     /db_xref="GeneID:3259713"
     CDS             complement(join(241849..241950,242009..242184,
                     242234..242601,242640..243194,243254..243489,
                     243542..243646))
                     /locus_tag="CNI00980"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor"
                     /protein_id="XP_572725.1"
                     /db_xref="GI:58271138"
                     /db_xref="GeneID:3259713"
                     /translation="MALSLKDMRPLVVHCDTDYIRAGFAVGELFPRPSVTLRACYAIP
                     IASSNKAADANGDSRAADGDVDVPSKSGWLVGEELVGAQKENNWESSLELRWPFRPNK
                     VADDWEGREYIMSHLLALLGINIQTNSSALLLIPPPSPPTFTLSTQALYTQFAFESLN
                     TPMFSILPAPLSGLYALGATTGIMIYIGHEESSAFVITDSIVRWECSTSVQIGQADCE
                     SHFEQLLLEDDLLDQELKTATGNESLDLEEKRKLVKEVANFVWTECTGDDIEVPALNA
                     KAAIVIGAAQTSGEEDTFDVAKKLVGDPTPAPTTNSHKSKKQQAQALAAANKAAAQAA
                     ADAAAQAALPPSIDAIVVTIPSLPEKEIQLGPVRHRICEPLFKGKSIGGDTLYEAVGR
                     AVENDSLSTGEKLAIWEGVGVIGEVAKIKSFSPALVTYLSPYLLSSSELPSDCQPSKM
                     RLLSIPDYFANFKKTTTELAPFLGGTLVAKVAFTDSTGKHSVSKVDYNTKGPEAIYVV
                     TSEDR"
     gene            complement(244034..>245107)
                     /locus_tag="CNI00990"
                     /db_xref="GeneID:3259454"
     mRNA            complement(join(244034..244160,244214..244321,
                     244381..244442,244492..244515,244570..244946,
                     245004..245051,245102..>245107))
                     /locus_tag="CNI00990"
                     /product="expressed protein"
                     /transcript_id="XM_572844.1"
                     /db_xref="GI:58271375"
                     /db_xref="GeneID:3259454"
     CDS             complement(join(244108..244160,244214..244321,
                     244381..244442,244492..244515,244570..244946,
                     245004..245051,245102..245107))
                     /locus_tag="CNI00990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572844.1"
                     /db_xref="GI:58271376"
                     /db_xref="GeneID:3259454"
                     /translation="MGLLDKVTDKVTGHSHGKNSDNYDQSGNESYGSGGQGNNSFGAG
                     KDSYGSSGQGGDTYGSGGQPGGQSGGQSGGFGSSGNNSYGSSGQGGGTYGSGGQSHGS
                     SGLGSSGNDSYGSSGGDSYGSGGLSGGQPGGFGGNQSGGGLGGGNSGGFGGSGGNDSY
                     GSGGNAGGFGGGRGDDSYGSGGKPGGFAGGNNDAFGSGGNPGGLGGGGVRGSEQGGFG
                     GTGRSGY"
     gene            245948..248965
                     /locus_tag="CNI01000"
                     /db_xref="GeneID:3259446"
     mRNA            join(245948..246209,246269..246517,246568..246883,
                     246944..247353,247402..247453,247509..247667,
                     247725..248204,248254..248397,248446..248550,
                     248613..248898,248953..248965)
                     /locus_tag="CNI01000"
                     /product="DNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532862|gb|CF678703.1,gi|41533768|gb|CF679609.1,
                     gi|41533780|gb|CF679621.1,gi|41537231|gb|CF683072.1,
                     gi|41537238|gb|CF683079.1,gi|41539544|gb|CF685385.1,
                     gi|41540379|gb|CF686220.1,gi|41546072|gb|CF691913.1"
                     /transcript_id="XM_572723.1"
                     /db_xref="GI:58271133"
                     /db_xref="GeneID:3259446"
     CDS             join(245992..246209,246269..246517,246568..246883,
                     246944..247353,247402..247453,247509..247667,
                     247725..248204,248254..248397,248446..248550,
                     248613..248726)
                     /locus_tag="CNI01000"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="XP_572723.1"
                     /db_xref="GI:58271134"
                     /db_xref="GeneID:3259446"
                     /translation="MTLDILQPKPTPDASVQSFLNRHKQLLELERKAEEEQTRLLNSK
                     CSPSLLEQRGLALNGLGVSGISIGLGGKSLIELHRPLAYHTSPALPPHTFRPGDPVRI
                     EAHVATTSGKSKGKKRESEDEGAVEGVVYRVGPEKVVVAVNESKEIDLPERLRLLKLA
                     NSVTFDRMEKTLAHLERLVLPSGGTPSPPSFNMPLVQALLGKQLPTWKETIPPQNNIE
                     PLGQLSSDEDMKWFGQHLNDSQKESIKFCLKANEVACIHGPPGTGKTHTLVELIFQLL
                     SRPAAPNTTLPPRILITTPSNLALDNLLIRLHILAQQPPYSSLLPRNSFLRMGHPTRV
                     HRDLVKETLDWKAANGDQGELLKDVGKEMQGHLDALGKKRGEKGAVKGKERGKKWGEV
                     RELRKEYRQREGKVVKTVVNGAQIVLATCHSAGSRQLNNMIFDVCIIDEATQAVEAVC
                     WVPILKSKKLILAGDPQQLPPTIMSKENAPPLKDLQEAIDQIKLGDSPSLKSPRTLET
                     TLFERLEKLYGPGIKRVLQVQYRMNEHIAVFPSETLYESALISDASVAKRTLLELPSV
                     KDKTSEDVKDDLEPTVVFFDTADCEFYERTEGDGEATKSSIGEGSKSNENEAEIVARW
                     ARKLISLGIPPIEIGIVTPYQAQVTLISSLLHEEYPEMTIGSVDGLQGQEREAIILSL
                     VRSNPSGEVGFLGEYRRLNVAMTRAKRQLCVVGDSKTVSKGTKYLKKWMDWLEAEADV
                     RWAGEETV"
     gene            251935..254447
                     /locus_tag="CNI01010"
                     /db_xref="GeneID:3259618"
     mRNA            join(251935..252322,252372..252468,252507..252617,
                     252671..252926,253074..253783,253841..254097,
                     254152..254279,254336..254447)
                     /locus_tag="CNI01010"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547006|gb|CF692847.1,gi|41547015|gb|CF692856.1"
                     /transcript_id="XM_572956.1"
                     /db_xref="GI:58271599"
                     /db_xref="GeneID:3259618"
     CDS             join(252063..252322,252372..252468,252507..252617,
                     252671..252926,253074..253783,253841..254097,
                     254152..254279,254336..254382)
                     /locus_tag="CNI01010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572956.1"
                     /db_xref="GI:58271600"
                     /db_xref="GeneID:3259618"
                     /translation="MPPRPAPSSGPSTIEPANLSHFAIFNPNLETPAPTRKEGEDRDK
                     DDEDDQKEAAQILFYTSREAGGVSRDKMLRQVGLAKGLMGFADMLAKDNTKFWAIHSH
                     KSRLIVYTPEPDIYIYTCITLAYNADTKDPAPSSQSISDLMLVSALGRGYEDFRFLHG
                     PLSSHTPLTSASSSLIDRYFTRFAFNFESACLSSPSLSQWIAGFPPPSNNTIDQLLQY
                     FKGSNGITSDVYAVAKDGPLAIGRTLKRKKDETRKASWATLGGWAPDLRQVGVPSLGS
                     AKQKVSTTSEQVSIKDVKKPSSGNGSTVEKKDSWGFGWGAIGDAVGSVGTVFGLGTAQ
                     PVKTPADVSRATHGASETIVSSKPEDNLGLQTSTDEEDDGMEAKKVLSQISTPEIQGS
                     SDIIDSNDSKDHPADVPPAISLSSPTPDSHATSQVTIDENVRPVNVSIPELEDAAEPD
                     VEIDWDSRAAWIVCADGILERRIICWIIRDGIIIAIILPGESTPPFSLPSARSILSLV
                     ADVTQVTSATDVAASDCRQDEGAWIYKFDKDFMVSTGKMGTVEEQTLIDLRGTLKSTP
                     SISEVFAKTSSSHFVLAKQKTDKELYAVCETKDASLTDAEHSLRKLLRSHPEIKM"
     gene            complement(<254556..>255719)
                     /locus_tag="CNI01020"
                     /db_xref="GeneID:3259571"
     mRNA            complement(join(<254556..254620,254705..254972,
                     255064..255253,255323..255368,255429..255499,
                     255658..>255719))
                     /locus_tag="CNI01020"
                     /product="peroxisomal protein, putative"
                     /transcript_id="XM_572842.1"
                     /db_xref="GI:58271371"
                     /db_xref="GeneID:3259571"
     CDS             complement(join(254556..254620,254705..254972,
                     255064..255253,255323..255368,255429..255499,
                     255658..255719))
                     /locus_tag="CNI01020"
                     /codon_start=1
                     /product="peroxisomal protein"
                     /protein_id="XP_572842.1"
                     /db_xref="GI:58271372"
                     /db_xref="GeneID:3259571"
                     /translation="MDPYTISLRQNSLRQTRHHHHPANHDLLSVIKGARNGFVYGVKI
                     RFPHALVMTFLFSHKPWPAKIKGILTATRTHAINLCKFVTIYKLLLILQKKLNGGKER
                     DLDTFVAGGLGGWWVFGERTPINEQMVLYVLSRSLLSLLPRLYNTASPPKTPIEPLAH
                     PLPPLTSPQANPKPIPPAQLPFAVLAALSWASVMYMFRHRGERIQPGMANSMRYLYRD
                     SETWRDLRTLLWHNK"
     gene            256277..>257550
                     /locus_tag="CNI01030"
                     /db_xref="GeneID:3259619"
     mRNA            join(256277..256526,256577..>257550)
                     /locus_tag="CNI01030"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41566077|gb|CF711918.1"
                     /transcript_id="XM_572970.1"
                     /db_xref="GI:58271627"
                     /db_xref="GeneID:3259619"
     CDS             join(256496..256526,256577..257550)
                     /locus_tag="CNI01030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572970.1"
                     /db_xref="GI:58271628"
                     /db_xref="GeneID:3259619"
                     /translation="MALTESDGLMITLPSTLPITSSHSQETMTTPPTLTFANSKSLTT
                     PPLNRSLPNLGLADGSTTCAPGYILICIHHDPLSRYTLGINFTAFVGLCPTSPVTTST
                     ADCPAFPSSTPKFADHMRCHVIQRLLHTVMHDHLANMTDCHTWESLVNAVYDYCTWTM
                     ECILLGTDANVRFGVSCYPFLKELEEAARTLRRDSMGEWDDVVQIGVDRLLETLPCGE
                     WTLTKRRIEKERLPEFPKAQTQVKAKREARRPAAPSIPAPAVIPVPAPAPLIIKRKRY
                     SSLRTLMGRAGSVVGRQKMRAKASAVIEKGKVGFHDRQTVQRMEPVSSMSGPASLSCM
                     "
     gene            257779..259347
                     /locus_tag="CNI01040"
                     /db_xref="GeneID:3259718"
     mRNA            join(257779..258486,258542..259347)
                     /locus_tag="CNI01040"
                     /product="inositolphosphorylceramide synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535626|gb|CF681467.1,gi|41535640|gb|CF681481.1,
                     gi|41541362|gb|CF687203.1,gi|41541376|gb|CF687217.1,
                     gi|41551057|gb|CF696898.1,gi|41551069|gb|CF696910.1,
                     gi|41572497|gb|CF718338.1"
                     /transcript_id="XM_572823.1"
                     /db_xref="GI:58271333"
                     /db_xref="GeneID:3259718"
     CDS             join(257823..258486,258542..259263)
                     /locus_tag="CNI01040"
                     /codon_start=1
                     /product="inositolphosphorylceramide synthase"
                     /protein_id="XP_572823.1"
                     /db_xref="GI:58271334"
                     /db_xref="GeneID:3259718"
                     /translation="MSAIRTLANPVTACFSTSLSPRAAFHRFLHALSASIRRLDLSRD
                     PSKTLNRLKQHRFTLANTLPRAFMLLCASYSLYIMTTPPFPLKLGIPIAYVAAVILPI
                     TSQFVWPATPIFAWLITFFSARFIPSGRRPEIHVALLPALESVLYGANISDLQTRYTN
                     AFLDVVAWLPYGVLHFTLPFVVAVILWSLGPRGAVQFWGLAFGWMNLLGVVCQLLFPA
                     AAPWYEIIHGLTPADYSMAGSPGGLMRIDRVFHSSGYTNAFGSAPLVFGAFPSLHSGC
                     AVMEALFLSHFFPSLKGLYWGYVGVLWWATMYLSHHYLIDLVGGACLSVLVFYLCMPE
                     GFKDVDQIQWEAVEGDGYEMIGGPRTGTGPDIDLDEEIRKLEEQGEALFEQAIGDEES
                     RIETKGEGNTGAGGNVSGNESGDSADSGKKKGKGKQTAKKPKMKEPRSVSWGETKVMG
                     EGAQVVSEDSS"
     gene            complement(259390..>260068)
                     /locus_tag="CNI01050"
                     /db_xref="GeneID:3259394"
     mRNA            complement(join(259390..259771,259877..>260068))
                     /locus_tag="CNI01050"
                     /product="30S ribosomal protein S18, putative"
                     /transcript_id="XM_572840.1"
                     /db_xref="GI:58271367"
                     /db_xref="GeneID:3259394"
     CDS             complement(join(259439..259771,259877..260068))
                     /locus_tag="CNI01050"
                     /codon_start=1
                     /product="30S ribosomal protein S18"
                     /protein_id="XP_572840.1"
                     /db_xref="GI:58271368"
                     /db_xref="GeneID:3259394"
                     /translation="MSFSRLPRLTSVVRALHTSASTRRPAANPTEIFQKAFGERAATQ
                     TSPLMKNEVQDNREQFKANQFAAPQAFTQESIFPTARPFPRPPLLGPPKKIAVKLDPF
                     YITKTNPLVHDMNPNFAYEFVNPMGKIKSRAETGLTWKSQRRVGKLVRRARAMGIISR
                     WTNRPVPGGLGWSY"
     gene            260264..263291
                     /locus_tag="CNI01060"
                     /db_xref="GeneID:3259629"
     mRNA            join(260264..260460,260516..260562,260620..260669,
                     260726..260840,260916..261271,261339..261702,
                     261761..261840,261897..262077,262145..262549,
                     262610..262972,263032..263291)
                     /locus_tag="CNI01060"
                     /product="ribonucleases P/MRP protein subunit, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546103|gb|CF691944.1,gi|41546109|gb|CF691950.1,
                     gi|41555502|gb|CF701343.1,gi|41555508|gb|CF701349.1"
                     /transcript_id="XM_572825.1"
                     /db_xref="GI:58271337"
                     /db_xref="GeneID:3259629"
     CDS             join(260298..260460,260516..260562,260620..260669,
                     260726..260840,260916..261271,261339..261702,
                     261761..261840,261897..262077,262145..262549,
                     262610..262972,263032..263271)
                     /locus_tag="CNI01060"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit"
                     /protein_id="XP_572825.1"
                     /db_xref="GI:58271338"
                     /db_xref="GeneID:3259629"
                     /translation="MSKPQGKAGPSKPYGRPQKPIHKTIDLLKKNQAAAAKGKGKENE
                     VLGDVMSLVDEVKRLPGMISVEKFAQTRAMEIHAFQTAIKTAAAQGSTRAFQSLPRHL
                     RRRAASHNPRRVPKRLRSRAAAEIDAGDSIAKKHRKIAKLRAKGNLRDRLSRTAIFRI
                     RQRSKRWLPTHIWHAKRYHMANIWGWRLPITPTLKSFRPAYRAGKRKAIAWDVSYYGV
                     IEVEGMKEEIVKLLTGMTFGKFAGAKFENGARVAEVLVYQPESFPRGLIGPAEILWQP
                     LAQNKSPLNDARRIWIRAHPSIFDQVFSTLKAVSGNILAEKSLSKRVRALQIRDLRGE
                     LESFEIMGPKSGEVLRRVLRLCKSEKGVKSKFFDALGDPAEVPSGTIAGLNVHDPRLH
                     FPPPRIQEHEERLSNDGILRSNDTLPSSELAQSALWDPTARELASEVMYTKYQLDARR
                     HKLGMPGTRLHPTSSDNRIPFILFHRSTRPPLSSTPESFHGFTLLFPSSWAQYLLTSI
                     AYTGTLIGGLNERKVQHREAGTPSFPEHFGQVCVAGGKWEESKAEEAEGRWKRKPPAK
                     RVAFDKLGTSRPWIPDWSTLMGQGVTTLEETALNGEPSTHPYLLPHPFTTRLDASLTP
                     SKLLMNINTFRSQRGLSALPSARQNELFREAVLHVELNVVGRGSPGDMAVICGLTEEE
                     RKAWIGAYEGKSDEFGSAGETSELQRLGEARAPEKNLIGYTSTGNISLSRGKGHALGM
                     ITLAGYLDLLKAAAGEVKGSEWDGKALVCVRNRDGTVARFAEVRVAC"
     STS             262072..263409
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     gene            <264329..270051
                     /locus_tag="CNI01070"
                     /db_xref="GeneID:3259786"
     mRNA            join(<264329..264397,264455..264824,264878..265147,
                     265206..265664,265717..265746,265786..266036,
                     266108..266425,266492..266600,266653..266691,
                     266740..266931,266988..267078,267134..267503,
                     267565..267647,267697..267770,267821..268854,
                     268907..269033,269088..269383,269443..269600,
                     269652..269724,269775..270051)
                     /locus_tag="CNI01070"
                     /product="transcription regulator, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41575739|gb|CF721580.1,gi|41575748|gb|CF721589.1"
                     /transcript_id="XM_572827.1"
                     /db_xref="GI:58271341"
                     /db_xref="GeneID:3259786"
     CDS             join(264329..264397,264455..264824,264878..265147,
                     265206..265664,265717..265746,265786..266036,
                     266108..266425,266492..266600,266653..266691,
                     266740..266931,266988..267078,267134..267503,
                     267565..267647,267697..267770,267821..268854,
                     268907..269033,269088..269383,269443..269600,
                     269652..269724,269775..269921)
                     /locus_tag="CNI01070"
                     /codon_start=1
                     /product="transcription regulator"
                     /protein_id="XP_572827.1"
                     /db_xref="GI:58271342"
                     /db_xref="GeneID:3259786"
                     /translation="MLASDTQTGVGISASSSVISSQSPSSKPSSTHRITLRMPQQPES
                     TADLDSESESLTPSPEEINIGQGIGEEVSDQERAGDDESEGEAEQDDFNYDEEEEEDY
                     DEDELMEEGDDDDDDDDPNFGERKKKAKKARVKMDSDRPVKQKKSAGAFPMRKQVDES
                     SDEDYGTKAHKKKYFSKTGVSRKATPGTPYSEDNAFRRGAAKRVVTYNEADVDYGLES
                     EDEAGDTGYHYTAGAPAEAEPADEIDQVMFHWRDENHKDDPKDIPQVNLVSGVGMLCL
                     TLLIIDLQRFHIKWKDYSHIHNTDETYAFLKNYKGFKKVENYITKVWTIDQRYHHPEP
                     DAAWKPTQEEMEQYEIDKERIKELQESYKIVERVLDEKEEKRKEGRATLFFVKWTNLQ
                     YSDCTWETYEDVMECQGAKEGIEEFHQRQARTTIPARSISYGIDNRPTYQKIPENPPY
                     LACGGALKPFQLTGLNWLAYVWSKGENGILADEMGLGKTVQSVSFLSYLFHVQHQYGP
                     FLVVVPLSTISAWQAQFKRWAPELNVICYMGSARSRDVIRQFEFGPLKNLKFNVLLTT
                     YEFILKDRQDLQQIKWQVLAVDEAHRLKNHESQLYEALKSFWSASKLLITGTPLQNNV
                     KELLALMHFLMPEKFQLANDFDLNDASEDQGAKIKDLHDKLTTLMLRRLKKDVVKELP
                     TKSERILRVEMSAMQTHYYKNILTKNFAVLSKGGTQQVSLMNVAMELKKASNHPYLFE
                     GAEDRSKPANEILRGLVMNSGKMVCLDMLLSRLKSDGHRVLIFSQMVRLLDIISDYMT
                     ARGYVHQRLDGTVPSDVRKKSIEHFNAPGSPDFAFLLSTRAGGLGINLETADTVIIFD
                     SDYNPQNDLQAMARAHRIGQQRHVSIFRLVSKGTIEEDILERAMRKMLLEYAIINKMD
                     TTGAHINGSSTPKDKNVDLSKEELSAILKFGARNMFKTDDSTQNKKLDEMNLDDILNN
                     ADAFDTESAAAPGTTSLGGEGFLSQFAAIQDVKADVDNLSWDEIIPEDERGKAEEEEN
                     AAATAEIVAASSRKRAAAKAPGTYQDMDLDDHDGSSKPGSPNDKKPKAPGQLKKTPAQ
                     RALELKDRDLRVLIRGIQKWGDIRSRYEPIVKEAKLENKNRVVIIQTCEDIITHGEQT
                     IAAHKAHIRDLQERGEPISSSLRQKAILFTYKGVASINAETVVARYYELKALVEHFKR
                     VEDFPSYTIPHDSLKPTMNWTVEWTAREDSQLLVGIWKHGFGSWEAIAHDPELHLNDK
                     IFLEDPKAAKLDPNAPKPGVPGPVHLQRRGDYLCGIIREYEENRRILVEQQAMIASLP
                     AKEGFGFEHPPLPSIAGPSKKPSPSIASSSKDRDSGKGKRRKTPEYTDSEDESSYESM
                     DEDAVKELLRPAKKHLKKLKSGTENLSREEKIVALKECLAGIGARIDEVVAEKAAEGQ
                     NATKWRKHCWVFASFFWPRQGVNYSKLMEIHGKMVNESGPTTSKSKAKPKRKTEDDPS
                     KPNKKPRLSDSQKEIKVEGSSGEQL"
     repeat_region   264623..264742
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            270206..272472
                     /locus_tag="CNI01080"
                     /db_xref="GeneID:3259486"
     mRNA            join(270206..271076,271134..271185,271235..271642,
                     271693..271779,271825..271850,271907..272002,
                     272058..272247,272307..272470)
                     /locus_tag="CNI01080"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531102|gb|CF676943.1,gi|41531104|gb|CF676945.1,
                     gi|41535900|gb|CF681741.1,gi|41539494|gb|CF685335.1,
                     gi|41539504|gb|CF685345.1,gi|41540593|gb|CF686434.1,
                     gi|41540606|gb|CF686447.1,gi|41542139|gb|CF687980.1,
                     gi|41542146|gb|CF687987.1,gi|41543322|gb|CF689163.1,
                     gi|41543326|gb|CF689167.1,gi|41543934|gb|CF689775.1,
                     gi|41543942|gb|CF689783.1,gi|41544053|gb|CF689894.1,
                     gi|41552933|gb|CF698774.1,gi|41552948|gb|CF698789.1,
                     gi|41562673|gb|CF708514.1,gi|41562683|gb|CF708524.1,
                     gi|41564191|gb|CF710032.1,gi|41574410|gb|CF720251.1,
                     gi|41574421|gb|CF720262.1"
                     /transcript_id="XM_572720.1"
                     /db_xref="GI:58271127"
                     /db_xref="GeneID:3259486"
     mRNA            join(270211..271076,271134..271191,271235..271642,
                     271693..271850,271907..272002,272058..272247,
                     272307..272472)
                     /locus_tag="CNI01080"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41564181|gb|CF710022.1"
                     /transcript_id="XM_572721.1"
                     /db_xref="GI:58271129"
                     /db_xref="GeneID:3259486"
     mRNA            join(270211..271076,271134..271191,271235..271642,
                     271693..271779,271941..272002,272058..272247,
                     272307..272469)
                     /locus_tag="CNI01080"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544043|gb|CF689884.1"
                     /transcript_id="XM_572719.1"
                     /db_xref="GI:58271125"
                     /db_xref="GeneID:3259486"
     CDS             join(270316..271076,271134..271191,271235..271642,
                     271693..271850,271907..272002,272058..272247,
                     272307..272315)
                     /locus_tag="CNI01080"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase"
                     /protein_id="XP_572721.1"
                     /db_xref="GI:58271130"
                     /db_xref="GeneID:3259486"
                     /translation="MARFPFFRILLRGNTPAKLLLLFFAVVFFFAFPFSSRPTSIFAD
                     PALREKAEVAPLSELASVYDQVRLDILDARRFNGSHAAEKLRAPKTLPDGTLNFDPDL
                     ETYVARLRGFVNNYLRSAPAHIQIAGSNTLTTLVRRLPAKHRDGDFPSKVWATHPRGM
                     DGVESGFELWGELLPFPLPPSLANQLSPNHEVEFLKPARVGKDWDVEVLDDDALDSAM
                     SEWTGEDIGRGITGEGKWSQLWGKLDKGVLRADLFRYVSMLVEGGIYSDSDTMVRPIS
                     HPYVWGLHAPSILDQDLEVLNDLMVSSLLPKFPTHNRPPRVDSRSIVDSDNSTYVPPY
                     PGLRLTRRAPVYTVENPNPSSILNPSISMVVAIEWDSQIGRTLGMWKQWTWFRATRSW
                     KDCCFPRGLQMVQNLLVSKPFHPIMMDIVATIAQLVETGLYEKLSPVSLLDYSVECTD
                     LRQLELTGPGPFTDAVFRYLLVQYGVTPDELRALRGPVRVGDILILQEEACHAPRKAI
                     QRLKAFVDSLHLKLGTNRHGRFSPWLFGLGYKDWKSGGVKVAYHGLTGIWK"
     CDS             join(270316..271076,271134..271191,271235..271642,
                     271693..271779,271941..272002,272058..272247,
                     272307..272315)
                     /locus_tag="CNI01080"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase"
                     /protein_id="XP_572719.1"
                     /db_xref="GI:58271126"
                     /db_xref="GeneID:3259486"
                     /translation="MARFPFFRILLRGNTPAKLLLLFFAVVFFFAFPFSSRPTSIFAD
                     PALREKAEVAPLSELASVYDQVRLDILDARRFNGSHAAEKLRAPKTLPDGTLNFDPDL
                     ETYVARLRGFVNNYLRSAPAHIQIAGSNTLTTLVRRLPAKHRDGDFPSKVWATHPRGM
                     DGVESGFELWGELLPFPLPPSLANQLSPNHEVEFLKPARVGKDWDVEVLDDDALDSAM
                     SEWTGEDIGRGITGEGKWSQLWGKLDKGVLRADLFRYVSMLVEGGIYSDSDTMVRPIS
                     HPYVWGLHAPSILDQDLEVLNDLMVSSLLPKFPTHNRPPRVDSRSIVDSDNSTYVPPY
                     PGLRLTRRAPVYTVENPNPSSILNPSISMVVAIEWDSQIGRTLGMWKQWTWFRATRSW
                     KDCCFPRGLQMVQNLLVSKPFHPIMMDIVATIAQLVETGLYEKLSPYGVTPDELRALR
                     GPVRVGDILILQEEACHAPRKAIQRLKAFVDSLHLKLGTNRHGRFSPWLFGLGYKDWK
                     SGGVKVAYHGLTGIWK"
     CDS             join(270316..271076,271134..271185,271235..271642,
                     271693..271779,271825..271850,271907..272002,
                     272058..272247,272307..272315)
                     /locus_tag="CNI01080"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase"
                     /protein_id="XP_572720.1"
                     /db_xref="GI:58271128"
                     /db_xref="GeneID:3259486"
                     /translation="MARFPFFRILLRGNTPAKLLLLFFAVVFFFAFPFSSRPTSIFAD
                     PALREKAEVAPLSELASVYDQVRLDILDARRFNGSHAAEKLRAPKTLPDGTLNFDPDL
                     ETYVARLRGFVNNYLRSAPAHIQIAGSNTLTTLVRRLPAKHRDGDFPSKVWATHPRGM
                     DGVESGFELWGELLPFPLPPSLANQLSPNHEVEFLKPARVGKDWDVEVLDDDALDSAM
                     SEWTGEDIGRGITGEGKWSQLWGKLDKGVLRADLFRYVSMLVEGGIYSDSDTMPISHP
                     YVWGLHAPSILDQDLEVLNDLMVSSLLPKFPTHNRPPRVDSRSIVDSDNSTYVPPYPG
                     LRLTRRAPVYTVENPNPSSILNPSISMVVAIEWDSQIGRTLGMWKQWTWFRATRSWKD
                     CCFPRGLQMVQNLLVSKPFHPIMMDIVATIAQLVETGLYEKLSPLELTGPGPFTDAVF
                     RYLLVQYGVTPDELRALRGPVRVGDILILQEEACHAPRKAIQRLKAFVDSLHLKLGTN
                     RHGRFSPWLFGLGYKDWKSGGVKVAYHGLTGIWK"
     gene            272779..273885
                     /locus_tag="CNI01090"
                     /db_xref="GeneID:3259668"
     mRNA            join(272779..272857,273176..273260,273319..273525,
                     273580..273885)
                     /locus_tag="CNI01090"
                     /product="60S ribosomal protein L19, putative"
                     /transcript_id="XM_572717.1"
                     /db_xref="GI:58271121"
                     /db_xref="GeneID:3259668"
     CDS             join(272794..272857,273176..273260,273319..273525,
                     273580..273808)
                     /locus_tag="CNI01090"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="XP_572717.1"
                     /db_xref="GI:58271122"
                     /db_xref="GeneID:3259668"
                     /translation="MVNLRQQKRLAASVAGVGQRKIWLDPQEAAEIGQANSRSGVRKL
                     LKDGHIIVKPTVIHSRARAREHAAAKRAGRHTGFGKRKGTAEARMPTKVQWLRRMRVL
                     RRLLKKYREAGKIDKHMYHTLYLEAKGNRFKNKRVLMEHIHREKAEKLRTKHLAEQQE
                     ARRVKNKAMRERRANRLAEKRQGIHEVEQEEAKE"
     gene            <274097..>275645
                     /locus_tag="CNI01100"
                     /db_xref="GeneID:3259590"
     mRNA            join(<274097..274321,274430..274586,274630..274674,
                     274731..274856,274915..275002,275062..275129,
                     275186..275386,275443..275498,275565..>275645)
                     /locus_tag="CNI01100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572715.1"
                     /db_xref="GI:58271117"
                     /db_xref="GeneID:3259590"
     CDS             join(274097..274321,274430..274586,274630..274674,
                     274731..274856,274915..275002,275062..275129,
                     275186..275386,275443..275498,275565..275645)
                     /locus_tag="CNI01100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572715.1"
                     /db_xref="GI:58271118"
                     /db_xref="GeneID:3259590"
                     /translation="MRPALRVLPRLRLFRALPVRTYATLNPHTPPPTSPYQVFDEPSK
                     DLQRSRAIIRLRELQAQSGNEPAEGEDELRVDLRVPPSSILEISSHAGQLTQVLQEVL
                     ADEVPTGTEQSEIEGRRKWWIVDSSRVGEALWRDDDSYFITPPTRIQASASDFLNHPE
                     IGPLKEQVEAVVSAAGLHWVGDIVGGLTQIRHLLKPDGVFVAAVFGGDTIFELRTSLQ
                     LAEQERRGGIANRISPMISSTDAPSLLNRAGFTSITVDVEDIIINYPSMWELIADLRD
                     MGESNAILGRRAAVGRDVLTAASSIYQEMYGNEDGSIPATFSIIFLIGWKPGPNQPQP
                     SKRGSGQANLKDVL"
     gene            complement(<276284..>276870)
                     /locus_tag="CNI01110"
                     /db_xref="GeneID:3259376"
     mRNA            complement(join(<276284..276304,276439..>276870))
                     /locus_tag="CNI01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_572713.1"
                     /db_xref="GI:58271113"
                     /db_xref="GeneID:3259376"
     CDS             complement(join(276284..276304,276439..276870))
                     /locus_tag="CNI01110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572713.1"
                     /db_xref="GI:58271114"
                     /db_xref="GeneID:3259376"
                     /translation="MLLIVYLGYYILRRQEAERDRLKALAKAKPKSSNSSSSTGSSKN
                     KKPLSSSDVRDGKLAAPSNKQVGDPTPKHVSGLSKEDPSAQSFRKNYFLTMQGPGRPA
                     LVPFQDGLRPKKGEAAGTMWWDNVPEGKDGPSWSDQYVQQLTQKAEEA"
     gene            complement(277149..278207)
                     /locus_tag="CNI01120"
                     /db_xref="GeneID:3259642"
     mRNA            complement(join(277149..277349,277404..277499,
                     277557..277790,277961..278207))
                     /locus_tag="CNI01120"
                     /product="40S ribosomal protein S7, putative"
                     /transcript_id="XM_572711.1"
                     /db_xref="GI:58271109"
                     /db_xref="GeneID:3259642"
     CDS             complement(join(277325..277349,277404..277499,
                     277557..277790,277961..278205))
                     /locus_tag="CNI01120"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_572711.1"
                     /db_xref="GI:58271110"
                     /db_xref="GeneID:3259642"
                     /translation="MASINSKVLRSANAPQTAPSEIEQQIAQALLDLEANVPELKSEL
                     RQLAFSSAKEVDVKGGKKAVVIFVPVPMVKAFHKVQQRLTRELEKKLSDKFIVFLSQR
                     RVLPKQSRSSASSQKQKRPRSRTLTAVHEKILEELVFPSEIVGKRTRVAQDGSKLIRV
                     YLDSKDQNNLEYKLDTFSSVYRNLAGKDVVFEFPVVAQE"
     gene            278522..282287
                     /locus_tag="CNI01130"
                     /db_xref="GeneID:3259645"
     mRNA            join(278522..281072,281123..281196,281251..281550,
                     281600..282058,282113..282287)
                     /locus_tag="CNI01130"
                     /product="small nuclear ribonucleoprotein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531550|gb|CF677391.1,gi|41531556|gb|CF677397.1,
                     gi|41538996|gb|CF684837.1,gi|41538999|gb|CF684840.1,
                     gi|41565067|gb|CF710908.1,gi|41565073|gb|CF710914.1,
                     gi|41572544|gb|CF718385.1,gi|41572561|gb|CF718402.1,
                     gi|41572651|gb|CF718492.1,gi|41572658|gb|CF718499.1,
                     gi|41572858|gb|CF718699.1,gi|41572868|gb|CF718709.1"
                     /transcript_id="XM_572829.1"
                     /db_xref="GI:58271345"
                     /db_xref="GeneID:3259645"
     CDS             join(278560..281072,281123..281196,281251..281550,
                     281600..282058,282113..282231)
                     /locus_tag="CNI01130"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein"
                     /protein_id="XP_572829.1"
                     /db_xref="GI:58271346"
                     /db_xref="GeneID:3259645"
                     /translation="MSDEEYPQLQSYTAPQDILDEHAELADEDETPDAFQDKAKSKQV
                     AARQSDYHLRRFNRTDGQGEGEDESYEERMRRINLEKEEEKVRRYKEKMEKEEKERGE
                     MRVDDKTPPRELTGGDTPPRKALIGDETPPRAQAGDVTPPRKKRRWDTEPEVKQEVKE
                     EVKEEVKEEEPKKRRSRWDQTPAEAPPEKKRSRWDQTPAQTASSSVLAAPTNLAKPSG
                     IVLVEDKRYRRMTDEELDSLLPGSEEGYVVVPVPDDYHPAPSVRKMVPQQAEAGFMMQ
                     DETDAARARAAAGGLQGTTEQTEIDGIGTLQFLKPEDTQYFAKVLGEGGGEENDAEYT
                     VEELKERKIMRLLLKIKNGTPPVRKTALRQITDRAREFGAGPLFDKILPLLMERTLED
                     QERHLLVKVIDRVLYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAA
                     GLAHMISTMRPDIDHVDEYVRNTTARAFSVVASALGIPALLPFLRAVCRSKKSWQARH
                     TGIRIIQQIAIMSGCAVLPHLRNLVDAIADGLKDEQQKVRTMTALALAGLAEAAAPYG
                     IESFDNVLKPLWLGIRQHRGKTLAAFLKAIGYIIPLMDPEYAGYYVRECMPILIREFQ
                     TSDEEMRRIVLQVIKQCASTEGVTPSYIKEEVLPEFFKAFWVRRMALDKRNYKQLVET
                     TVELANKAGVAEIVGRTVNDLKDESEPFRKMVMETITKVVSNIGAADVDERLEVLLID
                     GIIYSFQEQTFEDTVMLDGFATVVASLGPRVKPYLPQIVSMILWRLTNKSAKVRMLAA
                     DLTTKLAPIIKSCKEDVLLSKLGVVIFEQLGEEYPDALGSLIAAEGAIANVVGMTEMN
                     PPVKDLLPRMTPILRNRHEKVQEATINLIGRIADRGAEYVPAKEWMRICFELLDLLKA
                     HKRAIRRAAVNSFGYIAKAIGPQDVLSVLLTNLKVQERQSRVCSTVAIAIVAETCGPF
                     TCIPAILNEYRTPELNVRNGCLKALAFVFEYVGEMSKDYIHSVVGLLEDALTDRDHVH
                     RQTACAIVKHLAIGVAGLGYEEALTHLLNLVWPNIFETSPHVIGGVMDAIEAMRLGIG
                     SGVVLSYVLQGLFHPARRVREVYWRMYNTLILGSSDAMVPFYPALGSESDLASGQDYT
                     RHQLMMWI"
     misc_feature    278796..278865
                     /locus_tag="CNI01130"
                     /note="GA-rich"
     gene            282576..283751
                     /locus_tag="CNI01140"
                     /db_xref="GeneID:3259464"
     mRNA            join(282576..282610,282678..282811,282871..283082,
                     283133..283227,283284..283414,283462..283751)
                     /locus_tag="CNI01140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572831.1"
                     /db_xref="GI:58271349"
                     /db_xref="GeneID:3259464"
     CDS             join(282601..282610,282678..282811,282871..283082,
                     283133..283227,283284..283414,283462..283665)
                     /locus_tag="CNI01140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572831.1"
                     /db_xref="GI:58271350"
                     /db_xref="GeneID:3259464"
                     /translation="MSKNSECCPPQSNSNPSKPNVPHPTSDPIGYKYKGEFQSVANYD
                     KVYVTGPDNAKHALVVIYDIFGFWDTTIKGSDTLVSHLASTFPTKVLMPDVFKGKPFP
                     ADKDGDKETLQKFFATTAKLDDRLPEVLDFAKELQKSYEKVSILGYCWGGKLTLLSLA
                     EGTPFNAGAVAHPAMIAPEDGEKLSVPLGFYPSHDEPKDVVEKIVNDFKSKPFGDKCG
                     YHLYDTVHHGWAAARANLNDPENVKQFDDVYKRLSEWFASVKA"
     gene            <284502..>284850
                     /locus_tag="CNI01150"
                     /db_xref="GeneID:3259433"
     mRNA            join(<284502..284520,284579..>284850)
                     /locus_tag="CNI01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_572709.1"
                     /db_xref="GI:58271105"
                     /db_xref="GeneID:3259433"
     CDS             join(284502..284520,284579..284850)
                     /locus_tag="CNI01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572709.1"
                     /db_xref="GI:58271106"
                     /db_xref="GeneID:3259433"
                     /translation="MTLDLDERRIPKTLPHVFDLETLAKHFQENPLPPGACKLIDLPG
                     DVFLDTEDDVNVVAAALWVLAVKYDNLPSEERPNHREASRKVGSPFKGARYD"
     gene            285562..288130
                     /locus_tag="CNI01160"
                     /db_xref="GeneID:3259708"
     mRNA            join(285562..285592,285678..285988,286046..286354,
                     286403..286887,286938..288130)
                     /locus_tag="CNI01160"
                     /product="polyadenylate-binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531221|gb|CF677062.1,gi|41531227|gb|CF677068.1,
                     gi|41533594|gb|CF679435.1,gi|41535670|gb|CF681511.1,
                     gi|41535684|gb|CF681525.1,gi|41537571|gb|CF683412.1,
                     gi|41537583|gb|CF683424.1,gi|41538251|gb|CF684092.1,
                     gi|41538258|gb|CF684099.1,gi|41539346|gb|CF685187.1,
                     gi|41539358|gb|CF685199.1,gi|41542037|gb|CF687878.1,
                     gi|41542043|gb|CF687884.1,gi|41542621|gb|CF688462.1,
                     gi|41542630|gb|CF688471.1,gi|41545250|gb|CF691091.1,
                     gi|41545263|gb|CF691104.1,gi|41547890|gb|CF693731.1,
                     gi|41547954|gb|CF693795.1,gi|41547965|gb|CF693806.1,
                     gi|41548143|gb|CF693984.1,gi|41553126|gb|CF698967.1,
                     gi|41553128|gb|CF698969.1,gi|41553539|gb|CF699380.1,
                     gi|41557021|gb|CF702862.1,gi|41558205|gb|CF704046.1,
                     gi|41558213|gb|CF704054.1,gi|41559270|gb|CF705111.1,
                     gi|41559276|gb|CF705117.1,gi|41560619|gb|CF706460.1,
                     gi|41560628|gb|CF706469.1,gi|41562604|gb|CF708445.1,
                     gi|41562613|gb|CF708454.1,gi|41563886|gb|CF709727.1,
                     gi|41564400|gb|CF710241.1,gi|41565645|gb|CF711486.1,
                     gi|41565660|gb|CF711501.1,gi|41566114|gb|CF711955.1,
                     gi|415"
                     /transcript_id="XM_572834.1"
                     /db_xref="GI:58271355"
                     /db_xref="GeneID:3259708"
     CDS             join(285768..285988,286046..286354,286403..286887,
                     286938..287944)
                     /locus_tag="CNI01160"
                     /codon_start=1
                     /product="polyadenylate-binding protein"
                     /protein_id="XP_572834.1"
                     /db_xref="GI:58271356"
                     /db_xref="GeneID:3259708"
                     /translation="MSAETATSPAPAAETPVAPAPATQTTPAEGAPTPAAAAPGGNTV
                     SASLYVGELDPSVTEAMLFEIFNMIGPVASIRVCRDAVTRRSLGYAYVNYLNAADGER
                     ALEHLNYSLIKGQSCRIMWSQRDPALRKTGQGNIFIKNLDQSIDNKALHDTFAAFGDI
                     LSCKVGTDENGKSRGFAFVHYSTGEAADAAIKAVNGMLLNDKKVYVGHHVGKKERLSK
                     VEELRAQFTNVYIKNVDLEVTDAEFEDLVKPFGPTISVALSRDEKGVSKGFGFVNYEN
                     HESARKAVDELNEKEVNGKKLYAGRAQTKSEREAELKKSHEEKRLENEAKSAGVNLYV
                     KNLDDEWDDDRLRAEFEAFGTITSSKVMRDDSGVSRGFGFVCYSSPDEATKAVSEMNG
                     KMIGTKPLYVALAQRKDVRRQALESQIAQRAQQRMQYGAGFPGMQGYMGQPMYGYPPM
                     PGYGQPMPGMPPVRGPMMGYPGAPQNMMQSRPRFNPNGQPLPGGVPAYGMPPQVPYPG
                     APGYPVRPGGARIPAAPNANGPRNGGPSPVGAPQGLPAGSIPRGGQMPARPHEQAAPA
                     PQAGRLDAQSLARAAPAEQKQMLGEALYPLIHETQPELAGKITGMLLEMDNAELLHLV
                     ESQPALQEKVDEALRVLAEWGKDEKPAADEGAEEPKKEEEETKEEEKKE"
     misc_feature    287901..287941
                     /locus_tag="CNI01160"
                     /note="GA-rich"
     gene            complement(288204..>289209)
                     /locus_tag="CNI01170"
                     /db_xref="GeneID:3259573"
     mRNA            complement(join(288204..288365,288463..288574,
                     288676..288955,289016..>289209))
                     /locus_tag="CNI01170"
                     /product="thiamine pyrophosphokinase, putative"
                     /transcript_id="XM_572707.1"
                     /db_xref="GI:58271101"
                     /db_xref="GeneID:3259573"
     CDS             complement(join(288262..288365,288463..288574,
                     288676..288955,289016..289209))
                     /locus_tag="CNI01170"
                     /codon_start=1
                     /product="thiamine pyrophosphokinase"
                     /protein_id="XP_572707.1"
                     /db_xref="GI:58271102"
                     /db_xref="GeneID:3259573"
                     /translation="MPPHFARTWTCEELLRGHATKKYALIIVNQPIRKDLLQRAWQAV
                     DIRLCADGGANRLFDVDHESQYLPDLIKGDLDSLRPDVQAHYASLKVPIKKDEDEYST
                     DLMKCIQEVPEDYALVLLGGLSGRVDQTVHTMSMLHKMDREIYVLDKESMAWVLRPGQ
                     HEIHIDHSTMGQTCGILPVGIDSAHVRTKGLKWDVGNLSTSNHLLPEEPVVWIETSRP
                     ILWTVEIRQIE"
     gene            289360..291552
                     /locus_tag="CNI01180"
                     /db_xref="GeneID:3259738"
     mRNA            join(289360..289445,289501..289540,289578..289605,
                     289644..289671,289712..289810,289850..290021,
                     290069..290145,290197..290259,290312..290795,
                     290856..291043,291113..291340,291395..291552)
                     /locus_tag="CNI01180"
                     /product="vacuolar ATP synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532869|gb|CF678710.1,gi|41532872|gb|CF678713.1,
                     gi|41533253|gb|CF679094.1,gi|41533263|gb|CF679104.1,
                     gi|41533633|gb|CF679474.1,gi|41533636|gb|CF679477.1,
                     gi|41535893|gb|CF681734.1,gi|41535895|gb|CF681736.1,
                     gi|41537677|gb|CF683518.1,gi|41537685|gb|CF683526.1,
                     gi|41542673|gb|CF688514.1,gi|41542964|gb|CF688805.1,
                     gi|41544643|gb|CF690484.1,gi|41544649|gb|CF690490.1,
                     gi|41549811|gb|CF695652.1,gi|41549824|gb|CF695665.1,
                     gi|41549888|gb|CF695729.1,gi|41549897|gb|CF695738.1,
                     gi|41550594|gb|CF696435.1,gi|41550607|gb|CF696448.1,
                     gi|41551885|gb|CF697726.1,gi|41551893|gb|CF697734.1,
                     gi|41554925|gb|CF700766.1,gi|41554937|gb|CF700778.1,
                     gi|41555205|gb|CF701046.1,gi|41555208|gb|CF701049.1,
                     gi|41555779|gb|CF701620.1,gi|41555786|gb|CF701627.1,
                     gi|41560499|gb|CF706340.1,gi|41560513|gb|CF706354.1,
                     gi|41560614|gb|CF706455.1,gi|41561433|gb|CF707274.1,
                     gi|41562519|gb|CF708360.1,gi|41562522|gb|CF708363.1,
                     gi|41562836|gb|CF708677.1,gi|41562845|gb|CF708686.1,
                     gi|41565599|gb|CF711440.1,gi|41565604|gb|CF711445.1,
                     gi|415"
                     /transcript_id="XM_572836.1"
                     /db_xref="GI:58271359"
                     /db_xref="GeneID:3259738"
     CDS             join(289395..289445,289501..289540,289578..289605,
                     289644..289671,289712..289810,289850..290021,
                     290069..290145,290197..290259,290312..290795,
                     290856..291043,291113..291340,291395..291484)
                     /locus_tag="CNI01180"
                     /codon_start=1
                     /product="vacuolar ATP synthase"
                     /protein_id="XP_572836.1"
                     /db_xref="GI:58271360"
                     /db_xref="GeneID:3259738"
                     /translation="MVHDPRISDSQLAQINAAAAVREYAIEPRMDYRTVSAVNGPLVV
                     LDNVSFPSYNEIVQLTLPDGTIRGGQVLEVSGKKAVVQVFEGTSGVDTKATRISFSGS
                     SMKLAVSEDMLGRVFNGSGNPIDNGPKVFAEDYLDINGSPINPYSRIYPEEMIQTGIS
                     TIDTMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKRPGATKGVHDGHEDNFSIV
                     FAAMGVNMETARFFKRDFEESGSISNSTLFVNLASDPTIERIITPRLALTTAEYFAYQ
                     LEKHVLVVMTDMSSYADALREVSAAREEVPGRRGYPGYLYTDLATLYERAGRVEGRNG
                     SITQVPILTMPNDDITHPIPDLTGYITEGQIFVDRQLSNRQIYPPINVLPSLSRLMKS
                     AIGEKLTRKDHGDVSNQLYAKYAVGKDAASMKAVVGEEALSADDKLALEFLDRFEKEF
                     VGQGAYEARTIFESLDIAWELLRIFPKESLNRISPKILAEFYARRPKGTSAEQPEENK
                     EDNLIDA"
     STS             290924..291704
                     /standard_name="Xho5"
                     /db_xref="UniSTS:470724"
     gene            complement(291438..293276)
                     /locus_tag="CNI01190"
                     /db_xref="GeneID:3259441"
     mRNA            complement(join(291438..291858,291921..292607,
                     292658..292811,292868..293034,293085..293149,
                     293210..293276))
                     /locus_tag="CNI01190"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538865|gb|CF684706.1,gi|41538870|gb|CF684711.1,
                     gi|41541618|gb|CF687459.1,gi|41541633|gb|CF687474.1,
                     gi|41542893|gb|CF688734.1,gi|41542899|gb|CF688740.1"
                     /transcript_id="XM_572697.1"
                     /db_xref="GI:58271081"
                     /db_xref="GeneID:3259441"
     CDS             complement(join(291529..291858,291921..292607,
                     292658..292811,292868..293034,293085..293149,
                     293210..293267))
                     /locus_tag="CNI01190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572697.1"
                     /db_xref="GI:58271082"
                     /db_xref="GeneID:3259441"
                     /translation="MLPIEEILITALKEHDYRDNNSVNVDEHIQRIKRQLDDPSSIRP
                     YSKSSTPLSVVSFQCLLQDTGYPMEVYLPGNIETSDHVDWSKLKERWVGWGVEVPGEQ
                     TWVKGKTDLADGLQQLSIEPQPLPSSVHAKYPLPERKGEYVGALLKVYDDASFRPAST
                     HEFIGLLSTSPMPSNEPEEADIVPTIHVLSQRQDTAAHEVTPQDEEIREELLDYLATA
                     FNPPDRTAGEYLLLLLLSSPTARPASLPVLGTLSLNFRRQASSTTSPFKSVISSISPR
                     VVPLPLTIPLLHSHPFSPSMTDTTGLNAGLLQLSEGTVLVVEEDAMGDGGALSEKALG
                     NLKALVNCVKDQKVKYEYPYMDGLKMDCAVRVAVLSQGKSLLPVDVDIPLREDGTAPT
                     KPPSLEAFRSYLARYSSPTHASRLVIPDEISQLIQDHFVQERKSNAADAEEALKRRMK
                     VARIVALSYPHATLNKEVWERTVRLDQEVAKRHAMS"
     gene            <293704..294737
                     /locus_tag="CNI01200"
                     /db_xref="GeneID:3259522"
     mRNA            join(<293704..293747,293791..293890,293935..294231,
                     294273..294369,294437..294737)
                     /locus_tag="CNI01200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572695.1"
                     /db_xref="GI:58271077"
                     /db_xref="GeneID:3259522"
     CDS             join(293704..293747,293791..293890,293935..294231,
                     294273..294369,294437..294684)
                     /locus_tag="CNI01200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572695.1"
                     /db_xref="GI:58271078"
                     /db_xref="GeneID:3259522"
                     /translation="MVSNLKYKVVVIGIGRGASCSGKTLLAKHIRRALPTDAAIIHQD
                     DLCPPAEEVPYSKQYPDLQDWDDPETCILWSEFRALLRQVRETGRVGDHDTHDHLNKE
                     NKIEVNEQIFERWQRKFEELTKQQREQGVELIWVIVDGFVLYYDKDVVDMLDIRIFLR
                     VPHDVLKDRREERQVYVLQRGVWIDPPEYFNKIVWPGYLKAHAHVFEDPAVGELKQEW
                     GPKGRDLHVIRPGEGEEGMTEAFDKSCEAIVDGVKKGRGIYLA"
     gene            complement(294675..296135)
                     /locus_tag="CNI01210"
                     /db_xref="GeneID:3259387"
     mRNA            complement(join(294675..294824,294861..295316,
                     295372..295599,295648..295896,295937..296135))
                     /locus_tag="CNI01210"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41556557|gb|CF702398.1,gi|41556574|gb|CF702415.1"
                     /transcript_id="XM_572693.1"
                     /db_xref="GI:58271073"
                     /db_xref="GeneID:3259387"
     CDS             complement(join(294688..294824,294861..295316,
                     295372..295599,295648..295828))
                     /locus_tag="CNI01210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572693.1"
                     /db_xref="GI:58271074"
                     /db_xref="GeneID:3259387"
                     /translation="MSNDRRNGIATRRYLAFGNNLCRQLDYRGSLVLKEPKDITDCLQ
                     GWQEVVWHSYACTIAQNSAWEWYGWGLDPLVSRDEPKKLEFDGKQYTRIIGYARPLAF
                     LQVDGHVINQKGQKSVKVWNDVVVTELGATYGYRWQDGVYYFESLQNLLDHENPFGPL
                     EHSLLHQKTPLKLFAAESQVYILAQGAMSHLFEVIDARALPPGLRQTCKDPVTVKLVE
                     DLEGLGVTKLVTGSANRFLALTEGGDAYLLAYNSDPEMIKVPNEEEVRLAGVGPDFVI
                     VVTENNIYVQGSNSFGQLGLLGDNQPEFIKLDIGEFKAEQIEKIYTSRWSTILCVRG"
     gene            296846..300241
                     /locus_tag="CNI01220"
                     /db_xref="GeneID:3259694"
     mRNA            join(296846..296977,297018..297091,297144..297831,
                     297938..297990,298065..298606,298928..300001,
                     300071..300241)
                     /locus_tag="CNI01220"
                     /product="ferric reductase transmembrane component 2
                     precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541086|gb|CF686927.1,gi|41551284|gb|CF697125.1"
                     /transcript_id="XM_572958.1"
                     /db_xref="GI:58271603"
                     /db_xref="GeneID:3259694"
     CDS             join(296855..296977,297018..297091,297144..297831,
                     297938..297990,298065..298606,298928..300001,
                     300071..300198)
                     /locus_tag="CNI01220"
                     /EC_number="1.16.1.7"
                     /codon_start=1
                     /product="ferric reductase transmembrane component 2
                     precursor, putative"
                     /protein_id="XP_572958.1"
                     /db_xref="GI:58271604"
                     /db_xref="GeneID:3259694"
                     /translation="MTVTGSTSAEVAASSYVPPYKATTSYAQSPEVTGSVTSALPADP
                     TVSSGISGADYAASYLDAHMMSWPSYRYAYLFWIILAGLAAIYALSHHLRLSAGSLGA
                     GYSKWGMRRKALGTKDGRRGTVLPSNNTMLSIAFLIILSVVLCLVGYDYINPSSTILN
                     FASYRKRAFVPYGISKAFWTSGNRFGYMAFAMTPLVVLFALKAPPFAFLSLRPFTHLY
                     SDKLALFHRAAAWLVWAFTTVHTILWTIQLFKDKRNGRAVWFTIWNSYHFIFGCIAYG
                     LMTAVMVLSLKPVRKHGFECSGSGWQELSFSGDVREVSYDQYSHRKQDFKQGDPYSTP
                     QRDFGNPYTDKTPPKPLAMGHLPSGDLSDFGGTRGQNGYDEGSFQPLGSYDARHSDSD
                     PAAVSPPYHERVQSVAHSIPPGLPAYMPTTIPIGHAQAQLLPSRTIRLTIRVARPFRW
                     SPGQSVLLYLPELSWFQSHPFTILNNDPNEIMLLVKARKGLTRQYAEIAWVAGQLRRC
                     QDMVSADQLHIDIFVTKAQRVKDDLAPPKPVFARGAHSRANSFDSAASEMSADSSTDR
                     DEAVDSTLMESYADVIDLTNYEDEEDVDDPVENRLSTKLEQQGKLRRARSRKFAKRKS
                     AAKLSQTPSYPPSRFQSTYSYDNPEESFAHSNQGYGHSPASSLYDSFHESRGHAGHSS
                     IAMSPSASQSMLIHSTSHSVPQSMLSPSTSISMLPTSPPFNAYHGNHQSVRSISDSTY
                     TANDPFTGGSSQGHGSPSVGHSSLTDDTQVAVPNDPFRDIQTALSRTSRTQSMVLLEN
                     SGADPKEDAGLWIDEADYAAMCVMSEMARAGKPKLSAVLEEEIEIAQGSLIVATCGPV
                     TLNTVVRNLVSKTISPSRIRRGDRRGHIVVYSEDYEG"
     gene            complement(300270..303560)
                     /locus_tag="CNI01230"
                     /db_xref="GeneID:3259549"
     mRNA            complement(join(300270..300506,300560..301464,
                     301504..301530,301582..301618,301679..302859,
                     302906..303560))
                     /locus_tag="CNI01230"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41564230|gb|CF710071.1,gi|41564234|gb|CF710075.1"
                     /transcript_id="XM_572691.1"
                     /db_xref="GI:58271069"
                     /db_xref="GeneID:3259549"
     CDS             complement(join(300357..300506,300560..301464,
                     301504..301530,301582..301618,301679..302859,
                     302906..303527))
                     /locus_tag="CNI01230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572691.1"
                     /db_xref="GI:58271070"
                     /db_xref="GeneID:3259549"
                     /translation="MSALQPGPLAPPCPPRPLHVHGNSTWTDDEDLSSDDDEAVFFGA
                     HKPEEVHLVAKLSAAVQSPAPFIPRVKKRDSREFLRRKTLLLPTDKRNQKNLNLSAQD
                     SARLYPSQWSDDEGSCSTPARSGHPASASTPSQAGQDPSDLTLKFETWHLSTPRDDES
                     ESAEEASDKENVPVPPCAGVQGPVDAVPLDELYMERQGILDLQGSDQDIPQLNMGGLH
                     LSDFSDQESGAIFQGLDILDEFYLEHVAEEHRSPEHPRSSTPLQSDESNPLDFDSPLE
                     VARAGPVAIPVLSSHHFASIRADVGSPCRNLPPSPILSAPVEQETTSVKLASLESPTH
                     QPASLSIATPSRATALPPADLVQRGAKTLKASTTKHAPPPPAVDTKKAAALKSAIRGQ
                     LDSAVLARINPGAPKSVSGSHTTSSARVVSENSVIEATEKPKQTLPPLQPRPEPRLVK
                     KPHPISRPTIPLSSSVNRTIPRPALASKTALPRPKSTLPTKTTSMLPPPSSIPLKRPA
                     SSQTHATRHPTAVPLSVTRPSHAHPAATFGKPLLGQPARVFREAATPLEITPVFSVAA
                     GGDHSTMSMSRIALKSPAKQNMYKKPLGENHTPRKLGTPMRFGTPRFGMFPLSLSMAS
                     VHPPITALQTNTAPPPKETVPPVPEPVDDSPPASHTRHAEAAADATSADTTSTPPFSP
                     PQSSTRSSGTMSESRTEQQVSSQPASSSPSPNRPARSKRSTSSSTKSAKPSKRPTTTT
                     PTPTAFPPALTEKQLKTTTARNTARNQVYHCAIDRKVIRQRGPRPPSPTSKIRTTSER
                     DEADKKNSREARAKRRMGIQSGEEEKEKDKKKEKPVIEKLELVKAPGDDDDWTYKTPP
                     PHRPLKRARRTSEAKDQGEKEEEKKKLRWDRVVSVIRDDGNASGSAKSLSDDGKERDG
                     EELKSCIKTKVPLDEHGNVLDAQRPVDNLKRTRVVVTAVFYDGEEHVPAPATATRSKK
                     K"
     misc_feature    300836..300871
                     /note="CT-rich"
     gene            <304017..>309446
                     /locus_tag="CNI01240"
                     /db_xref="GeneID:3259471"
     mRNA            join(<304017..304292,304382..304496,304547..304655,
                     304752..304916,305095..305687,305832..306634,
                     306708..307931,307965..308087,308148..308454,
                     308509..308599,308668..308810,308866..309362,
                     309423..>309446)
                     /locus_tag="CNI01240"
                     /product="protein kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41565230|gb|CF711071.1"
                     /transcript_id="XM_572689.1"
                     /db_xref="GI:58271065"
                     /db_xref="GeneID:3259471"
     CDS             join(304017..304292,304382..304496,304547..304655,
                     304752..304916,305095..305687,305832..306634,
                     306708..307931,307965..308087,308148..308454,
                     308509..308599,308668..308810,308866..309362,
                     309423..309446)
                     /locus_tag="CNI01240"
                     /codon_start=1
                     /product="protein kinase"
                     /protein_id="XP_572689.1"
                     /db_xref="GI:58271066"
                     /db_xref="GeneID:3259471"
                     /translation="MSSSPRGRRAPAPAALDLGPRTDGSRYGAVGLGLGAGHEADGRR
                     VFTEPVSFPAVAIADVAVAAHVQAAAASARPRSVFQRPALAARRQPQLLPGSAQPHPS
                     SIDRRTLVGVGELSTPRWPGSGVHNRAPNAHNGPARGPFDGTSEAYLGDTVASPSARH
                     KIASHTAITSRLSCDIDVSKDGLAKDELVGLVKDGLAKDGLAKEPSLTPTRIHTPSFA
                     GECSKTPPNPSRHNPSHDILKQFAVKDFSHLPPSPSSASINQFLRASGSTQNISSGTP
                     PGSASASNAYFPSKGVQREDSQKSQKSQKQQRTTPKPKELDPNVDEALRKLDGLTGTP
                     GKNKAKGKSSGGPSAASSRPGTPVAESKSRSEGKIPSKPSIGSFKDATGSPLSNWIDL
                     TEDLPAIPIPRARIPPNRESSSSASVTDQPEETEKSVPPVPPLPQVYVNKKQSMPAQS
                     SAMRPPSYVPMREPSPEPPAVSSPFEPGSPSTTAPVPVPAQPKMHKKWSFSSALNLKS
                     AASSASSVDEMRMTTPQSPQTPWSEIHRAELFSPSSSVHGKESAGGDSGPQGATPLAP
                     PSSKASNVNKRLTPSSIPFFRRSSSSSFQSKASQSVAPLPVPLPETPKQTEKTAAVPS
                     SQSRKSVLGMHFPSMLRGSSSKRGLAQQTSQSQVSAKGKEEVKPTSAPSASATSGWTG
                     RKRGKTLSISGDLPNPFPGLKHQSSADSSFGTRGSAVSSNSDATTISGSNTFDRLPAI
                     MGSPARPPEGARYSNSPRNLPSTTPTKIPRMTQRPAPSPATVTAHSGMPPPPFPTTRK
                     ISNTVSGAGEQQQRGGPPVSEFGMVDGIPHMPTTPRLTTSGAHRAHLLAPMSARQETR
                     RVNNRPFDPPPRSKEAYTGAVPPSRRHLPQPPPASTVTSMTLSASAKRASREFKNKRR
                     ESKDGQDGSSSGKNSPVKPSKSMHSSMAVPSSSRLPSSYSAGTPGSNYRKLSLADSSP
                     SMSPADDDEASGDAEMEAYIKRRRERAAANKKDDLSDVTEFPRDITPVEPLSQRAFIT
                     RNLAKMSDAERKEVLDFDYIYYSPTPGTIRRPSQPGGAMFNHGYDDERGDYLVVEGDH
                     LCYRYEVVVQCRDHKTGKSVAVKIIRNKKRFHTQALVEVKILQQLIEWDPEDKHFMVR
                     MTDSFSFRNHLCIVTELLSINLYELIKANHFAGFSTVLIRRFTTQMLGSLQLMRSHRI
                     VHCDLKPENILLCHPSKSAIKVIDFGSSCLETEKVYTYIQSRFYRSPEVILGMNYAMA
                     IDMWSLGCILAELYTGVPIFPGENEHEQLACIMEVLGVPDRYLIEKASRRKNFFDATG
                     APRPFVNAKGRRRRPGSKTLAGVLKCDDELFVDFIARCLTWDPDKRLKPQPAMRHPWI
                     LAGRRRYAPTPSRDEKRATTTERSSRLFGTSHTSTRISSKNLSELSTSSMKDKDKSKL
                     LISSPVPLAPAKHPYHASTASTSRIGQAMSSSRLAHQTSARSGSLTTSKLSIG"
     misc_feature    304027..304062
                     /locus_tag="CNI01240"
                     /note="GC_rich"
     gene            complement(309631..311883)
                     /locus_tag="CNI01250"
                     /db_xref="GeneID:3259676"
     mRNA            complement(join(309631..309810,309862..310149,
                     310203..310475,310526..311077,311123..311284,
                     311325..311462,311517..311654,311709..311883))
                     /locus_tag="CNI01250"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560766|gb|CF706607.1,gi|41560777|gb|CF706618.1"
                     /transcript_id="XM_572975.1"
                     /db_xref="GI:58271637"
                     /db_xref="GeneID:3259676"
     CDS             complement(join(309671..309810,309862..310149,
                     310203..310475,310526..311077,311123..311284,
                     311325..311462,311517..311654,311709..311862))
                     /locus_tag="CNI01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572975.1"
                     /db_xref="GI:58271638"
                     /db_xref="GeneID:3259676"
                     /translation="MSRTQHPDLTYWQDTVERLTALCSRLQHPRQSTSETEIIDILNG
                     LAVALRDESLRTPIGSLGLPDTLTELLQQAITVDLEEVVKQVGRVAANLAVENDFNRE
                     LLAKAGFIGHVLSPSVLDRNSSHPSDQALVASLYNLVVQGNSLCISVFQQENHLRCLC
                     RLAVDHLQQVHKSNAVGTVDLTIAQWLWSILSVVINDNGDKDCKMSDQLPLLDLFKHF
                     PYWTPPGSLSDFVIESGPEPPLNILLSSCQVIENILSDHSDILKQLIEDDDRLPKAAK
                     HPLELVLDFVEFANLPLSWTNATTEQRDDGESASQEEDFDARKLFGEAKACLVNGIVS
                     FSSESASSTLPLGFFWTRMRSWLDSDVSNRRDLVECALLSYGNSITGDTDAIEYLDGE
                     TTLLPRIKSLLKPDVPATTQHAVVGLLRNLSIPDQNKNVLYEAGVIDDLIGMGVWSEN
                     RDMLGSVQGGVVGIFKNLCRNQSDIASYIMASYKDDLISLCKRTNDQAIKFEGTRVFV
                     NAARNLPKGMDSQGVNALCDERIVKLLVDMMLNASQYPLLENEAVLGLAFLSMFSSAN
                     ALVMEELTAEREGGTGKTRLEQMVANKDLLKEGRENAEALLTLMRDRL"
     gene            <312069..323968
                     /locus_tag="CNI01260"
                     /db_xref="GeneID:3259481"
     mRNA            join(<312069..312129,312229..312485,312539..313160,
                     313228..313634,313848..313908,313948..314127,
                     314179..314300,314347..314751,314800..315415,
                     315469..315576,315634..315711,315773..318272,
                     318360..318542,318592..318661,318918..319019,
                     319075..319150,319201..319258,319311..319453,
                     319504..320115,320169..322394,322446..322506,
                     322561..322608,322731..322826,322884..322938,
                     322998..323179,323227..323276,323338..323392,
                     323449..323629,323686..323968)
                     /locus_tag="CNI01260"
                     /product="ubiquitin-protein ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545494|gb|CF691335.1,gi|41546008|gb|CF691849.1,
                     gi|41558519|gb|CF704360.1,gi|41566294|gb|CF712135.1"
                     /transcript_id="XM_572687.1"
                     /db_xref="GI:58271061"
                     /db_xref="GeneID:3259481"
     CDS             join(312069..312129,312229..312485,312539..313160,
                     313228..313634,313848..313908,313948..314127,
                     314179..314300,314347..314751,314800..315415,
                     315469..315576,315634..315711,315773..318272,
                     318360..318542,318592..318661,318918..319019,
                     319075..319150,319201..319258,319311..319453,
                     319504..320115,320169..322394,322446..322506,
                     322561..322608,322731..322826,322884..322938,
                     322998..323179,323227..323276,323338..323392,
                     323449..323629,323686..323826)
                     /locus_tag="CNI01260"
                     /codon_start=1
                     /product="ubiquitin-protein ligase"
                     /protein_id="XP_572687.1"
                     /db_xref="GI:58271062"
                     /db_xref="GeneID:3259481"
                     /translation="MLKTYHSNEGQEICKEAERSTSGDDLTIVLKQFQVWRYPRGDLH
                     AWIPVLDRFDNLLAEIIKSYDLTKLQINDFTPKTKDMLLEILRLQRILMENCTNRKLF
                     NSYDRLADLLLTNDLDVLLATIFVLLRPSQQYAISTPLDPAQRHAILQRLLALSRGWE
                     SLVHSGLDLTTIASANEVVIPEHLRQVQVHFYPTVQRQEAPSLDKSPVKMLSSGAMET
                     PTRQRPFVFGKAGTPVVRQGGAASTSSGPSVVDLGDVSTMEVNFTDQLSALAEKNYIP
                     LEEQFATLNKLRLVILMKDREIRRQLLSVRLFALATYVYLASEDAAQSNLFLYEPELV
                     SQLADLLRSSSDVGEQVTTGTLLALCACAHHQAKMGEVMTSVSANVNHGVLVTFFRHL
                     NDRLVAGEAVSFELVDATMSFLAFVATSPSHSNMLMGAGILRLLLEMLNTTGDRRENT
                     EIELRLQARDEAASETISEETILSCANNPLKTILRSIQRLMQASGGTEGLRNLVDSDL
                     PKSLKVIFQNSPKFGSRVYALAINTMATFVHNEPTSLAILQEMQLPQTLYAQLEKEVP
                     SSSDVLTAISNAVGAVCLNQSGLEYTVAHPDVINNLVSIVMSTDHAQVFNERENARAL
                     GLSLDELSRHHPSLRPVIIKAVVNLLRQAIDTGAAFEPAIDERPDYIIEEMAQQMVPS
                     LETQPAKTSPSNPTLAAFTRIFRVLGGLLRNPTIVKDFVDAGGFDLVFTMTDSPCWPI
                     RFGNTQASTSLAHLTKHAIEHCYPQFIDAIVASIRTSLAQCTDVWSETDAHKKWTAVR
                     EGSADAELLGKFKTFHSIFVRLTLFADALYALSVTNSRAATSVIKTFKVQDDPSFITN
                     LGTIHRLCFRYHVLSRSSEPSISEDPSKEGDNVKESGVRYLSTRSHAILTKFFKCLVR
                     LIYSKRGRDQTHRDQAQALSVCIADILIDHLQPIPDLSANGFSVDGFALGTVMTMLFD
                     GRGLDGHLNTTLFLAFEEKGGFDATLSASTRIISHMEEVTKKHNEDNDTTQGELDTES
                     VAAIKTVLLVLNSFASPKALLDSPETHAIQFAAPGQPKPSFTATNFFLKIRLAVFPLA
                     HRIWRASWLLNCPTPVIKIAINCFSTLVEGKHEESSGPEAISRAIHIVAQPRPVVVTA
                     DPTSVDQLVDMGFPRRGAERALIRSRNNITTATDLLLTMPDEFVDDVSGGDNQAGPNT
                     VLEENNQEIEGESSQSAERELDSHSGAAHTEIGDRESTPRPADEDVKLKEQLQEVRKK
                     YREGMSDRALEIMDQAEALVFDLLPCVPSGQAGITFVVDRLSDACINYQSDRDIMISA
                     RLRLASVCLRSNDSIVFSDELQARSAEIVHALPLEEVQRPRWLPALLLFAETVYGLQS
                     FIKKVKLGDSPEEEVTAALVSQLRSEVSRLSTICVTTIRADDSTRDELVAAFRLLALL
                     TRVSGVGISPSVIADCLQPFKKVSEKLAGCHPFLVLVIRHLLDNESTLVEAMQGEIKN
                     WLSPARNKVADIQHFVRQLRHVALREPTCFLRAVKQECALVDPTPPQSVYHIRGKIES
                     KDGPLATGHVDSPLESLGEETQTMMNFLLGELSQAVRASFEKSDNEKLSTEVKNSAEQ
                     AYSGLVMSTLTEILGSYVTAKKAFLNGLKQGTFPGALKAKGGISALINDLICCPVLRP
                     DVSTTPVAGSDPLSLQRLAISSRSTAMVVALCSDVVLVGDKKDVPEDIVSIRRTVLDA
                     LAKAIRDTSAVLDNNARYGRLWALGELVYRLLMARPHTSPRQVNNTGLHMAKTMLEKN
                     FVGILTNALGEIDLNYPDIRNVSKLSVKWGKANKNQREEVGQHQSEEGNDSSNPSHSD
                     SESDVDMLEDEQSAPDLYRNSALGMIGGELGDEDEDDDMDDEDEEDDMADDLDDDAGD
                     SDEDGEMEQEVILGSADEDGEVWDGDSDGQDSYGTDDEDDLEEEGIHAEGIFDDDVDD
                     PEMDDFDDEEAYDETAFMEPFQDIMSPEAAGPWGWNQPAGRETVRSSGFTRADGQFMA
                     DEDLLGGPLASNTRNLTEHPLLTNQASSSHIHSSRLSDILYAIENMRGTDTIQMLENF
                     VANRQHNVMGSNQLAFSRNHDGSMSVSINGRVYTVGGQSRNVTSPNVAAEFVPMTTSQ
                     RWQEELNMLPMSRNEASSRLVVHIVNHLLPEARRQAAEKEVMDKEAEADRKTSATSAE
                     KIEENGNAIDEEGVGNDDHDWQEDDEDVNMDDSDFDSHVSADEDVVTEEGGADRGPRT
                     LVSIRGRDVDITDTGIDLEFLQALPDEMRADVVEQHMREQRRHQRPVSSNIPEIASQI
                     NTEFLNALPPDIRAEVIMQEEMENARRDQPPPPPSIQTGRTSGHFFTAIANELRVLQQ
                     NPLGVASSSGAVHATGDAPSTFNPRHREAIQLLEKPGIAVLVRLLFYPHAFKKSYLFR
                     VLVNLCENSNTRNDLLDLLISVVHDGSGDLPAVDRSFQQMSLRGASVSTPKATPKSKT
                     VDTPSTVIPPGLFSGLQNEHVPTFIAQRCFEALAYIVNSNTNAASYFLTEHEQTAGLR
                     KHTSKKGKGKEKILPQTKFPIVVLLGLLDRPLLAKTPGMMETVTALLLTITKPLADRK
                     SEENGQAVATDKDTDSSAKPPTIQSSQEASAGPEHVVGKQTSPSIPPSVLKLIVNCLT
                     AGECTSRTFSQTLGAMQNLACLPESKDIILQELCARCQELGAAAHEQLQELAAALNDE
                     DSDVGSLTLVKFSPPTSTQAQLLRLLKTIDYLHLNKVDPDPPADTMTAEEEAVTKVFQ
                     SFNFEGLWDQLGQCLSIVEARGSTEQLATVLLPLVEALMVVSKYRTRFSREIRSPSIA
                     PATSEGVDFFVSFTTAHRKVLNTIVRNNPSLLSGSFSLLIRNPRVLEFDNKRTWFFQK
                     LKRKKSSAIPSGTLHLNIRRQYVFEDSFLALQRWNGEELKYGKLSVKFRHEDGVDVGG
                     VTREWYSVLAQQIFDPNFALFEPCAADQQTYQPNKTSWINDVHLSYFKFVGRVIGGRL
                     LDAYFNRAFYKQILGRTVDMRDLESIDPEYHKSLQWMLDNDITGVIDQEFTIEDDQFG
                     EKKTVELKENGANIPVTEGNKEEYVRLVVSYRLDNSIRDQIKSFLEGFYDIIPQELIQ
                     IFEPDQLELLISGITTVDVDELKNATQLNGWKATDPEVAWFWRALRSFSQEERSRFLM
                     FVTSSSRVPLGGFSQLQGSSGTQPLQLQKLHGKEGGLPQASTCFNLLLLPTYASYEQL
                     RERLQFAITETGGFGKA"
     gene            complement(324487..>326748)
                     /locus_tag="CNI01270"
                     /pseudo
                     /db_xref="GeneID:3259380"
     repeat_region   343820..343862
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     repeat_region   354942..354984
                     /rpt_type=tandem
                     /rpt_unit_seq="cata"
                     /satellite="microsatellite"
     misc_feature    356044..356135
                     /note="C-rich"
     repeat_region   357485..357505
                     /rpt_type=tandem
                     /rpt_unit_seq="ta"
                     /satellite="microsatellite"
     repeat_region   361484..361648
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     repeat_region   365630..365674
                     /rpt_type=tandem
                     /rpt_unit_seq="tatg"
                     /satellite="microsatellite"
     gene            complement(<370721..>372549)
                     /locus_tag="CNI01280"
                     /pseudo
                     /db_xref="GeneID:3259406"
     gene            complement(381759..>384724)
                     /locus_tag="CNI01290"
                     /pseudo
                     /db_xref="GeneID:3259408"
     gene            complement(388527..390028)
                     /locus_tag="CNI01300"
                     /db_xref="GeneID:3259410"
     mRNA            complement(join(388527..388709,388753..388919,
                     388969..389037,389097..389234,389300..389353,
                     389404..389457,389519..389594,389675..389808,
                     389881..390028))
                     /locus_tag="CNI01300"
                     /product="2,4-dichlorophenoxyacetate alpha-ketoglutarate
                     dioxygenase, putative"
                     /transcript_id="XM_572683.1"
                     /db_xref="GI:58271053"
                     /db_xref="GeneID:3259410"
     CDS             complement(join(388577..388709,388753..388919,
                     388969..389037,389097..389234,389300..389353,
                     389404..389457,389519..389594,389675..389808,
                     389881..389994))
                     /locus_tag="CNI01300"
                     /codon_start=1
                     /product="2,4-dichlorophenoxyacetate alpha-ketoglutarate
                     dioxygenase"
                     /protein_id="XP_572683.1"
                     /db_xref="GI:58271054"
                     /db_xref="GeneID:3259410"
                     /translation="MTINYTPLHPTFVAEASGVDFDNITPEVVEEIKKGLAKYGVLIF
                     RKTGLNDKKHVEMSSFFGELDDVKPYNKLGRINRLAYDELFDVSNVDAEGNIFQPTGQ
                     RAIINRGNTIFHCDSSFNPRRAGYSLLLAHELPPAGTGGNTEFADTRTAYDDLPEERK
                     ETIKDWVLWHSQHHSRRVANPGEPLLDQEKFLPTSHPFGKHKLVQVHEPSGRTNLYIA
                     NHAYKIESLPLEHGQAEIKTLLDHCSSPRYVCSVEWKNDGDLVIWDNTCVMHRAVPGA
                     FEGKYKRDMRRTTVHDSSSYAWGLNTVGDTWRSGLP"
     gene            complement(392735..395472)
                     /locus_tag="CNI01310"
                     /db_xref="GeneID:3259605"
     mRNA            complement(join(392735..393168,393225..393450,
                     393512..393642,393691..393893,393941..394164,
                     394217..394376,394429..394593,394649..394686,
                     394750..394801,394854..394866,394938..395472))
                     /locus_tag="CNI01310"
                     /product="transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530249|gb|CF676090.1,gi|41542021|gb|CF687862.1,
                     gi|41542027|gb|CF687868.1,gi|41548259|gb|CF694100.1,
                     gi|41548264|gb|CF694105.1,gi|41556211|gb|CF702052.1,
                     gi|41556214|gb|CF702055.1,gi|41556965|gb|CF702806.1,
                     gi|41556970|gb|CF702811.1,gi|41562474|gb|CF708315.1,
                     gi|41564346|gb|CF710187.1,gi|41564363|gb|CF710204.1,
                     gi|41565556|gb|CF711397.1,gi|41568190|gb|CF714031.1,
                     gi|41568198|gb|CF714039.1"
                     /transcript_id="XM_572856.1"
                     /db_xref="GI:58271399"
                     /db_xref="GeneID:3259605"
     CDS             complement(join(392893..393168,393225..393450,
                     393512..393642,393691..393893,393941..394164,
                     394217..394376,394429..394593,394649..394686,
                     394750..394801,394854..394866,394938..395213))
                     /locus_tag="CNI01310"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_572856.1"
                     /db_xref="GI:58271400"
                     /db_xref="GeneID:3259605"
                     /translation="MTTENEKDMAHHPTFREEVDIGFAGESAEYAQAPRLTQTANLKD
                     MNPLDITASTEKGEVDGRQQQQPEQGQSGVLTGARLYLVFVALMLCVFMFALDQSIVS
                     TAIPVIVSDFNAFDQVAWIITGYFLTQCGLILLVGQVLTILKAKWMLLGAIFFFELGS
                     LICGVAKDMDTLIGGRAIQGIGASGMFVSILAVIAVVTRVDQRAAFMASFGFVFVVSS
                     VVGPLLGGAFTDHVSWRWCFYINLPFGGFAAAAVVFLLPARDPEHADTAPPDRTVLGK
                     LRRLDWIGTGLIFCAITCLLLALAWGGNQYAWNNWRIPFLFTLGGLLVIAFGVWQWRY
                     DKYALIPLSLLKNRTVLACSGAIFFFMLAMLGGTYQLPLFYQAGRGHSPEKSGVDIIA
                     FMLATCVAILISGGLTTKFGRYYPFLLIGPPFAAVGFGLLYTIDVNTPNAKIIGYQIL
                     AGFGIGLSFQNVLVAVQAEYHDRPSLLPQATGVVSFFQLTGAALGVGIINTVQSVYLN
                     TEIKRLAPEVDFNLVRQSVSAIYTLPADQQSAVIEAYVISITNSLIPIIVAVGLAMVF
                     GAFIRNHNLLKKGGAGSAHMA"
     gene            395970..398981
                     /locus_tag="CNI01320"
                     /db_xref="GeneID:3259531"
     mRNA            join(395970..397684,397741..398421,398483..398981)
                     /locus_tag="CNI01320"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41569593|gb|CF715434.1,gi|41571432|gb|CF717273.1"
                     /transcript_id="XM_572854.1"
                     /db_xref="GI:58271395"
                     /db_xref="GeneID:3259531"
     CDS             join(395990..397684,397741..398421,398483..398905)
                     /locus_tag="CNI01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572854.1"
                     /db_xref="GI:58271396"
                     /db_xref="GeneID:3259531"
                     /translation="MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFD
                     EGNLHAMEGSDSSEVSNIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDE
                     CKGAVQAYAASQGFAAVIRRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGDSFKDV
                     RIRTIQTVKNGCPFAAVAWEMAEAEVKEHGGDKCWTWKVVNASHNHPPVANIGIALLR
                     RASRTPEAKELINTLIDSRTPFPSIISTMSQRFPTVMLTSEDLHRLAFRRRADLRAGS
                     SASAACIRQLVSNDELHRPFVNTRDELIGLVYTKRTARALIHRFPEVLFFDCTYKTNL
                     YRMPMLHIVGSTSTGMTYTAGVILMLRETTNWYTQALNSFFELVGKPDVKVVITDRDP
                     ALINALMSVLPKAYRFSCFWHLQENVKSNIRPCFVDEENIVMAVSNFCKAWVRYCVHA
                     KSDEQLEEGYRKMEELYPGQKYARAISYIRGLDEIKERFVHAYINKQLHFGQTGNSRL
                     EGQHATLKKSIDTKYGDLLLVIGSLSTYFDQQWLKILKRIELERTRCATHIPSTFVRL
                     KGSISRAAMKLLAEQLTLAKRYLGDYDEGVDDFEESHPCSGSFTKSHGLPCAHRLISF
                     VRERRHLEKDHIHPHWRLGSAASLKRYLDHINRLVGTPDTSVIRLDDVFDFGEDQELI
                     LDPPILSTKRGRKAPNPPVLQEDRMSAPSGRYLTQSERIMGAGLTQRKKGRCKHCQSS
                     THYTKDCARVQASRRVDKNQEAENAGEDRRVLVPDSDDEEGNEEDLVEVPNEPNLRPK
                     KHSRSQYPAPSQIYPSHAVQMQHLPPEPSVPQLPPSSQFYPPLSQYYPPAPQHYPTSK
                     YHVPPTQYIPYNQVLFHNHSEAPTPYHYPSVSGYNNLQSPQIYQYNLENNVGKDASIR
                     SQEDSIIMQRGRDRHSWE"
     gene            complement(397631..>398907)
                     /locus_tag="CNI01330"
                     /pseudo
                     /db_xref="GeneID:3259778"
     gene            <400162..>401243
                     /locus_tag="CNI01340"
                     /db_xref="GeneID:3259749"
     mRNA            join(<400162..400252,400331..400363,400432..400723,
                     400777..401022,401081..>401243)
                     /locus_tag="CNI01340"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_572858.1"
                     /db_xref="GI:58271403"
                     /db_xref="GeneID:3259749"
     CDS             join(400162..400252,400331..400363,400432..400723,
                     400777..401022,401081..401243)
                     /locus_tag="CNI01340"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_572858.1"
                     /db_xref="GI:58271404"
                     /db_xref="GeneID:3259749"
                     /translation="MPRLGLGSGGLRDQTAVDAVEHAMKVGYLMVDTAQQYQNEREVG
                     TGIAKSGIPRSQIFICTKWQPRPDGSIERPTPEQVCQEAHQSVLRLDQSGSGKEYLDL
                     MLIHHPRPDPDGRAVHWKGLALAQKEGWVKDIGVSNFNVKHLEALPGPLPAVNQLELH
                     PWCQQREVVDYCSEKGIVLQAFCPLVRIRKDKFEDPVVVKVAKKHERAEAHILLRWSL
                     QKGFIPIPKASSAERIEANKDLYNFELDSEDMEELDGLDQGASGRVSGIDPAHLPD"
     gene            401769..404689
                     /locus_tag="CNI01350"
                     /db_xref="GeneID:3259690"
     mRNA            join(401769..402072,402145..402196,402269..402341,
                     402402..402496,402564..402659,402720..402753,
                     402818..402874,402931..402997,403058..403471,
                     403562..403782,403850..403968,404029..404147,
                     404211..404689)
                     /locus_tag="CNI01350"
                     /product="transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530096|gb|CF675937.1,gi|41530628|gb|CF676469.1,
                     gi|41538368|gb|CF684209.1,gi|41538380|gb|CF684221.1,
                     gi|41567367|gb|CF713208.1,gi|41567381|gb|CF713222.1,
                     gi|41568624|gb|CF714465.1,gi|41569409|gb|CF715250.1"
                     /transcript_id="XM_572860.1"
                     /db_xref="GI:58271407"
                     /db_xref="GeneID:3259690"
     CDS             join(401911..402072,402145..402196,402269..402341,
                     402402..402496,402564..402659,402720..402753,
                     402818..402874,402931..402997,403058..403471,
                     403562..403782,403850..403968,404029..404147,
                     404211..404450)
                     /locus_tag="CNI01350"
                     /codon_start=1
                     /product="transporter"
                     /protein_id="XP_572860.1"
                     /db_xref="GI:58271408"
                     /db_xref="GeneID:3259690"
                     /translation="MTLGERERLLQPAPAPPGTTLYSEPNHSEDIETTDEHKLSYNRV
                     GLNARRFWILCASMWIASFLNAFDGTVVATLLGPISSSFKATNLASWLGTSYMLSVCC
                     FTPIYGRLCNIIGRQGSMLLALAIFTTGNLLCAFAPSMEALIAARALAGMGGGGLSII
                     GSTIMSDIVPITHRGIFQGLANLAFGSGMGLGAPIGALINDCLNWRWAFWVQIPVLLF
                     ASYLVHSNVRYDVPSRPSSGAATPNPAAVKQTAMQLFKRIDFLGCFLLAGWVGAALIA
                     ISLNINSTATNAYNWSDPIMIGLFATSAVLFVLFLFVELKWAAEPVMPFELLVSRTPV
                     AVAINNFVLSVANFAILYSVPLYFTTVRQMSASNAGAHLIPNSFVGVIGSLGAGLIVR
                     RTHKYYWLNTFCACFGVIGCFLISTWRLGTSEWMLWTNMSFTSFAMGAVTTLTIVALI
                     ADVGPEHVAIATSLSYVFRTIGQVLGVALSGALTQAVLTWELEKRIRGPNAEEIIASI
                     RESSASIRYLPEPLKSIAIASYQKGLHAVFICTVVLSVITLLSGLGIRELDMKQIMSG
                     GKQAKQVQNESEEEEA"
     gene            406808..408678
                     /locus_tag="CNI01360"
                     /db_xref="GeneID:3259714"
     mRNA            join(406808..406894,406944..407010,407061..407201,
                     407254..407627,407679..407746,407809..408678)
                     /locus_tag="CNI01360"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532406|gb|CF678247.1,gi|41532416|gb|CF678257.1,
                     gi|41553619|gb|CF699460.1,gi|41553623|gb|CF699464.1"
                     /transcript_id="XM_572784.1"
                     /db_xref="GI:58271255"
                     /db_xref="GeneID:3259714"
     CDS             join(406821..406894,406944..407010,407061..407201,
                     407254..407627,407679..407746,407809..408479)
                     /locus_tag="CNI01360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572784.1"
                     /db_xref="GI:58271256"
                     /db_xref="GeneID:3259714"
                     /translation="MAIAFPQPFMHPKTLPVGLVTEAAKDTIFRDKTSEDPHTPLPLD
                     QDSYFQFSAAASNLKNVSYTISGGDEGAESRGDELNGGVWTSEEEEFIKLVMSRPARD
                     FSVPFPPDALPPSAVIDEITDYIAIPGIAAHASVDGQTATHGDNQLQLWPHTWQETRI
                     KVLQIALEQSRFGRDVKERKLPREIRNHRPGLRRMDSMDFLDQEKTEGVSEDHLGRAL
                     RLSSSLQSSAQDEKTNIMFQQPIAIESLRPQSHSVTSSEPLIPANPVSRAFRRCNSKS
                     SRPSSLLQRGRSFTAADLQMEDENLEEDDRGTTFLTARGEQASSSTRAIGTHQYEKKI
                     NLIQPMTSITSQSTSETSSKPPARLIRSNSSYSVANAAPYSSQKMFLSTPQPSTAQSS
                     IMPLSLQPSMKLSVSKSRRTNNGRDFNQPAFKKAKRRDGNEYQVKPGGIPIQHSLLQG
                     GLQSPFEEKKGLDL"
     gene            408965..410933
                     /locus_tag="CNI01370"
                     /db_xref="GeneID:3259450"
     mRNA            join(408965..409606,409661..409742,409804..409901,
                     409954..410601,410652..410933)
                     /locus_tag="CNI01370"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533508|gb|CF679349.1,gi|41549615|gb|CF695456.1,
                     gi|41549617|gb|CF695458.1"
                     /transcript_id="XM_572979.1"
                     /db_xref="GI:58271645"
                     /db_xref="GeneID:3259450"
     CDS             join(409206..409606,409661..409742,409804..409901,
                     409954..410601,410652..410862)
                     /locus_tag="CNI01370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572979.1"
                     /db_xref="GI:58271646"
                     /db_xref="GeneID:3259450"
                     /translation="MSSATDRIPALIAHYLATHYPTALDPFLQAAQIAAPDFSHPPNP
                     DLRTVVEDWSSQQLATSLAMATIDESDIDAPARDGTWKGWKLKDMMKAKLSAGVGLRS
                     TDRGFHGVSAANLLTVAAVNVPSREFDTSSAIYRTSCSLDIVTTSVDKTLKIIDYSSG
                     EVNKVLQPHRAAILTFAFHPQNQRYLLTGSMDGTTVLTDILTCKTLQTFSSTKFVVRV
                     LFSSDGHFMATASYDHHIVVYAATSSALPPPTHEDDIPLDDTDHWSLACEPDLQYTEV
                     HRIQVDANPEAILFHPDSTWLMYTTRSSYQLYYVRLPSESCPPDDEWQIKTKSFNPHP
                     MDTHVSFSVLNMALHPSGRMVACQTGDHKGGAGERILLYGVEPEETERLGCLWTGSGG
                     DDYVLPRMAWVPDGSGIVTTTHNGFLNLIALNGEIRSSVKVHGTSNSGKAVSEVVRDC
                     CIIPGEAGGWEVISIGYDRSIRISVIDGY"
     gene            complement(410920..412867)
                     /locus_tag="CNI01380"
                     /db_xref="GeneID:3259640"
     mRNA            complement(join(410920..411062,411123..411673,
                     411733..412172,412232..412499,412570..412867))
                     /locus_tag="CNI01380"
                     /product="endoplasmic reticulum protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535910|gb|CF681751.1,gi|41535917|gb|CF681758.1,
                     gi|41558978|gb|CF704819.1,gi|41559776|gb|CF705617.1"
                     /transcript_id="XM_572989.1"
                     /db_xref="GI:58271665"
                     /db_xref="GeneID:3259640"
     CDS             complement(join(411014..411062,411123..411673,
                     411733..412172,412232..412493))
                     /locus_tag="CNI01380"
                     /codon_start=1
                     /product="endoplasmic reticulum protein"
                     /protein_id="XP_572989.1"
                     /db_xref="GI:58271666"
                     /db_xref="GeneID:3259640"
                     /translation="MRLSHSHPMTVPPAPLHLLQGHPKEMLELLHQSRGSWDPHFIYR
                     ANRAATGAWGAWNSRDEKELSKEYGFEPVKAFWFTGEKGAPDEKPKPRQDGGPVILHF
                     HGGGYLCGTAAETDLTSSICKALVSYSPVHHILSVDYRLAPVGPWPLPLLDAISAYHY
                     LVKIEGIPEQDIVIGGDSAGGHLAMALTRWLRDEGDHVGLSMPRGIVLMSPWGDLGFT
                     NAWGADEYKYNADSDTIDDTFGPFACSLLLRALPLSILYSSPYLSPASSTLSATSLFN
                     NFPPTYIVYGGAERLAKSTETLYSRIQLARRAADKVLVPDRLFASPDAVHDFVIFPWM
                     AREASQVYEDLDKWLRELLTTDICSPAAASKESLKQPKKITDQCRLTRQRTLESLRSH
                     KSPRMCAAPDSGMLELVQDMQEEGMSMIEIPKLDLGSTAIT"
     gene            complement(413206..414627)
                     /locus_tag="CNI01390"
                     /db_xref="GeneID:3259500"
     mRNA            complement(join(413206..413746,413803..414627))
                     /locus_tag="CNI01390"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530434|gb|CF676275.1,gi|41530441|gb|CF676282.1"
                     /transcript_id="XM_572971.1"
                     /db_xref="GI:58271629"
                     /db_xref="GeneID:3259500"
     CDS             complement(join(413250..413746,413803..414622))
                     /locus_tag="CNI01390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572971.1"
                     /db_xref="GI:58271630"
                     /db_xref="GeneID:3259500"
                     /translation="MAANHGVFFHPPQPLSSPSAPFFTPSRKRRAASPTPDSDPLSPW
                     QQSASPTTFADTPHREKRRRPNLAHGFSSLSISPTATQSTTVPDQPRADDDDEGIGPS
                     VYPRNDDVKVEVLPDNTNRLSSYQHRSHRTHTDQWDPYHPRPCSSSSSPSPTTSTDET
                     YDSDATFTRNVPRIKRYDGTAQQADEIVQPDGSSMFTGPDLGVEDVTGIPPPLRARRP
                     REEDIEGMEHAGKKRRGNEMDIDMSTMDENTEDGSVEEKDKLRGRKTVWYEPEKDRIV
                     ITSLSDSDSRSSRSPSPETESRYLSQPGEQGFTISPSLLTHLMNVHRNKDLRGPLQDL
                     LENNQKSLTLYRPLGIPADRWKESIVKTWEDARNYDDSGRFEEIDDTEDFGNNIRSTG
                     NNDEGMDIEGTVPAWQGGAWNTGEAGMGEGGAVSGDGDVDMAMDVE"
     gene            414959..416862
                     /locus_tag="CNI01400"
                     /db_xref="GeneID:3259492"
     mRNA            join(414959..415302,415358..415412,415454..416135,
                     416184..416257,416316..416702,416773..416862)
                     /locus_tag="CNI01400"
                     /product="choline kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552596|gb|CF698437.1,gi|41552606|gb|CF698447.1"
                     /transcript_id="XM_572982.1"
                     /db_xref="GI:58271651"
                     /db_xref="GeneID:3259492"
     CDS             join(415007..415302,415358..415412,415454..416135,
                     416184..416257,416316..416702,416773..416838)
                     /locus_tag="CNI01400"
                     /codon_start=1
                     /product="choline kinase"
                     /protein_id="XP_572982.1"
                     /db_xref="GI:58271652"
                     /db_xref="GeneID:3259492"
                     /translation="MVVTPTRPPVEPSGPPLSPLALASTAPRNSSDSYFAAQAGSRPL
                     PRHRRTSGSSFSKLSEFSLDPPLLDKTDQYAASPDQIDENGVTGVRHVALSVDASEWR
                     QPVFKQKVLAILRRLHVPRWSSTLLTPTNIHLQKVSGALTNAVFFVSFNPAPNPTSPS
                     ESPLLTPTIPPSDPSHPPPLTPDQYPHTLLFRVYGPSSEALISRSEELRILHVLSTQY
                     GIGPRVFGTFTNGRVEEFFPSRALTAQELRDPSISRGIARRMRELHSVDLRRLGYEQG
                     RATEPALWICLKEWSEAAEDVITSLTALGGTLEAWVERFSLHRIREEVTIYRNFVESQ
                     SGKGSGVVFAHNDTQYGNLLRLDVELPPNTPEHCRYIVIDFEYASPNPRGYDIANHFH
                     EWRANYHHPTHSHSLIPHFPYPTPIQREDFYRSYLSVEVDGRNGEEVVGKRKDVPADK
                     VAALEREVRIWSPGCSINWALWGLVQAEEQVCALATKKEGYVPEFDYLSYAAERLEMF
                     RDEAKKLGVPL"
     gene            417077..419762
                     /locus_tag="CNI01410"
                     /db_xref="GeneID:3259538"
     mRNA            join(417077..417218,417274..417536,417598..417679,
                     417738..418014,418066..418210,418261..418360,
                     418406..418528,418580..418837,418892..419395,
                     419449..419762)
                     /locus_tag="CNI01410"
                     /product="dynein intermediate chain, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532708|gb|CF678549.1,gi|41570258|gb|CF716099.1,
                     gi|41570268|gb|CF716109.1"
                     /transcript_id="XM_572785.1"
                     /db_xref="GI:58271257"
                     /db_xref="GeneID:3259538"
     CDS             join(417102..417218,417274..417536,417598..417679,
                     417738..418014,418066..418210,418261..418360,
                     418406..418528,418580..418837,418892..419395,
                     419449..419715)
                     /locus_tag="CNI01410"
                     /codon_start=1
                     /product="dynein intermediate chain"
                     /protein_id="XP_572785.1"
                     /db_xref="GI:58271258"
                     /db_xref="GeneID:3259538"
                     /translation="MSDRRRQEIEEKRARLAELRRARDERKQLLAQAEKGSAEPLSTS
                     RRDVNELVDSLLARPATPLTGPSSTRPSTIGTPARPSGSTPPASIPGTPGGRVSRLSN
                     DGSLSRVAGSTAGGASVGVPGTVDQENMPSPSPSQAVDFVDHQAELFELPSKSAKAAP
                     VTYSKAIQTMTSMSTSTDDADVDDAQSEGEDGTGRRRRRKGEADESGKETEDEMRKRI
                     LEELDEERKALEKELRELREKTEELKIAELSDEQRQAIFAAPDFTSFIEESTRIVQRA
                     LSDGYDYIKDYTIGIDGAFDESEGQKVKLFCAFSDERWTNGRSVTDVDWSPKFPELSV
                     ASYNKNPSAVNDPDGIVAVWNLHLLERPEFVFHSPSDVLSVNFSPYHPTLIFGGTYSG
                     QVLLWDTRAKHLPVLKTPLSATAHTYPIYAMKMVGTQNANNLISSSTDGLVCSWLADM
                     LAQPQEALPLTMPAHNKTDEVSITCFDFPDNETSTFWIGTEEGSVYQANRYDRASAKA
                     GINPDEAYRGHAAPVTGIHFHPGTGSIDFSNLFLTSSVDWTVKLWRTKAANTTKGASG
                     TQANGNGEDKTVAPVHSFEEASDYVFDVKWHPHHPAVFGTVDGSGKFDLWNLNQDVEV
                     PIISTNVSPRAINKLAWDRSATARKVALGSSDGKVYIYDVAEKLVVPRDSEWVETQKN
                     VQSLAASKDGANGVLGNESVSGSAGRYRL"
     gene            complement(<420290..420875)
                     /locus_tag="CNI01420"
                     /db_xref="GeneID:3259728"
     mRNA            complement(join(<420290..420538,420600..420875))
                     /locus_tag="CNI01420"
                     /product="expressed protein"
                     /transcript_id="XM_572820.1"
                     /db_xref="GI:58271327"
                     /db_xref="GeneID:3259728"
     CDS             complement(join(420290..420538,420600..420824))
                     /locus_tag="CNI01420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572820.1"
                     /db_xref="GI:58271328"
                     /db_xref="GeneID:3259728"
                     /translation="MRPTLTFLAFLPLVAAFDCSITAFSISYDISPLAGLRTASKDSS
                     TPPTTSEVKVSMNLCGGEGLGKEDGVADEDQCPENTRVCLKLINHKPSSSDPDRVTAV
                     VSFWTVDTPDSDITATPLGKKGEQGLEISVKGQEYAGYVTFFVGMIANAANSHGE"
     STS             420485..420964
                     /standard_name="ha2098"
                     /db_xref="UniSTS:515485"
     gene            421045..422774
                     /locus_tag="CNI01430"
                     /db_xref="GeneID:3259578"
     mRNA            join(421045..421243,421324..421550,421600..421792,
                     421849..422270,422325..422774)
                     /locus_tag="CNI01430"
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41562067|gb|CF707908.1,gi|41562072|gb|CF707913.1,
                     gi|41564922|gb|CF710763.1,gi|41564926|gb|CF710767.1,
                     gi|41576022|gb|CF721863.1,gi|41576032|gb|CF721873.1"
                     /transcript_id="XM_572786.1"
                     /db_xref="GI:58271259"
                     /db_xref="GeneID:3259578"
     CDS             join(421049..421243,421324..421550,421600..421792,
                     421849..422270,422325..422631)
                     /locus_tag="CNI01430"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase regulator"
                     /protein_id="XP_572786.1"
                     /db_xref="GI:58271260"
                     /db_xref="GeneID:3259578"
                     /translation="MALSGQATPSEAGPSKSSLIPGPSAYHESSQFRHWRFSPSTLNR
                     IRSELNTKSVEVARRNTELEKEAQKSLGHDIADPPPAATYLTVNDELLLLRFYCSQVS
                     RICREGFGLPEVVESTAISYVKRFYLKNSVMEWHPKIIMPTCLYLAAKTTNFPIPADQ
                     FVSKIPKLTPEDVLEKEFLVAQSLSFEFWVRGADKALRGWTLDMQDQQNPPLEAIQKA
                     IAPAFTHLSTSYLSDAEFIFTPSQISLACLRMADRKLVEGFLEERYAAHAAAIASKSM
                     NGVEESENGTPVQGPAPLYGMEKVRLLEILDQIEAIIRAVAVELDVKKVKEVDKRLRQ
                     CTNPEKIPGTALYVKRKQEKEAADAAAKATKTLKSQSSAADSDMFFGGSLPLANGQSK
                     SRVPLSPRVNLNSNQKAGGAEMEISDTGMGIQGESGGLLMGGKGLKDVGLPLSKD"
     gene            complement(<422786..>425715)
                     /locus_tag="CNI01440"
                     /db_xref="GeneID:3259456"
     mRNA            complement(join(<422786..422871,422992..423053,
                     423138..423228,423318..423442,423513..423588,
                     423763..423847,423968..424212,424264..424595,
                     424644..424908,424965..425142,425194..425266,
                     425570..>425715))
                     /locus_tag="CNI01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_572681.1"
                     /db_xref="GI:58271049"
                     /db_xref="GeneID:3259456"
     CDS             complement(join(422786..422871,422992..423053,
                     423138..423228,423318..423442,423513..423588,
                     423763..423847,423968..424212,424264..424595,
                     424644..424908,424965..425142,425194..425266,
                     425570..425715))
                     /locus_tag="CNI01440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572681.1"
                     /db_xref="GI:58271050"
                     /db_xref="GeneID:3259456"
                     /translation="MATLGPRNKKITRKQLAAVDLARTCDLIAEPPEPMALRLSGALL
                     VGVARPEQITLGGVEFDWETDWTKELGYIDWNNPLGATRKRRASSVISSSQATPMSKR
                     HHDDGERHEENDSEDEGYESEVARQAKRKKYSASAAATTLHRTPLHPHAPSNSLYTGP
                     DLNFNEEVDLGLNLDFEAPAGANDSFSGPSGRDFDIPFAQPDDYDIGLNFEGFGEARP
                     DEDADMGPPVAYDDELGEKYAPYQAQTLQRSPNRQSSIETVEQNLEAKKKREKKLKTV
                     TFDRALEIDEEEERHAKKTYAERMEKEKRDAELKQVEKQIATIVGRMVDGGGGLEFFD
                     LEMDDWFSHLTHVPKFKWEQDLTRSKKGKYGAFKAHAKDIDVQEPVDGRPDVYDNLPP
                     MAEPDDYVYDVFGNIDLGQYDPIQYDDYDMPVRDRNVGRGSEALDLEYARFPDMPDTS
                     FTPGSLKLSIMTPQEVRRSGSLGGPLNQRRRIRSSSLMSDRPDDDPLMLAPGNDSDLD
                     ETQEARLADLPEAFRPEMLATLEKQCRDFFTGRIQRASARKVFKACSGGRFSLATKKI
                     LSINQPEPWEDINIHFAVKNP"
     repeat_region   426133..426160
                     /rpt_type=tandem
                     /rpt_unit_seq="ttcc"
                     /satellite="microsatellite"
     gene            426173..428051
                     /locus_tag="CNI01450"
                     /db_xref="GeneID:3259647"
     mRNA            join(426173..426245,426297..426645,426704..426894,
                     426942..427062,427107..427150,427261..428051)
                     /locus_tag="CNI01450"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41555688|gb|CF701529.1,gi|41555698|gb|CF701539.1,
                     gi|41572932|gb|CF718773.1,gi|41572942|gb|CF718783.1"
                     /transcript_id="XM_572960.1"
                     /db_xref="GI:58271607"
                     /db_xref="GeneID:3259647"
     CDS             join(426194..426245,426297..426645,426704..426894,
                     426942..427062,427107..427150,427261..427955)
                     /locus_tag="CNI01450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572960.1"
                     /db_xref="GI:58271608"
                     /db_xref="GeneID:3259647"
                     /translation="MSDAEKKRIQLEIARLSGAIHRHTHNASYHPYKSAYPPARGHPR
                     GRSRGTASSRGRGRGGRGAYSLDLRAQNQAASASGSQASTPTGAGSSAQAGPNTEKEE
                     GEIDPEPPAQPAASWVKTARSGHQSLMTAEKRAQLQANSVYKTSKSLASMKPPGKGRQ
                     PRLKIKAVPVPDGTPRVFIDGVTYEFNPGGKGLKRTSDYKQPNTLQWYIDSPKPRLVS
                     VLGIKYRFQPNGDLTLPKSNVPRRGQLCPYFSKTGRCRKGHICKAIHDPDRVAACPNF
                     LRGRCELGPICPLSHRTTAHNTPSCTRFQALSYCTRPNCPYPHVKVSNDAPICEDFAF
                     TGWCDTAEGECPNLHSYDCPEFWSTGKCPRGAKCKLRHTLRAEKGRVAKPESTKEEEK
                     KSKKTEVPPGSFEEQTEFIVFDDEGSPGLALSESEEDDEEENDDDEEENDEGDEDEDE
                     DEDEEDEDEDGHGKQEASADEKDESDEDVKILF"
     misc_feature    427782..427882
                     /locus_tag="CNI01450"
                     /note="GA-rich"
     gene            complement(428058..>429055)
                     /locus_tag="CNI01460"
                     /db_xref="GeneID:3259494"
     mRNA            complement(join(428058..428298,428367..428603,
                     428663..428803,428901..428978,429030..>429055))
                     /locus_tag="CNI01460"
                     /product="splicing factor, putative"
                     /transcript_id="XM_572679.1"
                     /db_xref="GI:58271045"
                     /db_xref="GeneID:3259494"
     CDS             complement(join(428109..428298,428367..428603,
                     428663..428803,428901..428978,429030..429055))
                     /locus_tag="CNI01460"
                     /codon_start=1
                     /product="splicing factor"
                     /protein_id="XP_572679.1"
                     /db_xref="GI:58271046"
                     /db_xref="GeneID:3259494"
                     /translation="MASHLANIFGTEQDRVNCSFYLKIGACRHGDRCSRKHIKPQFSQ
                     TILLPNVYNNPGHTPEGQNMSAEELQADFDRFYEDFFIELAKYGNLQEMIVCDNVGDH
                     LLGNVYARFEYEAEAARAVQALNDRWYAMRPLHAELSPVTDFRESCCRQNELGECKRE
                     GFCNFMHLCHPTRSLVSALQASQRVSRRRAHKGAEVDSGDMGWTPAVAAGGEGDLGWM
                     PERRY"
     gene            <429285..430539
                     /locus_tag="CNI01470"
                     /db_xref="GeneID:3259435"
     mRNA            join(<429285..429401,429457..429515,429589..429683,
                     429743..429923,429980..430154,430208..430539)
                     /locus_tag="CNI01470"
                     /product="vesicular-fusion protein, putative"
                     /transcript_id="XM_572788.1"
                     /db_xref="GI:58271263"
                     /db_xref="GeneID:3259435"
     CDS             join(429285..429401,429457..429515,429589..429683,
                     429743..429923,429980..430154,430208..430447)
                     /locus_tag="CNI01470"
                     /codon_start=1
                     /product="vesicular-fusion protein"
                     /protein_id="XP_572788.1"
                     /db_xref="GI:58271264"
                     /db_xref="GeneID:3259435"
                     /translation="MPSRAEDLIAKAEKKASSSVGWFGSSSSKWEEAADLFSQAAIAF
                     KIDNKWQESGQAYEREAACRLRLNENNDAMNAFHNAAKSYKKSNPEAAVTALHQAIKL
                     LIESGLFRQAADREKEIANIYAQDGIDPAKARDSFVRAGDWYKQEDANATANQCYQQA
                     AEISADLGDFQKSMELYQTVADWSLTSALTKYSVKEYWLRAALCSMAMGDLVTTHKLL
                     TEFAQKDLTFPSTREAKFAKDLMDACEEADLEKFTGTVYQYDQVTKLDNWKTGVLLKI
                     KKALEEDEGGLT"
     gene            complement(<430553..>431370)
                     /locus_tag="CNI01480"
                     /db_xref="GeneID:3259785"
     mRNA            complement(join(<430553..431222,431273..>431370))
                     /locus_tag="CNI01480"
                     /product="mitochondrial ribosomal protein, putative"
                     /transcript_id="XM_572818.1"
                     /db_xref="GI:58271323"
                     /db_xref="GeneID:3259785"
     CDS             complement(join(430553..431222,431273..431370))
                     /locus_tag="CNI01480"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein"
                     /protein_id="XP_572818.1"
                     /db_xref="GI:58271324"
                     /db_xref="GeneID:3259785"
                     /translation="MALPAARSALSARAFIRPAAALNAAASSSRYLSTTTPRHDAPVA
                     TTPGNSETALPVPLPGIKFLSMPPVTPHPPTHGIHVATLHLQAHHPYNLDLVSQFAVH
                     SAHSLNIPTSLPAFLPREKSLYTVLKSPFVKKKAQENFERRTHKRAIKVYDADREAID
                     LWLRYLRQNALPGVGMKAYIHEWVELGFGRKEAEGQNEIEMEVEEKRIQDAAAELVKA
                     LSEGEGEDQAEGVQKIVDAAREEKPAEKLKEEEAKSS"
     gene            431591..432670
                     /locus_tag="CNI01490"
                     /db_xref="GeneID:3259421"
     mRNA            join(431591..431757,431816..431935,431988..432054,
                     432115..432670)
                     /locus_tag="CNI01490"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546125|gb|CF691966.1"
                     /transcript_id="XM_572790.1"
                     /db_xref="GI:58271267"
                     /db_xref="GeneID:3259421"
     CDS             join(431647..431757,431816..431935,431988..432054,
                     432115..432596)
                     /locus_tag="CNI01490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572790.1"
                     /db_xref="GI:58271268"
                     /db_xref="GeneID:3259421"
                     /translation="MAAPISVEYTQDRASDLRENIAAVQQDIDNAAGTGAKPRLVAVS
                     KLKPASDIKALYDAGYRHFGENYIQEMVDKAAALPDDIKWHFIGSLQSNKSKLAASVP
                     NLFILETLSSTKVADLLQKSLPPSRQSKLNVYLQVNTSGEDSKSGLSPLPSNSAELVD
                     LAMHVIEKCPGLKLLGIMTIGSWDASHDPTKPNPDFECLKRTRTELAKALAENGVQGA
                     PKEDELELSMGMSADFVQAIKEGSSSVRVGTRIFGERPKKK"
     gene            complement(432699..436224)
                     /locus_tag="CNI01500"
                     /db_xref="GeneID:3259419"
     mRNA            complement(join(432699..432802,432890..433580,
                     433633..433961,434016..434172,434245..434511,
                     434569..434590,434645..435101,435167..435976,
                     436036..436072,436158..436224))
                     /locus_tag="CNI01500"
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539170|gb|CF685011.1,gi|41539981|gb|CF685822.1,
                     gi|41546119|gb|CF691960.1,gi|41552724|gb|CF698565.1,
                     gi|41552736|gb|CF698577.1,gi|41569902|gb|CF715743.1,
                     gi|41569908|gb|CF715749.1"
                     /transcript_id="XM_572987.1"
                     /db_xref="GI:58271661"
                     /db_xref="GeneID:3259419"
     CDS             complement(join(432776..432802,432890..433580,
                     433633..433961,434016..434172,434245..434511,
                     434569..434590,434645..435101,435167..435976,
                     436036..436072,436158..436213))
                     /locus_tag="CNI01500"
                     /codon_start=1
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572987.1"
                     /db_xref="GI:58271662"
                     /db_xref="GeneID:3259419"
                     /translation="MNDLSAASREKIRRGYRACLHCRSRKAKCDLGDIDAPSSPPCSR
                     CKRESRECVFAPSRRGGNNKKRARTDSEDISREDEDPPRPLGRSTAEVTSGEEHSSQT
                     FPYPQPPPQPRHPSVHNLLGHSPPPARYRQHFGHTSSSSQSSPQTSFSADHATPQTRP
                     TLSNVQSHTATGYPDSPPSPRRRRTANPPLHAADPSSIVVADMRNESDALQILALASG
                     QAANRDGEEERSDRHDGHSVPGTVDSTGMGGHQQQMRGAPSSPEKEMQLAKLAQFPLV
                     KLGILSVEQTTRLVDMFFRCHHHFFPIIPSDGIPRTLEQLSVFAQNEKYLLATIIIIS
                     SRVENTPEMREIHERSWAVMRRWISKVQCLGEPPTIGLVESLLLLAENLPRTSREMMS
                     DDSTETDAIEEPHGVENRQAWQMIGLAVRSAYEMGLDKLGLQLIPETERTLELERAKL
                     VWVYCYLFDRHVSMRLGKGFWTRGGAVCFQGYSSSAQTGPAAALVNFPFLREIRPGDP
                     HSDHPQDDLGSLVQAYLELTMMMSNAHDVLYPNAARTRSLVVYGEYFKYIDEMARSLD
                     GFKILWRRKKWTLFPLTDTVWVMFYYIQLYICAFSFQAHVERATIRGEEEYKLLEQRH
                     KEQGGTTKLAKPSLSLFPRGAAQSPDARYIFQMCDAARELIHICVDNLYPGGALPYLP
                     SRFLLWFTYGAIVLLKAIYSGAMLRADHKRTLDLIDRLCTCFAQCSTDEEYPAVRYGK
                     QLEALRNKLAGLSDVKSTQSPNGSQTVRLPRTQNRAPEVRVSPSQTSTSPNTVPPPQQ
                     FDPRPSTFQPARPHAMPNEHAVNTPTWQLPVLQQYTQPVTFPYPTTPVSFTTGPSTEM
                     SAPYVAPPHQQPFMEFGVAQSSDGLNLGMNDHHNLGFTTLDDWFGFGTAGTAGGAGQG
                     GNGVDDPMGLANVGLDLQDFWMNVGPGEAQGGFPFR"
     misc_feature    434219..434239
                     /note="AT_rich"
     gene            436402..438081
                     /locus_tag="CNI01510"
                     /db_xref="GeneID:3259386"
     mRNA            join(436402..436499,436541..436716,436779..437360,
                     437429..438081)
                     /locus_tag="CNI01510"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542699|gb|CF688540.1,gi|41542705|gb|CF688546.1,
                     gi|41549200|gb|CF695041.1,gi|41549652|gb|CF695493.1,
                     gi|41549666|gb|CF695507.1,gi|41551670|gb|CF697511.1,
                     gi|41552936|gb|CF698777.1,gi|41555737|gb|CF701578.1"
                     /transcript_id="XM_572792.1"
                     /db_xref="GI:58271271"
                     /db_xref="GeneID:3259386"
     CDS             join(436471..436499,436541..436716,436779..437360,
                     437429..438066)
                     /locus_tag="CNI01510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572792.1"
                     /db_xref="GI:58271272"
                     /db_xref="GeneID:3259386"
                     /translation="MADNAAAPAPLYLPAILQNPANRAARQVHAHNAQQREKAAARRE
                     RDTRSNAAPEYNGKGKRVIRRLDNAAFASNPHIVRPTKTDYAPPVPLQARPSRPSFPA
                     GAIPRSTPVPPALVPERDPFSPDSRQGSFSTSLKGTRAMLRKRGKRAEGLVTKADAEI
                     RKWLGGEWGDLNAQEDGQWRVIDERLVDYASEAGAASTSSAARRLPTHRGLDILPDLP
                     IENGQIPAILEISRSPAHLTWCLSESFDRLVIHLLSRYYELASWSQDLATTSGQILRV
                     THVVVPSIAQPNRHPIAGHSLATPETSEVSGQSSSESNYHSSYHSLSEGESNESSGFT
                     ESDSDTATEMGDAEIVSYSVEGDTTITPIPEMSDLSLSENENELIRTFSTTSSRYASS
                     EGGSDFGTLGDSLTIPRTSGHESEDSMAGGWVDMDDESDFGDIPGFSRLRIDAMYGRI
                     NPGVRVSARGWESKPTFFEYLYGV"
     gene            complement(438062..438896)
                     /locus_tag="CNI01520"
                     /db_xref="GeneID:3259561"
     mRNA            complement(join(438062..438308,438368..438450,
                     438524..438755,438829..438896))
                     /locus_tag="CNI01520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572816.1"
                     /db_xref="GI:58271319"
                     /db_xref="GeneID:3259561"
     CDS             complement(join(438271..438308,438368..438450,
                     438524..438755,438829..438877))
                     /locus_tag="CNI01520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572816.1"
                     /db_xref="GI:58271320"
                     /db_xref="GeneID:3259561"
                     /translation="MFFHLSALSVFLVVAFLLIYYRARLFPLAARFLPDTVVNRLSHY
                     TPLESYSFADQAEAGMSSGNFDLEANNGEGSGEGRLGLDEAGVEEVRRIMAIERCTFD
                     QARLIRHNRILAKNGIAPDGTPLDRKAITHL"
     gene            <439129..440761
                     /locus_tag="CNI01530"
                     /db_xref="GeneID:3259490"
     mRNA            join(<439129..439668,439719..440023,440073..440238,
                     440293..440468,440522..440761)
                     /locus_tag="CNI01530"
                     /product="transport-related protein, putative"
                     /transcript_id="XM_572677.1"
                     /db_xref="GI:58271041"
                     /db_xref="GeneID:3259490"
     CDS             join(439129..439668,439719..440023,440073..440238,
                     440293..440468,440522..440726)
                     /locus_tag="CNI01530"
                     /codon_start=1
                     /product="transport-related protein"
                     /protein_id="XP_572677.1"
                     /db_xref="GI:58271042"
                     /db_xref="GeneID:3259490"
                     /translation="MSGLSLAQQLKQLHSNNVSVPDPESAYSNLDSHDIQRKGDEGRE
                     HYVDVGPSRLRMELGGTGGGTLTGPKYEGVKTGRMKIFDDDDDDDDDREGNGSEEGSD
                     GEGDEDEDGDEDDEDEEDEDEDEEESDEDEQGEDEDEDEEEQPQPRANGSKQALDPVA
                     SLRNSRLKDVEKGQAIRKQKALFESLITLRITFQKALTASNTVPPTLPEDPENELAYK
                     KASILKSLGELNERLFTLRESISLPGELGEDVSLGKRKRAEGDDAQGQAYWIKAAKES
                     LGIADRSHPQLLPILNKWSSKIQAASLQLGSKQAGGSKFLQQMKNGAGGVVEAIESGI
                     NSKREAEKTLMESEETGYRALLREVIESRSGSGPAADLTHLRREKKKKREAERGGSKG
                     RKLRYTVHEKAQNFVVPIPLSHGWHEEQVDELFSSLFGGVGMKGATAEKTVGLDVGTA
                     DEGLAELGGLRVF"
     repeat_region   439375..439550
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(441062..444502)
                     /locus_tag="CNI01540"
                     /db_xref="GeneID:3259601"
     mRNA            complement(join(441062..441358,441418..441900,
                     441953..441975,442036..442721,442816..443482,
                     443538..443697,443759..444022,444088..444205,
                     444331..444362,444436..444502))
                     /locus_tag="CNI01540"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544242|gb|CF690083.1,gi|41572614|gb|CF718455.1,
                     gi|41572619|gb|CF718460.1"
                     /transcript_id="XM_572969.1"
                     /db_xref="GI:58271625"
                     /db_xref="GeneID:3259601"
     mRNA            complement(join(441062..441358,441418..441900,
                     441953..441975,442036..442721,442816..443482,
                     443538..443826))
                     /locus_tag="CNI01540"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544248|gb|CF690089.1,gi|41561669|gb|CF707510.1"
                     /transcript_id="XM_572968.1"
                     /db_xref="GI:58271623"
                     /db_xref="GeneID:3259601"
     CDS             complement(join(441232..441358,441418..441900,
                     441953..441975,442036..442721,442816..443101))
                     /locus_tag="CNI01540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572968.1"
                     /db_xref="GI:58271624"
                     /db_xref="GeneID:3259601"
                     /translation="MRIPLDVAHSVVRALHTIRSDSAQSGNVTQTSVQIPSNQPAWAE
                     PLSPNLAAFSIEMDRWPDWAGQKVGEPNKYVNQVLTNLGERTGVMPYLRVGANSEDRA
                     TIDLSYEVMNATFPAATEEVPVPEADSISIGRDFYALSGNLPDGTPFQWGVNLASLNR
                     TETIAQAKLIADTFQGDRAHLTANVHLDGLEIGNEPDFYSSGKGLGAAWTPANYSQTW
                     LDYAQGVSEVIQLGGDGPYLTPGAMTGFEAPAWTPEASLEAGILDDDDIRSVVKQFNQ
                     HVYSGAFADGYPLSPTGSLMDKGTVRANLTTRTYGLKAVKSEGLQYVFAEGNSYANHG
                     QPGTSNTAEAAIWAIDWMLQLASMGVERMHFHHGVGFRYNFFQPVATDADHDDGTNMT
                     SRAHILPAYHAALIVNEAIGTNGNSYVAEISTPNDNVVAYGIWEDGDLVRMVVTSTEV
                     YTTDDEDAQEGRNKFELNLVGVEGRNATVKRLFVPQTTAMHGLTWAGQFFDTEDGKPT
                     GEVSEETLDNGVLQIDASSAVLICFK"
     gene            444720..>451240
                     /locus_tag="CNI01550"
                     /db_xref="GeneID:3259712"
     mRNA            join(444720..444945,445002..445187,445244..445427,
                     445481..445687,445731..445895,445924..446031,
                     446079..446157,446208..446221,446277..446693,
                     446748..446830,446883..447021,447071..447361,
                     447417..447653,447708..447724,447776..447879,
                     447931..447960,448018..448212,448268..448332,
                     448387..448470,448531..448641,448690..449531,
                     449584..>451240)
                     /locus_tag="CNI01550"
                     /product="RNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556982|gb|CF702823.1,gi|41556990|gb|CF702831.1"
                     /transcript_id="XM_572794.1"
                     /db_xref="GI:58271275"
                     /db_xref="GeneID:3259712"
     CDS             join(444848..444945,445002..445187,445244..445427,
                     445481..445687,445731..445895,445924..446031,
                     446079..446157,446208..446221,446277..446693,
                     446748..446830,446883..447021,447071..447361,
                     447417..447653,447708..447724,447776..447879,
                     447931..447960,448018..448212,448268..448332,
                     448387..448470,448531..448641,448690..449531,
                     449584..451240)
                     /locus_tag="CNI01550"
                     /codon_start=1
                     /product="RNA helicase"
                     /protein_id="XP_572794.1"
                     /db_xref="GI:58271276"
                     /db_xref="GeneID:3259712"
                     /translation="MSVQHYLGTLFQPQPPTFEDSWKAVISSWGPSQFRAQAIDDFEP
                     VLETSPWPSVLNYLTETGLPSVTLEPPPIESTPAPESSSSTKADLVDRLRQHIPATFG
                     SLVNLLSTPRSNDDIQSELIEVMGFEGDALSLVEELLKPGARQDVIDSCLRSTPNAQD
                     KKETRPVQMDKPAYLPNARMTVKGKVKDRKKIIDISDIVGSAEDINKRLQEQIEGPKA
                     MFSEDGPLTLMKIQKMVEQEILPHVYTATGNKFVPLSHGGKFALPEGTKREYTDVGST
                     FLLMTYEEVIIPPANPIPPKKTERPVKIAELSPIARGCFPKYIQLNRMQSIVQPTAMN
                     TNENMLICAPTGAGKTDVAIMSIIRVLSQHVIDGPTSHPSGFNINRNAFKVIYVAPMK
                     ALAAEIVSKFAKRLAWLSIKVRELTGDMQLTKQEIEETQIIVTTPEKWDVVTRKPTGE
                     GELASKVKLLIIDEVHLLAEDRGAVIETIVARTLRQVESSQSLIRIVGLSATLPNYVD
                     VGDFLRVNRYQGLFYFDASFRPVPLEQHFIGVSGKPRSAVSARNMDRVVFEKVSELVE
                     AGHQVMVFVHARRDTVKTAQTLKEMALEEGVSTFFQTDGHAKFSQYRAELSKSKNKEM
                     KELFDAGFGIHHAGMLRTDRNMMEKMFEDGCINVLCCTSTLAWGVNLPAHAVIIKGTQ
                     VYDTGKGSFMDLSVLDVLQIFGRAGRPGYATSGVGFICTTHDKVDHYVTSVMSQTPIE
                     SKFIPGMTDALNAEVALGTITNVQEAMQWLSYTYLFVRMKKNPWVYAMAHDVTKDDPQ
                     LGNKRNELIVQAARLLQKARMVRYDDLANTFGITDLGRIAAKYYLRFSTIETFNSKFN
                     PRMSNADLFQMLCEATEFEQIQLRDSEVEELEAIIGSGVIPLEVAGGAINKRNKVNIL
                     LQAHISNVYINDFALVSDAAFVAQNAGRIIRALLEIALSRNWANCSYLLVELSKCIER
                     RQWVYDHGLAQLKVLQRETIHKLTQYTPDSMTISDFRDMTAQENGEFIHMNEKHGQAV
                     LDAAMMFPTVNLTHTLRPITHDLLQITVKVTPQFKWHNKISGSSEPFYVWVQDEEGLN
                     IYQWRSVRVTPSTTVIDIDFFLPFDDVPPDSISIISISDKWLWSYEQLVIQLGDLIMP
                     PPPKESTQILGIPFLRRSCFNDPQLEQRYAQTLDTLNTIQSHAFWMLYNTSMNAVVSS
                     PVGSGKTLLAEGAIWNAFRHNKESVVLIMVPERYAVHETVARLRNLCPPKRRVIIRPL
                     FNVSDFDQLLSGGPAIGVTTPFAVLSNEKIDNFLSTQRLGLYVFEDLHLLDEVYELAV
                     SKILTFARTARTRIVGTTSSLSDPSDLAEWLGVDPGPLDQWGKPVASQPPALFSFAPS
                     DRGNHISVSIKSFTIPHGPTLLRSMIKPTYDILKSVTGGAIIFVPSVQACATVAADLV
                     TQSGTEMNVDGFLSRPRDEVEPFAERLKDEKLFEPVLHGIGYITRDMAPTDIAIVLEL
                     FASGIIRAIIAPRQSCWTLPVRGESVIIMGTQYVRMEARPEGKGPKAKPEKHLVSYSA
                     KELVKMQGFAVVSAAPTAPGGRMFIMCQAEQQVMISRVLKEGLPLESKILDLLSRRST
                     PSSSIDPRAIQALNNFFKGRRPPPRPTVDRPRRPDGRKADMMDIVNWSFLSVRVKSNP
                     SYYQLVKGSEAEGISRVIDGWFDAMDGIKVETVEEQRRLTVEDAEAQEDRKDDVEKAD
                     LNSDQEGGVANVEENGNLDESEQKGTASEKSGQSVGLCNTLEVN"
     gene            complement(451427..452540)
                     /locus_tag="CNI01560"
                     /db_xref="GeneID:3259648"
     mRNA            complement(join(451427..451549,451605..451721,
                     451783..451862,451922..451945,452003..452055,
                     452105..452163,452220..452279,452333..452350,
                     452417..452540))
                     /locus_tag="CNI01560"
                     /product="sterol-binding protein"
                     /transcript_id="XM_572814.1"
                     /db_xref="GI:58271315"
                     /db_xref="GeneID:3259648"
     CDS             complement(join(451629..451721,451783..451862,
                     451922..451945,452003..452055,452105..452163,
                     452220..452279,452333..452350,452417..452446))
                     /locus_tag="CNI01560"
                     /codon_start=1
                     /product="sterol-binding protein"
                     /protein_id="XP_572814.1"
                     /db_xref="GI:58271316"
                     /db_xref="GeneID:3259648"
                     /translation="MSDLTEPGFKTSDVLLSLASVFEKMPDDEKKSQIKKTNGVFQLN
                     VKNSQGKEAVWAIDLKNEGKVTKGPAKRPDVSIALSDDTFIGLADGKVNAQKAFMTGG
                     LKVKGNIMLAVCLTFFAMFFAMFRDWQLTIPCVNNT"
     gene            453491..456872
                     /locus_tag="CNI01570"
                     /db_xref="GeneID:3259550"
     mRNA            join(453491..454306,454355..454486,454603..454733,
                     454937..455078,455152..455353,455594..455704,
                     455752..456107,456171..456258,456310..456363,
                     456417..456427,456474..456582,456642..456702,
                     456755..456872)
                     /locus_tag="CNI01570"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536347|gb|CF682188.1,gi|41559090|gb|CF704931.1,
                     gi|41559106|gb|CF704947.1"
                     /transcript_id="XM_572675.1"
                     /db_xref="GI:58271037"
                     /db_xref="GeneID:3259550"
     CDS             join(453641..454306,454355..454486,454603..454733,
                     454937..455078,455152..455353,455594..455704,
                     455752..456107,456171..456258,456310..456363,
                     456417..456427,456474..456582,456642..456702,
                     456755..456779)
                     /locus_tag="CNI01570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572675.1"
                     /db_xref="GI:58271038"
                     /db_xref="GeneID:3259550"
                     /translation="MDFELPNHNDFRNNSAPLAPIITSVPVTTSSTTPLPSFRQSQFG
                     EVSTPHAANVTFPNVPTPNFDEYTPAGPSTRPVAINNCKHTPKTASPRRRAHTIDTPE
                     YIPSPVDTPDTSRPVIGAFGRSPRDDPATPGPLKLLPLKGETNKRFQNVSKHFQVFVA
                     KKDNGPVGGKKGGKEKGKKKQPMAKSKSLSGLGLGGGVLRGLRICLPPGDKPMSIQQE
                     AWDHIIELGGTVVLYPDKATTHVIYDSDNRTKAKLAKLLRLQSLDELPGVLLPVENFR
                     SFRVDSLFSRVMSTGSLDQRNPRLAGMANQRLTRDSVPHHAVETEHTASKGSGWKKGE
                     EDQRDALDEMIEGVKDGSLPEDETADPPSDDRAMENEANSTARFSKGGQEKSRKSEKG
                     PNEWLAEKFDQLHDLYEGQVGKNPHSIRQYRNEVVGQINEFISGVPGRTFYEDNEHAR
                     CVALFKDIYGVGRQYANELYRMGARTITDLRTGRFPLSTGQQIGLALYEDLRSRIPRE
                     ECKQIYELIKLEAKTVDEKLWVEIMGSYRRGSETSGDVDILITRDDADGKSHKGAIKK
                     LVDKLKAKGVITHELSAPHDWNALEAKWMGVGRVGQSAMYRRIDILCVPYESWGASLI
                     YFTGNELFNRSLRLYARRLGYNLNQRGLYRNVVRARDGTKVLEGDRVASRTEEGIFQE
                     LGLRWRHPHHRRP"
     gene            complement(456844..457680)
                     /locus_tag="CNI01580"
                     /db_xref="GeneID:3259602"
     mRNA            complement(join(456844..457200,457254..457325,
                     457391..457680))
                     /locus_tag="CNI01580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572673.1"
                     /db_xref="GI:58271033"
                     /db_xref="GeneID:3259602"
     CDS             complement(join(456903..457200,457254..457325,
                     457391..457617))
                     /locus_tag="CNI01580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572673.1"
                     /db_xref="GI:58271034"
                     /db_xref="GeneID:3259602"
                     /translation="MSDQYSAASASSLSLTQKLTDLRSLLSTQKTVMLVTHAPNGRLH
                     GRVMAIAEITKDWKFFFIYDRESYKEQEVDNDFHVNISVDAMAYNKGWASIAGKAKRN
                     DSPEVIQRLYNPTVKAWFADKGDGVHDGSANDPRVAVLEVSIEEVRHYHQEKTVIGTV
                     IDVVASAVKGETATPGDIRQISGEEISSAWARGELKEP"
     gene            complement(459414..460531)
                     /locus_tag="CNI01590"
                     /db_xref="GeneID:3259583"
     mRNA            complement(join(459414..459604,459658..459697,
                     459753..459981,460044..460053,460112..460290,
                     460345..460531))
                     /locus_tag="CNI01590"
                     /product="manganese superoxide dismutase, putative"
                     /transcript_id="XM_572672.1"
                     /db_xref="GI:58271031"
                     /db_xref="GeneID:3259583"
     CDS             complement(join(459502..459604,459658..459697,
                     459753..459981,460044..460053,460112..460290,
                     460345..460461))
                     /locus_tag="CNI01590"
                     /codon_start=1
                     /product="manganese superoxide dismutase"
                     /protein_id="XP_572672.1"
                     /db_xref="GI:58271032"
                     /db_xref="GeneID:3259583"
                     /translation="MITAITRTALPRATLRTSLATMSTIRAKHTLPPLPYAYDALEPS
                     ISAEIMNLHHTKHHQTYVNGLNAAEESLQKASAAGDFKAAIALQPALKFNGGGHINHS
                     LFWKNLAPTGSAQVKVPTSGVFYDQVQADFGGFENLKKEMNAKTAAIQGSGWGWLGYN
                     KATKKLEIVTTPNQDPLLSHVPIIGIDIWEHAFYLQYKNVKPDYLNAIWNVINYEEAE
                     SRLKAAQ"
     gene            <460810..>461555
                     /locus_tag="CNI01600"
                     /db_xref="GeneID:3259706"
     mRNA            join(<460810..460829,460877..461037,461090..461165,
                     461221..461268,461324..461351,461411..461480,
                     461530..>461555)
                     /locus_tag="CNI01600"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_572796.1"
                     /db_xref="GI:58271279"
                     /db_xref="GeneID:3259706"
     CDS             join(460810..460829,460877..461037,461090..461165,
                     461221..461268,461324..461351,461411..461480,
                     461530..461555)
                     /locus_tag="CNI01600"
                     /codon_start=1
                     /product="pre-mRNA splicing factor"
                     /protein_id="XP_572796.1"
                     /db_xref="GI:58271280"
                     /db_xref="GeneID:3259706"
                     /translation="MSYFMTHLHSGWHVDQAILVEEDRVVCIRFGHDHDEECMAMDET
                     LYGVSEKVQNFAVLYLVDITEVPDFNKMYELYDNCTLMFFYRNKHIMIDLGTGNNNKI
                     NWAITDKQELIDIIETVYRGASKGRGLVVSPKDYSTRHKY"
     gene            complement(462048..>463251)
                     /locus_tag="CNI01610"
                     /db_xref="GeneID:3259751"
     mRNA            complement(join(462048..462466,462532..462657,
                     462707..462785,463009..463111,463185..>463251))
                     /locus_tag="CNI01610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572984.1"
                     /db_xref="GI:58271655"
                     /db_xref="GeneID:3259751"
     CDS             complement(join(462104..462466,462532..462657,
                     462707..462785,463009..463111,463185..463251))
                     /locus_tag="CNI01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572984.1"
                     /db_xref="GI:58271656"
                     /db_xref="GeneID:3259751"
                     /translation="MSSILSAIWPFLSSYRPNAARDPEREKQPLRFGAFEATYKPPGF
                     GIRGPRNDKEAQRLYNHIRTVAFWLDAAPLLADLGLPFRAGLDDIISLVPIYGDILSG
                     ILQLYQVWLCFIFGVPRTLLGYMLFNVLIDCVVGIVPLIGDFLDNLFKSNLRNLALLE
                     DWLLTSPTATRSYHILLMPNTTDFMPKPKTSKFSSSWFGGGHGKSDGDEERERERTTG
                     KVRQTRRMGRDEGEVPHAQTDVPPPTL"
     gene            <463648..>464179
                     /locus_tag="CNI01620"
                     /db_xref="GeneID:3259697"
     mRNA            join(<463648..463847,463975..>464179)
                     /locus_tag="CNI01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_572671.1"
                     /db_xref="GI:58271029"
                     /db_xref="GeneID:3259697"
     CDS             join(463648..463847,463975..464179)
                     /locus_tag="CNI01620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572671.1"
                     /db_xref="GI:58271030"
                     /db_xref="GeneID:3259697"
                     /translation="MKEKQVPVTSKSEGREEAERSSALGVDDEKKQSSDHQQFSGESG
                     NVQTLQKKKSFFGSVNLKKKVKRVAPTPSFTSTKVSANAETVVEQNQSDFPEHPSVGQ
                     QVHGQSSILPQKASKDCVMASSYDVFQSPSCY"
     gene            complement(<465374..>466243)
                     /locus_tag="CNI01630"
                     /db_xref="GeneID:3259683"
     mRNA            complement(join(<465374..465425,465476..465526,
                     465581..465682,465736..465761,465811..466172,
                     466222..>466243))
                     /locus_tag="CNI01630"
                     /product="aminoacyl-tRNA hydrolase, putative"
                     /transcript_id="XM_572812.1"
                     /db_xref="GI:58271311"
                     /db_xref="GeneID:3259683"
     CDS             complement(join(465374..465425,465476..465526,
                     465581..465682,465736..465761,465811..466172,
                     466222..466243))
                     /locus_tag="CNI01630"
                     /codon_start=1
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="XP_572812.1"
                     /db_xref="GI:58271312"
                     /db_xref="GeneID:3259683"
                     /translation="MSTIRMEGIFPSIIFSILAFTLGYQAHSLLSRSTSAVAAPKSPK
                     GTRSPRKFQQQDDYESASDTESDASDNAAALATDLSNIKYSSFEEMKLVLVVNDELKM
                     TKGKIAAQAGHATLACAMTLKEANPKLFKAWQMQGQPKIALRGANTEEIETLAAQARS
                     VNLCARTIRDAGRTQVAPGSKTIVGIGPGPAKLINTITGKLKLL"
     gene            466465..467509
                     /locus_tag="CNI01640"
                     /db_xref="GeneID:3259523"
     mRNA            join(466465..466631,466695..466800,466881..466980,
                     467035..467277,467334..467509)
                     /locus_tag="CNI01640"
                     /product="acetyltransferase, putative"
                     /transcript_id="XM_572798.1"
                     /db_xref="GI:58271283"
                     /db_xref="GeneID:3259523"
     CDS             join(466476..466631,466695..466800,466881..466980,
                     467035..467277,467334..467442)
                     /locus_tag="CNI01640"
                     /codon_start=1
                     /product="acetyltransferase"
                     /protein_id="XP_572798.1"
                     /db_xref="GI:58271284"
                     /db_xref="GeneID:3259523"
                     /translation="MTATYSTTGTVSNPLDLSQIQGEHTSVNLSSSNKKNVKPNVKVT
                     LTSLTPNNSGTLRKINSVVIPIVYSEKFYKDVLDPLLDDVNKLIYYADIPVGAICCKY
                     ENLSKGSKEPPTLVILTLAILAPYRSLSLGTSLLRSAMHAAIHPTTPPPPIPSDKQTN
                     TRAQLTVAAPRVKVNRALAHVQVGNDEAKRFYERLGFKEVGIEENYYSKMEPRGAILM
                     VCDDLAIALGEKTEANGSV"
     gene            complement(467504..469750)
                     /locus_tag="CNI01650"
                     /db_xref="GeneID:3259502"
     mRNA            complement(join(467504..468440,468496..468963,
                     469003..469116,469164..469583,469643..469750))
                     /locus_tag="CNI01650"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537034|gb|CF682875.1,gi|41541354|gb|CF687195.1,
                     gi|41542915|gb|CF688756.1,gi|41561214|gb|CF707055.1,
                     gi|41565159|gb|CF711000.1,gi|41567564|gb|CF713405.1"
                     /transcript_id="XM_572670.1"
                     /db_xref="GI:58271027"
                     /db_xref="GeneID:3259502"
     CDS             complement(join(467820..468440,468496..468963,
                     469003..469116,469164..469400))
                     /locus_tag="CNI01650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572670.1"
                     /db_xref="GI:58271028"
                     /db_xref="GeneID:3259502"
                     /translation="MSTPSNEPFFPKDRKRSAHWSDSDTDILVDVLLRERDTGRTVDN
                     GFKPEVWKEAARLLENSNFVGGPKTPEACRSRWQRLQRDYRLVKEMEVLPGFSWDHNT
                     HRLSASPEAWMNAEKEMDAYKYRKIHLPHYDSLAILCANDSCRRAPRNTKTRHTSISS
                     SSSLMNLSTPNPNTSTPAQMAQVPQPITMAQVGHLSRQHSHSSLPTNGQMTPMSSSQH
                     HPHGHPGMHDPVNGNGLVQLGATSMQTDHNVFSWESGEQGGGEGDFDGSFGLSNGSQA
                     FLPQKRTMPFDPSLLNGSSQQHHMIPQGSPPKKPRTSSRPMITHQLSGMHQNGPFGYS
                     MQNTGNPAHLDTGNPGRGPNAGSGNQGDQQSPEFSTSTPAMLDHTLLQTPPGLRIKPY
                     TPPTPGSAPNLTLQAPEMAVAGLTEAQRRTEALLQLQLQESEMRDEDMVEVMAEFEMN
                     VAAADTYLAIKREPLRKMWLANLVKRRNL"
     gene            469842..471845
                     /locus_tag="CNI01660"
                     /db_xref="GeneID:3259758"
     mRNA            join(469842..470149,470203..470321,470374..470478,
                     470537..470661,470723..471365,471440..471542,
                     471608..471845)
                     /locus_tag="CNI01660"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543107|gb|CF688948.1,gi|41545972|gb|CF691813.1,
                     gi|41561487|gb|CF707328.1,gi|41563673|gb|CF709514.1,
                     gi|41563683|gb|CF709524.1"
                     /transcript_id="XM_572801.1"
                     /db_xref="GI:58271289"
                     /db_xref="GeneID:3259758"
     mRNA            join(469843..470149,470203..470321,470374..470478,
                     470537..470665,470727..471365,471440..471542,
                     471608..471845)
                     /locus_tag="CNI01660"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41543115|gb|CF688956.1"
                     /transcript_id="XM_572800.1"
                     /db_xref="GI:58271287"
                     /db_xref="GeneID:3259758"
     CDS             join(470012..470149,470203..470321,470374..470478,
                     470537..470665,470727..471365,471440..471542,
                     471608..471757)
                     /locus_tag="CNI01660"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor"
                     /protein_id="XP_572800.1"
                     /db_xref="GI:58271288"
                     /db_xref="GeneID:3259758"
                     /translation="MPLDLNYAPGSEDEEEDNIDDEDFPGPSSRRQARGAAGKGKGKN
                     KDTGRQAWEGEYQKSWDIVQEDESGSLESAVETLLARGRRKRALMSDTPVRRSIIRHV
                     FIIIDLSESMLDKDYRPTRFEVILGYLRTYVVEWFDQNPLGQIGVIAMRDRLSEVLIP
                     MGGNPEEIVRALSDKRKLEPSGEPSLQNGLVMAKGGMAHLPSTSSLEILVIFSAISTA
                     DPDGPITIHNVLDTLATGHIRTSILSLSGEIKICKQIAERTGGKFGVALDQEHLKDLL
                     WETIPPPATTIAPVTANVRSALAAGGRGPNQTGERAPAGDLMVMGFPIRLPLGGETMC
                     ACHGLLRKGGYLCPRCGSKLCDVPTDCEVCGLMVVSSPHLARSFWFLFPVANYGPLSI
                     EDVVESSETCFGCDSEFSDATAINAGVAQVEDGVSPTGRYRCAKCKHDFCADCDLYIH
                     DTLHTCPGCS"
     CDS             join(470012..470149,470203..470321,470374..470478,
                     470537..470661,470723..471365,471440..471542,
                     471608..471757)
                     /locus_tag="CNI01660"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor"
                     /protein_id="XP_572801.1"
                     /db_xref="GI:58271290"
                     /db_xref="GeneID:3259758"
                     /translation="MPLDLNYAPGSEDEEEDNIDDEDFPGPSSRRQARGAAGKGKGKN
                     KDTGRQAWEGEYQKSWDIVQEDESGSLESAVETLLARGRRKRALMSDTPVRRSIIRHV
                     FIIIDLSESMLDKDYRPTRFEVILGYLRTYVVEWFDQNPLGQIGVIAMRDRLSEVLIP
                     MGGSPEEIVRALSDKRKLEPSGEPSLQNGLVMAKGGMAHLPSTSSLEILVIFSAISTA
                     DPDGPITIHNVLDTLATGHIRTSILSLSGEIKICKQIAERTGGKFGVALDQEHLKDLL
                     WETIPPPATTIAPVTANVRSALAAGGRGPNQTGERAPAGDLMVMGFPIRLPLGGETMC
                     ACHGLLRKGGYLCPRCGSKLCDVPTDCEVCGLMVVSSPHLARSFWFLFPVANYGPLSI
                     EDVVESSETCFGCDSEFSDATAINAGVAQVEDGVSPTGRYRCAKCKHDFCADCDLYIH
                     DTLHTCPGCS"
     misc_feature    471416..471438
                     /locus_tag="CNI01660"
                     /note="AT_rich"
     gene            complement(471858..474691)
                     /locus_tag="CNI01670"
                     /db_xref="GeneID:3259608"
     mRNA            complement(join(471858..472490,472571..472729,
                     472794..474023,474085..474691))
                     /locus_tag="CNI01670"
                     /product="peptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533589|gb|CF679430.1,gi|41533598|gb|CF679439.1,
                     gi|41550778|gb|CF696619.1,gi|41550781|gb|CF696622.1,
                     gi|41553307|gb|CF699148.1,gi|41553851|gb|CF699692.1"
                     /transcript_id="XM_572810.1"
                     /db_xref="GI:58271307"
                     /db_xref="GeneID:3259608"
     CDS             complement(join(471995..472490,472571..472729,
                     472794..474023,474085..474452))
                     /locus_tag="CNI01670"
                     /codon_start=1
                     /product="peptidase"
                     /protein_id="XP_572810.1"
                     /db_xref="GI:58271308"
                     /db_xref="GeneID:3259608"
                     /translation="MVKPHILTVLSILPLSFATVATVATLDNTDSHNGLSPESVHHAA
                     TRQAVDMPERAITRDRGHGEQLIRKASARKRSVERRRRSTPPPFVGVGGVELDLVGRE
                     DRGMVKRSDNGTLLPLGTSQNTFVVPVSIGSPPTTYPLQLDLASSDILLASTLCGSHC
                     PTSLGTTTNPYYDVSKHSAGFESIDSNQTVWNTSYADGTVASGFLATETIILGDSVLQ
                     GQVFGMINATNLTLSSQKSSGILGLGFPRLSTLTHVLFEKHEQANTIASTSSSSLANE
                     TSVSTVSNATGTASASTASASRPAYFPTLLENLVRTPHLPYPVFALALSAPIKSSSTS
                     TSSSSSAAASASSRYRPSIGSLTLGGLSSYYVDDTEGSGRTVGDIEWHDVVPFGQPVS
                     ANDTATEEQALTASTGTLSASSTSENSEAASTSDAQRKRSDESQLDAFPSTVSELSQE
                     EYLYWALDLESVTVNGTDVGINSSYASIGLGSVALLDAGFNGIAGPQQDVVKLFRLIT
                     DAREVSEGQWAVPCNTRMTLGFSFGGRYIQLQPSDWIYAGIAQSSMCLAWPIAQPATG
                     DGIDWQLGTPFLKNVYTIFSYGINGKQAPLVGFLPLESTSVASNSTDDYNSITTSTAD
                     GNSPTPTSIAALSLTTTLQTALPNAVLPDPTFPTPTYVYSATPALLQPGAPQYLGLAN
                     SSAYEVMDVPVISVDNSAVSSIAVGNNGGGSNVSDDGSSSAAPRRMGAETVVGMGVMV
                     IGMIMGGLLV"
     gene            complement(474826..475689)
                     /locus_tag="CNI01680"
                     /db_xref="GeneID:3259372"
     mRNA            complement(join(474826..475056,475166..475293,
                     475393..475485,475654..475689))
                     /locus_tag="CNI01680"
                     /product="trafficking-related protein, putative"
                     /transcript_id="XM_572808.1"
                     /db_xref="GI:58271303"
                     /db_xref="GeneID:3259372"
     CDS             complement(join(474904..475056,475166..475293,
                     475393..475485,475654..475672))
                     /locus_tag="CNI01680"
                     /codon_start=1
                     /product="trafficking-related protein"
                     /protein_id="XP_572808.1"
                     /db_xref="GI:58271304"
                     /db_xref="GeneID:3259372"
                     /translation="MTAGLKTVILLSFILAAGFLLVILSCALWANWLPLLVALTFILA
                     PFPNWICSRCASADDLSPEFNSAYIDFGRFLTGMLVMTGLSLPLLLTHSALIQPAACW
                     MSIAGGMLVYGTILVYAGWFGGGNEEEF"
     gene            complement(475980..476649)
                     /locus_tag="CNI01690"
                     /db_xref="GeneID:3259740"
     mRNA            complement(join(475980..476168,476221..476362,
                     476420..476569,476615..476649))
                     /locus_tag="CNI01690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572805.1"
                     /db_xref="GI:58271297"
                     /db_xref="GeneID:3259740"
     mRNA            complement(join(475980..476168,476221..476362,
                     476420..476569,476615..476636))
                     /locus_tag="CNI01690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572806.1"
                     /db_xref="GI:58271299"
                     /db_xref="GeneID:3259740"
     CDS             complement(join(476109..476168,476221..476362,
                     476420..476569,476615..476634))
                     /locus_tag="CNI01690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572805.1"
                     /db_xref="GI:58271298"
                     /db_xref="GeneID:3259740"
                     /translation="MSHGFRQDMPPPGGYETLRYKRNLPLKGPSGAVLFGGVFAICTL
                     GFYRLGQGNVEKRELKREKAWSRINVVPLLLAEQDRDAYRRQQAALAREKEIMKDYPG
                     WEAGKRTYNSSRYTPNTIVVL"
     gene            <476769..478227
                     /locus_tag="CNI01700"
                     /db_xref="GeneID:3259564"
     mRNA            join(<476769..476797,476843..477246,477293..477481,
                     477542..478227)
                     /locus_tag="CNI01700"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560521|gb|CF706362.1,gi|41566903|gb|CF712744.1"
                     /transcript_id="XM_572669.1"
                     /db_xref="GI:58271025"
                     /db_xref="GeneID:3259564"
     CDS             join(476769..476797,476843..477246,477293..477481,
                     477542..478053)
                     /locus_tag="CNI01700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572669.1"
                     /db_xref="GI:58271026"
                     /db_xref="GeneID:3259564"
                     /translation="MNRFANAFSAAIPTPASSDAVSLYSPEPAFPPATARDDRHPAPV
                     YDDPRSPHHAAGHAARQPARPHTRPAFLRHLTDDGPRSQASTPRGRSESRERDRSVRV
                     NLMAAAATTARRGWGMSSATGTTRMNRMADGPDGKYAVGGGQFLRVFQVSDPCSGSST
                     PIIQEDPKERTLLARGQGGATISEVVNLWKSNWPVGKGVNDVNWGVAAWDHKLVTAAP
                     NGNFMLFDVEKGRLENEISSGSFRPLNCAQFCHQPSYCHMVLIGGADGNIKLLDLRTG
                     DPPSRRPLRHSSAITSLCFSPTDASSFVIGLDDGTIKRYDWRMAGKHLGTVYGAHGSK
                     AVMDLKWKLGDDSIGGAGAGWLASAGANKIVQVGREKSLYYKS"
     repeat_region   476988..477019
                     /rpt_type=tandem
                     /rpt_unit_seq="cccg"
                     /satellite="microsatellite"
     gene            <478340..>480067
                     /locus_tag="CNI01710"
                     /db_xref="GeneID:3259384"
     mRNA            join(<478340..478641,478699..479333,479370..>480067)
                     /locus_tag="CNI01710"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41566933|gb|CF712774.1"
                     /transcript_id="XM_572962.1"
                     /db_xref="GI:58271611"
                     /db_xref="GeneID:3259384"
     CDS             join(478340..478641,478699..479333,479370..480067)
                     /locus_tag="CNI01710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572962.1"
                     /db_xref="GI:58271612"
                     /db_xref="GeneID:3259384"
                     /translation="MDDDSARLEIWHVRRHYIAKYAIPSQDGVAVDASWRGSAGLVVT
                     FQNGGFAQLDIPRKLNSGLLPLPLDQIPRQIAGWSAKGDLYFAIDKFRAGEVPFDDLK
                     PEYANHYERLGRPTHSLSDPPYIPLQTIGSLALPDTDPSEFAFLASWYRLEGSIPADL
                     CAWNRDVAKWCGREDDARLWGFVKGLFEEFMPLQEGMEATFVNDVWGRAGKALAATTT
                     TTMTMTPPNVSPRGRHARLPPDDEREKRAHRILPTYAGIPLERITPPASPTSNPSEIS
                     ERTPDSDSGSDDEIYSDEQSESVKPRRSKFVSFIEPANRRRSSFSSQEGSPVFEKTTK
                     KKQQQQGETSPIAITNTNTNPSAGTISHPNSASKKSTLSKIAFTPRQHSHPHPHQHQH
                     HQHQLVSSSDWPDPYGIIPDQVLTSGTMTSTTATSGTSRASTTTQSSPLPAFARNGTK
                     NSPRAGTTGLAGHEIGSGVVEAPLAGRGSAEVGVGAVVPNGNGPGGIASRVGSGQGKE
                     MRGREEKFEKTEWEEYRKKRVATLMTWWDGCVENVC"
     misc_feature    478647..478673
                     /locus_tag="CNI01710"
                     /note="T-rich"
     repeat_region   479037..479068
                     /rpt_type=tandem
                     /rpt_unit_seq="cga"
                     /satellite="microsatellite"
     repeat_region   479570..479619
                     /rpt_type=tandem
                     /rpt_unit_seq="cca"
                     /satellite="microsatellite"
     gene            <480123..480914
                     /locus_tag="CNI01720"
                     /db_xref="GeneID:3259700"
     mRNA            join(<480123..480436,480490..480572,480645..480914)
                     /locus_tag="CNI01720"
                     /product="vacuole protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41573884|gb|CF719725.1"
                     /transcript_id="XM_572964.1"
                     /db_xref="GI:58271615"
                     /db_xref="GeneID:3259700"
     CDS             join(480123..480436,480490..480572,480645..480907)
                     /locus_tag="CNI01720"
                     /codon_start=1
                     /product="vacuole protein"
                     /protein_id="XP_572964.1"
                     /db_xref="GI:58271616"
                     /db_xref="GeneID:3259700"
                     /translation="MQLATTIALIASPLVTFPPFQVERLAHAYVQLLEQHRLFMFAAY
                     IRRFSGIPSLEITPQDEGLTHTFFCERCGKSTGNLEDIEVKGKIFWWCKKCRTGAKSC
                     AICRKIIKGLWMGCRQCGHGGHQACMRLYHSQAPLIPVPSTNGSNPSHTPHALLNTSS
                     STYNQSAGSNFTTLSTTDGANADPVEKVDGVEADGRFALCPTGCGCRCRRIGTANTAH
                     D"
     gene            complement(<481029..>483453)
                     /locus_tag="CNI01730"
                     /db_xref="GeneID:3259729"
     mRNA            complement(join(<481029..481973,482025..482571,
                     482619..483070,483119..483399,483447..>483453))
                     /locus_tag="CNI01730"
                     /product="ribosome biogenesis-related protein, putative"
                     /transcript_id="XM_572803.1"
                     /db_xref="GI:58271293"
                     /db_xref="GeneID:3259729"
     CDS             complement(join(481029..481973,482025..482571,
                     482619..483070,483119..483399,483447..483453))
                     /locus_tag="CNI01730"
                     /codon_start=1
                     /product="ribosome biogenesis-related protein"
                     /protein_id="XP_572803.1"
                     /db_xref="GI:58271294"
                     /db_xref="GeneID:3259729"
                     /translation="MQAQVPKSDKSSSSSGSEEDYSSDYSSSSEDVTEDEEGNELTPA
                     LDAAILRTLSKIKKKEGVYGGENVLQEELRKAQEIAEQRGLKSNIVKKVAEKPYLLAD
                     YHRSKLLAGEDQDEDSESAEPLTHVESQRRLRQEAVSAFKTLAEESDDESDEEFIQKR
                     EMDAQEVDEDDEEYKKFLLEFGGGEEEVRKILGMGDQPAILKVLESEGGEDEEEKAAV
                     SKIEKEELERQKQEKEAKKAKDDDDFLMNYILNRGWIDRSEKHVPTYDEVVGPSTEVA
                     EEAAAQTKSTKPKSSHPWGELDEESDFEDRAEEFETEYNFRFEEPGSSTIATHPRDIP
                     SLVRRADDTRKSKRARRAERKAAEKAAKEEEIKREKGKKRREMEKRMNILKHDLEKEG
                     FKDLEWGKLEKVLDGEWDENVWEKIVGGMLSKGDEQEDGDDNEKPTWDDELGDAEYDE
                     EEGEGDFQYEFAEGEGEGEDMDVDEDEGPINMDADFIDEEPSKKSKKKDKKKKNKNKE
                     HSPSPLPEDEENQLSIPEKAHALKEAVESYNALAHEDIIEDMPTRFKYTPSAPASFGL
                     TPVEILLATDDELNKLVTMKGIAPYRKGGIGIQGKGLGKRVRELKDKLRERRWGEEPS
                     QTKSREEKKEKKRKRDDGEERGQDERRGKKSEGEATEKSEKVRNGKRLGKKERMRLQK
                     AAEAAGAAPAAAGEPESAPAEKKRTVESGEMPADAPAANGEDGGDKKKRRKKKKSKAD
                     GEA"
     misc_feature    481251..481381
                     /note="CT-rich"
     misc_feature    481738..481775
                     /note="CT-rich"
     misc_feature    482640..482740
                     /note="CT-rich"
     gene            483657..485287
                     /locus_tag="CNI01740"
                     /db_xref="GeneID:3259709"
     mRNA            join(483657..484821,484872..485287)
                     /locus_tag="CNI01740"
                     /product="trans-hexaprenyltranstransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534890|gb|CF680731.1,gi|41534897|gb|CF680738.1,
                     gi|41551729|gb|CF697570.1,gi|41558142|gb|CF703983.1,
                     gi|41558155|gb|CF703996.1,gi|41559055|gb|CF704896.1,
                     gi|41559067|gb|CF704908.1,gi|41570873|gb|CF716714.1,
                     gi|41570886|gb|CF716727.1"
                     /transcript_id="XM_572668.1"
                     /db_xref="GI:58271023"
                     /db_xref="GeneID:3259709"
     CDS             join(483709..484821,484872..485210)
                     /locus_tag="CNI01740"
                     /codon_start=1
                     /product="trans-hexaprenyltranstransferase"
                     /protein_id="XP_572668.1"
                     /db_xref="GI:58271024"
                     /db_xref="GeneID:3259709"
                     /translation="MLRRPALPTRAFPKHRISSTFSFSTSQRRSSVSSSPAKQPESTW
                     AAATTEAHRVLTPPPATSASTVTSLDDPLSAINSEIGNLKSSLWRMLGSSNSALDTVA
                     KYYFQAEGKHLRPLLVLLMSQATNGLGGKGWDGAKREAIRRKVDDSLTAEGGVLNDWN
                     PEVSGPEPSSGLGSMVFASPFRIPEAGAPAIPEPEPLPSQFDELLGEGNGQPVILPTQ
                     RRLASITEMIHVASLLHDDVIDSSSLRRGTPSAPSTFGNKLSILSGDFLLGRASVALA
                     RLGSREVVELLATVIANLVEGEMMQLRATSEPEKAPTAKGFEDYMRKTYLKTASLMAK
                     SARAAVILGGCGSVSEEGAWVKDVAYGYGRNLGIAFQLIDDALDFLPPDSSLGKPSLG
                     ADLRLGLATAPALFAWETHPSMGPLILRKFTEPGDVEAARDLVARSDGLQRTIELARE
                     FAGEARRLVEMLPESGARDALVQLTVKVVERVK"
     gene            <487407..489435
                     /locus_tag="CNI01750"
                     /db_xref="GeneID:3259737"
     mRNA            join(<487407..487692,487785..488470,488590..489089,
                     489149..489435)
                     /locus_tag="CNI01750"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543225|gb|CF689066.1"
                     /transcript_id="XM_572966.1"
                     /db_xref="GI:58271619"
                     /db_xref="GeneID:3259737"
     CDS             join(487407..487692,487785..488470,488590..489089,
                     489149..489275)
                     /locus_tag="CNI01750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572966.1"
                     /db_xref="GI:58271620"
                     /db_xref="GeneID:3259737"
                     /translation="MRIPLDVAHSVVRALHTIRSDSAQSGNVTQTSVQIPSNQPAWAE
                     PLSPNLAAFSIEMDRWPDWAGEKVGEPNKYVNQVLTNLGERTGVMPYLRVGANSEDRA
                     TIDLSYEVMNATFPAATEEVPVPEADHIFIGRDFYALSGNLPDGTPFQWGVNLGSLNR
                     TETIAQAKLIADTFQGDRANLTANVRLDGLEIGNEPDFYGTGKGLGAAWTPANYSQTW
                     LDYAQGVSEVIQLGGDGPYLTPGAMTGFSAPVWTPQASFEAGILDDDDIRSVVKQYNQ
                     HVYSGAFGYGYPLTPVGGLMDKVTARTNLTARANEIKSVKSEGLQYVFILTNNSHGQP
                     GTSNTAEAAIWAIDWMLQLASMGVERMHFHHGVGFRYNLFQPVATDADHDDGTNMTSR
                     AHILPAYHAALIVNEAIGTNGNSYVAEISTPNDNVVAYGIWEDGNLVRMVVTSTEVYT
                     TDDEDAQEGRNKFELNLVGVEGRNATVKRLFVPQTTAMHGLTWAGQSFDTEDGKPTGE
                     VSEETLDNGVLQIDASSAVLICFK"
     gene            490299..492510
                     /locus_tag="CNI01760"
                     /db_xref="GeneID:3259520"
     mRNA            join(490299..491353,491403..491822,491873..492069,
                     492124..492510)
                     /locus_tag="CNI01760"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530351|gb|CF676192.1,gi|41530365|gb|CF676206.1,
                     gi|41532212|gb|CF678053.1,gi|41532219|gb|CF678060.1,
                     gi|41532220|gb|CF678061.1,gi|41532221|gb|CF678062.1,
                     gi|41532345|gb|CF678186.1,gi|41532356|gb|CF678197.1,
                     gi|41532579|gb|CF678420.1,gi|41532590|gb|CF678431.1,
                     gi|41533463|gb|CF679304.1,gi|41533475|gb|CF679316.1,
                     gi|41534400|gb|CF680241.1,gi|41534412|gb|CF680253.1,
                     gi|41534788|gb|CF680629.1,gi|41534800|gb|CF680641.1,
                     gi|41537085|gb|CF682926.1,gi|41539061|gb|CF684902.1,
                     gi|41539072|gb|CF684913.1,gi|41539401|gb|CF685242.1,
                     gi|41539413|gb|CF685254.1,gi|41539498|gb|CF685339.1,
                     gi|41539935|gb|CF685776.1,gi|41539952|gb|CF685793.1,
                     gi|41541015|gb|CF686856.1,gi|41542517|gb|CF688358.1,
                     gi|41542521|gb|CF688362.1,gi|41542540|gb|CF688381.1,
                     gi|41542546|gb|CF688387.1,gi|41542873|gb|CF688714.1,
                     gi|41544033|gb|CF689874.1,gi|41544045|gb|CF689886.1,
                     gi|41546068|gb|CF691909.1,gi|41546079|gb|CF691920.1,
                     gi|41548305|gb|CF694146.1,gi|41548317|gb|CF694158.1,
                     gi|41549040|gb|CF694881.1,gi|41549044|gb|CF694885.1,
                     gi|415"
                     /transcript_id="XM_572667.1"
                     /db_xref="GI:58271021"
                     /db_xref="GeneID:3259520"
     CDS             join(490558..491353,491403..491822,491873..492069,
                     492124..492204)
                     /locus_tag="CNI01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572667.1"
                     /db_xref="GI:58271022"
                     /db_xref="GeneID:3259520"
                     /translation="MLASIIAALPLLAFLPLSSAHAVSDGVALESRLWYERAAAALSS
                     EAEAAGVPSGFRSRAHTSGLRRRASRHHSEAGQKLVRRKKETTQKRDGEKKKKKRSCK
                     AKTTGLGAAATASSSSVSEEVSSSAATVSNSLGAVANAATAGISSQAESSAVSSSSSN
                     AAHVTNYAPTTTSSAAGSTITDSASAVADAWSPEISIGLSANASIDILTTYTVPDSAT
                     TAPTIAPSASASTTSSAANSSTSELSSELLPWGHGISSWTTSGGLLSYDAALKPLTAG
                     KLPDTGNAPDGTSALCANFPAGSYGLTNSGFSFYSSGAHSGVEVDSAREVALSYAVYF
                     EEGFGFNKGGKMPGLYGGTSLSEAKSCSGGRTTDRGSCFSARLMWRTDGAGEIYDYLP
                     VSYTGTDDGYGESIDRGAFTWATGRWQTVAMRVKLNDVGQANGEQELFVDGQSVINIS
                     GVTFATEEDTAIFGIMAQTFFGGHTSEWASPKDQNLYFKDWTLTVLA"
     gene            complement(<492821..>493643)
                     /locus_tag="CNI01770"
                     /db_xref="GeneID:3259407"
     mRNA            complement(join(<492821..492870,492928..493040,
                     493106..493239,493322..493388,493561..>493643))
                     /locus_tag="CNI01770"
                     /product="DNA-directed RNA polymerases I, II, and III
                     polypeptide, putative"
                     /transcript_id="XM_572666.1"
                     /db_xref="GI:58271019"
                     /db_xref="GeneID:3259407"
     CDS             complement(join(492821..492870,492928..493040,
                     493106..493239,493322..493388,493561..493643))
                     /locus_tag="CNI01770"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     polypeptide"
                     /protein_id="XP_572666.1"
                     /db_xref="GI:58271020"
                     /db_xref="GeneID:3259407"
                     /translation="MSDDERMDTGDFEGGDYEQDYVDPDTLNYENEENAEEEAANGEV
                     DETMIIESGAPEGDRPRTGKAAKPNEIRVTTPYMTKYERARVLGTRALQISMNAPVLV
                     PVEGESDPLEIAIKELAAKKIPLVIRRYLPDNSFEDWKVEELIVQE"
     gene            493959..496078
                     /locus_tag="CNI01780"
                     /db_xref="GeneID:3259535"
     mRNA            join(493959..494225,494324..494474,494538..494728,
                     494778..495222,495274..496078)
                     /locus_tag="CNI01780"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533411|gb|CF679252.1,gi|41533424|gb|CF679265.1,
                     gi|41540627|gb|CF686468.1,gi|41540634|gb|CF686475.1,
                     gi|41543907|gb|CF689748.1,gi|41543914|gb|CF689755.1,
                     gi|41555578|gb|CF701419.1,gi|41555588|gb|CF701429.1,
                     gi|41557062|gb|CF702903.1,gi|41557065|gb|CF702906.1"
                     /transcript_id="XM_572822.1"
                     /db_xref="GI:58271331"
                     /db_xref="GeneID:3259535"
     CDS             join(494075..494225,494324..494474,494538..494728,
                     494778..495222,495274..495988)
                     /locus_tag="CNI01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572822.1"
                     /db_xref="GI:58271332"
                     /db_xref="GeneID:3259535"
                     /translation="MQLGRYSVSTLLPPPIHSITFSPDGRFFAVAAEKGYEIWKTWPL
                     GLVRRRVLPGTLALAVILPHAPLLVLQAGGTAPLYAPNKIVIYNDKLGEVVAEVEFGE
                     RIRGVVARRGMICVALLRKVVGFEYGLGSDDAGKGKSKMMDSNSNGFWIKKIGEWETA
                     KNEQGLMAMATAPGSTLLTLPGRQPGHVQLVPLPPCPSSSSPGSPTRTSVTSQTTFRS
                     PIILAHTHPLSTLGISPSGSHIVTTSERGTLLRIWDTSRGRLERELRRGVDPAEMWGA
                     TFERDGKGARVAGWSDKGTIHVWESEENKTGQNGTRPATPSNASLTNILSRNLPLPKY
                     FSSITSTAQYRLPRKNPHAFSAALGAAGVPSMAMKEAVDLEGERGERFIVGWIEVDVA
                     VEDHKVDDKDRAKEDPKAQYRPSSNVSTMGSFPIGTREERMSFGSEGTSRTATPFQRV
                     ETPTPGGTKLGRGRGRMSGGPHVRLKGHSAQRTSSNTPSQKRTEKQMQLIAITYSGDW
                     YRLKIPEGAGRGEGSSGGEEGKTSAKCELVEYRRLAVGGGGW"
     gene            complement(<496137..>502736)
                     /locus_tag="CNI01790"
                     /db_xref="GeneID:3259411"
     mRNA            complement(join(<496137..497370,497420..498004,
                     498064..498321,498375..498517,498571..499009,
                     499060..499321,499376..499852,499911..500699,
                     500758..501850,501906..502320,502366..>502736))
                     /locus_tag="CNI01790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572847.1"
                     /db_xref="GI:58271381"
                     /db_xref="GeneID:3259411"
     CDS             complement(join(496137..497370,497420..498004,
                     498064..498321,498375..498517,498571..499009,
                     499060..499321,499376..499852,499911..500699,
                     500758..501850,501906..502320,502366..502736))
                     /locus_tag="CNI01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572847.1"
                     /db_xref="GI:58271382"
                     /db_xref="GeneID:3259411"
                     /translation="MSSLAQQLQSIASLDAARLTSAYGAPSGKSYLFPPDVASSHDID
                     SIFDLAQSGFDELLSLDPEMEEFEEELFSESAKRTDRMVLSKEENDNLDRTLGRCLRR
                     LGKWIRLMAGGKCIEWMVRRFRVHEMNVDEVLRSFLPYHESPNFPRILAIVTIPKTSP
                     YYATFAPLVKNAQPIPRSYIVTSISPAKDKSLVLLGDIASMVQQAVKEGVVHHALLTF
                     WTATMVDLLEGARHGKGANEGVVKQLVESFVTLLETPKAGEDVNAAVYPPLVLLTRTV
                     PLADEPFLAIVSSLLTPGTGSNPSQRMLTLLVILNDRHTWSLGLGEHATENLAKVSQL
                     GEILVAAMDKYRFEKALNIVVKSMLEKPDLHAKALATVLEHESLPTSVTELASTNLLQ
                     LGSSTDSQEVKAACKSLLTNLRERHPSIVDTAFLQASASLEIDTHPVDHGLVQKPSGE
                     VAFLDVYAADISSRVTGVKSVIDMAKKGEEIESSITALEARLSDVDENVVNALYEEPK
                     SLLEILPVEKYIAGVKPVFWAVSPISHIIGLHLDFISQHLLVSHPEAGKQIYESLLFP
                     IFLSTEKRQPLTKSQALKLLNGGFKKLDKLSTIGPEIGKAREEGMKGAQKGNLVIAKA
                     LAGATLSSSTFEDDISFLIAQLDSTTSSARLLAYLILHSLVLTLRGPRQLSTSLSILK
                     YLSPRLTGHSLRDLKHADENVNTEYMESVYKKPEETRTTLRAIVSILAAMGKVIKPIG
                     QIVWLSGESKAKDASYKTFAQQIYLWANIAILPANVAHFLLRSLLTQLGEEALLFFSS
                     IWTSSTSPVPLRISALKHALAFIHAYATLPTSPAAQGQPVDFQVVLPQILIALQDSDK
                     DVRRVAVDVLRSVEGGEGMGDVYALDTIYGDRSEMTQLLKSVDRKKYIETLLEVAEEF
                     VIDRLRLKAFHTEVLNMQSGKNRKESAHRRAIIGFLMSHVASYRAIDPRLVLLSLLSD
                     VHDTSILRSAIPLLASLFDDKSEESLWLSSLPDGQQALYVQALMGSLRVQSVSVLGEA
                     GGEGWEFLLNLLDASKSSRFIARLRILSFKAMVGGVFSALEAHQQIEYIIALIQCIHA
                     LPTDDALDAVKVLEKLDIQPRVLIELIEHLSDPLETSVNRKRQRQDAADEDRPTQAVH
                     ELITFVDSRNWPSIPASAPLVASLMSILSALLAKRLIVKEGIDYLEQEVFGAILALVE
                     RITDAQEIQRAHVGIEVVIKVIRASTNPRTAQRALLVASELARLIPDAVLHNVMPIFT
                     FMGASDFQRDDAYTFGVVEKTVSRIVPVMTQSLKEKAQNSLELYTKSLTFLSIFTDMA
                     GRLPRHRTLPFFVHLVKSLGASDYLAPVCMLLVDRATTKAGRNKESVSTALELPANLV
                     AAFDVSVKTQVLGEIVQELARLIGDLSKADKEAFLSQTISENDATDRPLRQVTYLLSF
                     LSSILGQLRGKACSQALVQSAVRQLIVLAASTSQPVMATTDIPSNLHKTLASTMLLLS
                     ADNFLGVTAELLSDGSEQDIIMSLGVFAERLPLIKSEVRLRCTKVIAEILKRIGDLLA
                     ASGATVNAALEAVKSVTKTAIAQEDGALASVLPTVVGCIGKVKDSAVIVAALSLVELL
                     VRRLAARTIPFIQSILDTSLNLIKSTKLAATATNQAFVTLSSVIETIPTFISSKQLNA
                     ILITTIDYRRVEETNSASLFTTLAKKIRTKSLFPVLIEAWKTVQEKGGDNEMKGFFEM
                     LRLTLKNAAREDLPSMLKPVFAFFLDVFDLRHRLQLKGVDTRVVNDVEESAIGSFLEL
                     VTKLNEPTFKPLFIRLYDWAVIDLAEGKNADDGRLTERKIVLLHVMMGLLTKFKNLLS
                     PYMGILFPHIQELLPAFASGSVRSEPLWTLLLNVLGKSFEVDSGAFWTDALEIELLPQ
                     LVAQVPLFLPIAPSPQSPRPISSCLANLAGSTTAENVLRRLNTAVCLATRSDDPKVRL
                     AALDALSAIWDAQAEEMVGLVPETVSEFLAELLEDESKDVEIAARGVLAKIEKVTGSL
                     KEYLE"
     misc_feature    502804..502824
                     /note="AT_rich"
     gene            <503219..503540
                     /locus_tag="CNI01800"
                     /db_xref="GeneID:3259478"
     mRNA            join(<503219..503340,503392..503540)
                     /locus_tag="CNI01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_572665.1"
                     /db_xref="GI:58271017"
                     /db_xref="GeneID:3259478"
     CDS             join(503219..503340,503392..503503)
                     /locus_tag="CNI01800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572665.1"
                     /db_xref="GI:58271018"
                     /db_xref="GeneID:3259478"
                     /translation="MNGCFFLLILTLFALAFLTQWNKHVLLLLAVTLLLWGSMAWFVL
                     ELTRVQSRPNNMPPPIDLDSLKDSPADESKKEQ"
     gene            complement(503509..505029)
                     /locus_tag="CNI01810"
                     /db_xref="GeneID:3259514"
     mRNA            complement(join(503509..503701,503752..504020,
                     504074..505029))
                     /locus_tag="CNI01810"
                     /product="SMC2orf, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530891|gb|CF676732.1,gi|41530905|gb|CF676746.1,
                     gi|41574683|gb|CF720524.1"
                     /transcript_id="XM_572664.1"
                     /db_xref="GI:58271015"
                     /db_xref="GeneID:3259514"
     CDS             complement(join(503559..503701,503752..504020,
                     504074..504960))
                     /locus_tag="CNI01810"
                     /codon_start=1
                     /product="SMC2orf"
                     /protein_id="XP_572664.1"
                     /db_xref="GI:58271016"
                     /db_xref="GeneID:3259514"
                     /translation="MSKRAAPSSMPDQKRTRFATSHTTHSISPSGTPASLEEDDAYLN
                     DDFESNAAATRQKARRGLRDAGGYASDSSGDEEGVVPSRRPGARGDDEDDVDMFADDV
                     DESKGKDKEKPKEKEFMSLEDIEGQEFDKPSQAKDYSDSETEEVKTGLDGDMGIDITP
                     FNMKDELAEGRFTAGGETYVANEEDPNDKYDVWLSDVDKEEIKKARRAHREQQRLEEE
                     RQAKEAGGGEEKEKKEKELLQAALRLMERGETVLEALQRLGKQVEDERKKREAGSKKK
                     SWAERQKERKVLMAAQEEQTDSIHTSNPFTNLSNIVSGLTTIGHLDVYSLSRESIQRM
                     LPAPADGAHNPPRAAPPPQPISDNRQFQYRFSMAYVKNLPEGQRPVEREVFGPFSLLQ
                     LRGWRSTGFFGPSSENVELRLVPDGGEPGQWGSWTEVIGQ"
     misc_feature    504253..504315
                     /note="CT-rich"
     gene            <505264..>506436
                     /locus_tag="CNI01820"
                     /db_xref="GeneID:3259370"
     mRNA            join(<505264..505795,505844..>506436)
                     /locus_tag="CNI01820"
                     /product="expressed protein"
                     /transcript_id="XM_572824.1"
                     /db_xref="GI:58271335"
                     /db_xref="GeneID:3259370"
     CDS             join(505264..505795,505844..506436)
                     /locus_tag="CNI01820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572824.1"
                     /db_xref="GI:58271336"
                     /db_xref="GeneID:3259370"
                     /translation="MPKLKAALASQQHSVAKLAARKRAQAAEDAKRASIKASVDGVKK
                     GKKRAKAAASKMANEAKSEGLEQITKSKAKKKPPTIPFDKQDTILLLGEANFSFSLSL
                     LREPHNLPAHQILATVYDSERTTLEKYPDAAENIRLLKEEGVRVEFGVDAGALEKCKA
                     VGKGRRWSRVIFNFPHVGAGITDQDRNILTNQHMLLKFFRSVEPLLTEGPTHIPIPQS
                     SSSKSNSKDKQKRKQKKPSSDDEAAPEPEDEEEDFFFNDDPTFTNPKIVVPKEFTPPK
                     RAGTVLITILSCPPYTLWCLPQLAARPPPICPGTNLPQPRYTLLRSFEFRPEIYEGYA
                     HRRTIGWKEGLSKSENEEILGRKGMPRTYEFVRTTNTKGD"
     gene            507430..511219
                     /locus_tag="CNI01830"
                     /db_xref="GeneID:3259569"
     mRNA            join(507430..507672,507728..508063,508122..508525,
                     508574..508811,508857..509780,509831..510037,
                     510086..510628,510679..511219)
                     /locus_tag="CNI01830"
                     /product="ribosome biogenesis protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542064|gb|CF687905.1,gi|41574925|gb|CF720766.1,
                     gi|41574927|gb|CF720768.1"
                     /transcript_id="XM_572826.1"
                     /db_xref="GI:58271339"
                     /db_xref="GeneID:3259569"
     CDS             join(507448..507672,507728..508063,508122..508525,
                     508574..508811,508857..509780,509831..510037,
                     510086..510628,510679..511173)
                     /locus_tag="CNI01830"
                     /codon_start=1
                     /product="ribosome biogenesis protein"
                     /protein_id="XP_572826.1"
                     /db_xref="GI:58271340"
                     /db_xref="GeneID:3259569"
                     /translation="MPKRGSKSTKLQKGLVNKQAALPEEQLKERKNISDALRQAVIDL
                     GGDEEDLDLIDGVDDDDEAPTQKKAEKSTDDKTLKKELGDFMKGLDFGSVEVAAVESS
                     EEVDEESDEEDEDSGGSGEEEGASEEDEEGEEEAEKDDDDEEESEGEVILKAGVPAKE
                     NAPSNPTKETSKTDSTASKDVDKSSGTNVPASTSWPSLVPPLPPVASLPKLHPHDLNN
                     LRQKASNLLANLPPLSRASSSSDQAFISQILQSGTHQDKLSALVLIVRESPVHAIKEL
                     DKLRGMAGWKEDGVGGGGNKDQRVAVMKALADWWVGGGGKEQGKLKYFTDQPLLAHPQ
                     LTDRHLLMYAFEDYLKKWFFNMLQVLEVLSHDTLPFIRTQALHIIFRLLAGNAEQEQN
                     LLRLGVNKLGDIDRPVASKASHHILTLLQAHPAMKAVVAREVSALVLRPSGAVGSAAP
                     STHIKFDNDKGKKAAHAGKAEAVGHGRYYGLITLNQMTLTRKDQDVAGRLVDLYFEVF
                     REILGDPNGLEEEEGQAENNEEVGEDKVQKVAGKVEKWRGRRKGAKPKGGRKSALEEE
                     ELIETTKAKLVAAILTGINRALPFAKLDETMFSSYMDTLFKITHAGTFNTSIQALLLI
                     FKVSTTESDFRQTVSDRFYRALYDSLFDNRLVTSSKQAMYLNLLFRAMKADDSIQRTM
                     AFVKRLLQMLGMHQPPFICGALYLLGELFSTTPGLKRMLIEPEDDGEEHFVDADADEQ
                     ENGGSAEKPARTVIGKDYDGKKRDPRYSNADSSCLWELTPFLNHFHPSVSLQANQLLH
                     SQNLTGSPDISLNTLISFLDRFVYRNPKKTIQPKGASIMQPAAASDKSGMVVKGEGEA
                     GVMVNSEAFWRKKIEDVPVEMMFFHQYFAEKLKRKEKRGKDKEKSTKGSDFGESESEG
                     EEEEDEEMEDSNEDNSGSENEDEDADPDVAEDDEDSDPEEAEIWKAMKATMPRANDDM
                     GLSEDEDDDISISGSSDDHEESDEDEEEEDEAEGASGGDEEDEESDQEPAPAATKSKK
                     RAARSPSPASSASSFPDFADEDEDVISLSDVDMPDIVLDGKASDVEDEAEIGDKRKKR
                     GEERKERRKKRRELPTFGSYEDYKALIEQAGSEED"
     misc_feature    507809..507950
                     /locus_tag="CNI01830"
                     /note="GA-rich"
     misc_feature    510775..510849
                     /locus_tag="CNI01830"
                     /note="GA-rich"
     misc_feature    511045..511104
                     /locus_tag="CNI01830"
                     /note="GA-rich"
     gene            511851..511947
                     /locus_tag="CNI01840"
                     /db_xref="GeneID:3259798"
     tRNA            511851..511947
                     /locus_tag="CNI01840"
                     /product="tRNA-Thr"
                     /codon_recognized="ACU"
                     /db_xref="GeneID:3259798"
     gene            complement(<512306..>515187)
                     /locus_tag="CNI01850"
                     /db_xref="GeneID:3259592"
     mRNA            complement(join(<512306..512478,512537..512625,
                     512676..512723,512777..513725,513775..514149,
                     514197..514450,514505..514741,514865..>515187))
                     /locus_tag="CNI01850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572845.1"
                     /db_xref="GI:58271377"
                     /db_xref="GeneID:3259592"
     CDS             complement(join(512306..512478,512537..512625,
                     512676..512723,512777..513725,513775..514149,
                     514197..514450,514505..514741,514865..515187))
                     /locus_tag="CNI01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572845.1"
                     /db_xref="GI:58271378"
                     /db_xref="GeneID:3259592"
                     /translation="MAPKPAKTSSKTAKLPTPAATPTRQPSVDTLSKPAVVDTPPTPA
                     SPAQVSAPVPPKKFAYPIPSRLSPSTINNTESLLRFIILALICGAAIGSRLFAVIRFE
                     SVIHEFRASKVLVNKGFYEFWNWFDPSAWYPLGRTVGTTLYPGLMVTSGLIWHALRAI
                     NMPVDIRNVCVLLAPGFSGLTAWATYLFTTEMSTPSAGLLAAAFIGIVPGYISRSVAG
                     SYDNEAIAIFLLMSSFYSWIKAVKTGSSFWGMITALFYGWMVAAWGGYVFITNMIPLH
                     AFVLIVMGRFNNRLYTAYSSWYVIGTIASMQVPFVEFLPIRTSEHMAALGVFGLVQLI
                     GFVEVVRRLVPGKQFQLLLKAFVVAVFCLSFAALVTLTFSGWIAPFAGRFYSLWDTGY
                     AKVHMPIIASVSEHQPTAWPSFYFDLEMLIFFFPAGVFWCFKELRDEQIFIIIYAVLS
                     AYFAGVMVRLMLVITPVVCVSSAIAFSKLLEAYIDPVIPESDEEAGESQTQVVSKSKA
                     KKMAAANANKSGFSFTGILSGKSVSGIFGLDTRFAVVSILSVFLFIFVLHCTYVTSTA
                     YSSPSVVLASRNPDGSQNIIDDFREAYYWIRQNTAEDSVIMSWWDYGYQIAGMADRPT
                     LVDNNTWNNTHIATVGKAMASNEDVAYPILRKHDVDYVLVIFGGLLGYSGDDINKFLW
                     MVRISQGEWPDEVQEVNYFTQRGEYAVDDRATPTMKNSLMYKMSYYRFPELYGGHPAQ
                     DRVRGQIIPPNSVTLDTLDEAFTSENWIVRIYKVKKEDPIGRDHKAVTAWNGGKKLKK
                     SPSASEGVKRGSGRPSM"
     gene            complement(515708..515804)
                     /locus_tag="CNI01860"
                     /db_xref="GeneID:3259799"
     tRNA            complement(515708..515804)
                     /locus_tag="CNI01860"
                     /product="tRNA-Thr"
                     /codon_recognized="ACU"
                     /db_xref="GeneID:3259799"
     gene            complement(516126..519254)
                     /locus_tag="CNI01870"
                     /db_xref="GeneID:3259382"
     mRNA            complement(join(516126..516702,516754..517015,
                     517075..517651,517713..519254))
                     /locus_tag="CNI01870"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545098|gb|CF690939.1,gi|41545106|gb|CF690947.1"
                     /transcript_id="XM_573000.1"
                     /db_xref="GI:58271687"
                     /db_xref="GeneID:3259382"
     CDS             complement(join(516210..516702,516754..517015,
                     517075..517651,517713..518903))
                     /locus_tag="CNI01870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573000.1"
                     /db_xref="GI:58271688"
                     /db_xref="GeneID:3259382"
                     /translation="MAPRDSSRFSFKSRFSLLSLLPARHPPLFVDPPRMPPTHPGPRH
                     ETIISDTVSPVHSEYPDLGTPFPPCRKKSYDRSPLGWGHGEEGEPVEEKKRRAKRPPP
                     LNLERTHMMYPPSSVDVVIDPGTPFNLDSPPPQKQVPSLPKKIKPRKKRQLVEDPFEV
                     AEVEIGHRYPSWKDGKADIRPGQVIPPGLMPSLVDLDVKPKPNRRGTAVDTPDNYESV
                     LHNVLLTPTYIVPSPQVNSTPTPSPYDPSEFIEKYDRPRTLLDRATDTISNAAKRTSK
                     WMPGKSILRNGSSGDDGATNKSLRALKERELQEMARFRQNARPGVRLAVPGEAAYSSG
                     SSPAREMSNIYSRKSPGWLGSRERIIGYDGDGKYPVVVGSSNNGWRAGKRDEEHAKRN
                     KRIWKITIIVAILFLTALTIGLCTSLLRKSSSSSLDTSSSSDAASADNSSGSATVTSS
                     AASASSTSSQTLSTCLNLFTSSAPTSPASYPCSDCVQVLQSTTNDFSEPMVNGNSTGV
                     GSALQFCAMMDIYSQIENTSQLSKWGEDASPCGWDGIGCDSRGRITSLSLQYPNVPTA
                     LPDTLGNVYALKALHLLGNSSVPTGDFPSSLLSLPYFQTLDLEYTAITGRIDTAPFNS
                     ATGLVTLMLVSNSQLGTSMPDLSSNTKLVTAAVTGQGLTDAEADKLPSSLTYLDLSYN
                     SLSGQVPSFSQLASLKTLYLQNNDFTSAPDSIPSSLTTMSFTSNYRLSGTMPSSVCSS
                     TVLTSCDLRSTNLTAGTTSSSSRSSSSTSLSFVAASSTITSIASTSSSSVKVSGSSMS
                     SASSSSGSNSAARDTNVTSSTMIGVSARASTEEGTCGVCQFN"
     gene            complement(519496..521881)
                     /locus_tag="CNI01880"
                     /db_xref="GeneID:3259615"
     mRNA            complement(join(519496..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521523,521675..521881))
                     /locus_tag="CNI01880"
                     /product="ATP-dependent RNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530174|gb|CF676015.1,gi|41533171|gb|CF679012.1,
                     gi|41533175|gb|CF679016.1,gi|41541642|gb|CF687483.1,
                     gi|41550106|gb|CF695947.1,gi|41551244|gb|CF697085.1,
                     gi|41551249|gb|CF697090.1,gi|41553881|gb|CF699722.1,
                     gi|41553892|gb|CF699733.1,gi|41556601|gb|CF702442.1,
                     gi|41559193|gb|CF705034.1,gi|41563332|gb|CF709173.1,
                     gi|41563342|gb|CF709183.1,gi|41565571|gb|CF711412.1,
                     gi|41565723|gb|CF711564.1,gi|41565727|gb|CF711568.1,
                     gi|41566218|gb|CF712059.1,gi|41566220|gb|CF712061.1,
                     gi|41568803|gb|CF714644.1,gi|41568810|gb|CF714651.1,
                     gi|41574488|gb|CF720329.1,gi|41574499|gb|CF720340.1"
                     /transcript_id="XM_572663.1"
                     /db_xref="GI:58271013"
                     /db_xref="GeneID:3259615"
     mRNA            complement(join(519496..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521845))
                     /locus_tag="CNI01880"
                     /product="ATP-dependent RNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530174|gb|CF676015.1,gi|41530180|gb|CF676021.1,
                     gi|41533171|gb|CF679012.1,gi|41541642|gb|CF687483.1,
                     gi|41551244|gb|CF697085.1,gi|41553881|gb|CF699722.1,
                     gi|41556601|gb|CF702442.1,gi|41556614|gb|CF702455.1,
                     gi|41559193|gb|CF705034.1,gi|41563332|gb|CF709173.1,
                     gi|41565571|gb|CF711412.1,gi|41565586|gb|CF711427.1,
                     gi|41565723|gb|CF711564.1,gi|41565727|gb|CF711568.1,
                     gi|41566218|gb|CF712059.1,gi|41568803|gb|CF714644.1,
                     gi|41574488|gb|CF720329.1"
                     /transcript_id="XM_572662.1"
                     /db_xref="GI:58271011"
                     /db_xref="GeneID:3259615"
     CDS             complement(join(519542..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521523,521675..521747))
                     /locus_tag="CNI01880"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_572663.1"
                     /db_xref="GI:58271014"
                     /db_xref="GeneID:3259615"
                     /translation="MSDAQAPPASTSWADMVDEDEKQKQEQNMSNQNDGWGETATETS
                     APAPPPASAPVSSSNNDGWGEPAPSAPADNGWADAGASNGGSGANNNDGWFDAPVPPS
                     SQPPKKEASDIQLQDDTEGLITNTFQVEVKLADLQGDPNSPLYSVQSFKELNLHEDLM
                     KGIIAAGFQKPSKIQEKALPLLLSNPPRNLIGQSQSGTGKTAAFTLNMLSRVDPTIPT
                     PQAICIAPSRELARQIQEVIDQIGQFTQVGTFLAIPGSWSRNSRIDKQILIGTPGTLV
                     DMLMRGSRILDPRMIRVLVLDEADELIAQQGLGEQTFRIKQLLPPNVQNVLFSATFND
                     DVQEFADRFAPEANKIFLRKEDITVDAIRQLYLECDSEDQKYEALSALYDCLVIGQSI
                     VFCKRKVTADHIAERLISEGHAVASLHGDKLSQERDAILDGFRNGETKVLITTNVIAR
                     GIDIPAVNMVVNYDVPDLGPGGNGPDIETYIHRIGRTGRFGRKGCSVIFTHDYRSKSD
                     VERIMNTLGKPMKKIDARSTTDIEQLEKALKLAMKGPA"
     CDS             complement(join(519542..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521689))
                     /locus_tag="CNI01880"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_572662.1"
                     /db_xref="GI:58271012"
                     /db_xref="GeneID:3259615"
                     /translation="MKNKNVRIPNLLDLVKICSFLTDISFIGCPVVALPPILPLHPTP
                     VIFIYNLRTKTEEQNMSNQNDGWGETATETSAPAPPPASAPVSSSNNDGWGEPAPSAP
                     ADNGWADAGASNGGSGANNNDGWFDAPVPPSSQPPKKEASDIQLQDDTEGLITNTFQV
                     EVKLADLQGDPNSPLYSVQSFKELNLHEDLMKGIIAAGFQKPSKIQEKALPLLLSNPP
                     RNLIGQSQSGTGKTAAFTLNMLSRVDPTIPTPQAICIAPSRELARQIQEVIDQIGQFT
                     QVGTFLAIPGSWSRNSRIDKQILIGTPGTLVDMLMRGSRILDPRMIRVLVLDEADELI
                     AQQGLGEQTFRIKQLLPPNVQNVLFSATFNDDVQEFADRFAPEANKIFLRKEDITVDA
                     IRQLYLECDSEDQKYEALSALYDCLVIGQSIVFCKRKVTADHIAERLISEGHAVASLH
                     GDKLSQERDAILDGFRNGETKVLITTNVIARGIDIPAVNMVVNYDVPDLGPGGNGPDI
                     ETYIHRIGRTGRFGRKGCSVIFTHDYRSKSDVERIMNTLGKPMKKIDARSTTDIEQLE
                     KALKLAMKGPA"
     gene            522165..525587
                     /locus_tag="CNI01890"
                     /db_xref="GeneID:3259536"
     mRNA            join(522165..522420,522481..523157,523205..525587)
                     /locus_tag="CNI01890"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531863|gb|CF677704.1,gi|41532357|gb|CF678198.1,
                     gi|41543683|gb|CF689524.1,gi|41543700|gb|CF689541.1,
                     gi|41546373|gb|CF692214.1,gi|41546379|gb|CF692220.1,
                     gi|41547758|gb|CF693599.1,gi|41547770|gb|CF693611.1,
                     gi|41561079|gb|CF706920.1,gi|41562812|gb|CF708653.1,
                     gi|41562819|gb|CF708660.1,gi|41565861|gb|CF711702.1,
                     gi|41565872|gb|CF711713.1,gi|41568627|gb|CF714468.1,
                     gi|41568637|gb|CF714478.1,gi|41575742|gb|CF721583.1,
                     gi|41575751|gb|CF721592.1,gi|41576599|gb|CF722440.1,
                     gi|41576600|gb|CF722441.1"
                     /transcript_id="XM_572973.1"
                     /db_xref="GI:58271633"
                     /db_xref="GeneID:3259536"
     repeat_region   522207..522229
                     /rpt_type=tandem
                     /rpt_unit_seq="tcca"
                     /satellite="microsatellite"
     CDS             join(522356..522420,522481..523157,523205..525456)
                     /locus_tag="CNI01890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572973.1"
                     /db_xref="GI:58271634"
                     /db_xref="GeneID:3259536"
                     /translation="MDVLRPGHAHRSSSDRLLNNYLDSQKSLSTSLFTLLSHSHSSTS
                     SLLAYVTSSPGVLLSVRRAVRHAAFEGPLSSSMTERGDHFPEHDSEGGWAAYISSLEQ
                     FRKDLKQIHLLEEELSRVKRDREILVGRLIKATKGRPTKSDLSALASTYSSHALHDAP
                     QSSRASVLSDNSSVTSKEGKRAGKLADAQAELLGCEEHLRGLEVRIENERNRVMSRGL
                     EERFRSMEVVGRMWVQQAKRGLEDLDKMHDLPPDAFELDSNGSLAPSQSASQIIPYDD
                     RPPSRSDVPYPRHMQHEVAGSITGSIAEEDEDGSSSEEDPNQFVVHENRPGSQLSPRL
                     PPKGRATPGPKSPSLGVPSVNSRARPLSNVESPGRGGRRAASDIGTGAYRPPSSRALR
                     RTISHDEPSPRRAGSDTSSIREHRPKKKGFFASIGRLFKSKKHGSDRSSSPPYGSSRG
                     GWQTRTDSNVKRANAFGGARGGDESSSDEDNGNLVSVSNNRNSTWTVDPTRSSGSHIK
                     RSSTMPVANGLIPPKPTRSTSQSTITAKSKPKTTGASNVSRSNTVKSSVSEATTVKSG
                     GTVKKKTRPNGSIARAKSPTSVNGHGQGAGVAGRNIMTLVDTSNPPVMPEVPKAPKSQ
                     VNPEMEGIKAPGSSIVTADTPLPPIKHTPSAATSVGAPALGRSVSSKSAKKKEQVKPK
                     SSPPYRPTTPLPPSRTLSPPVKSAMRPTSPQPSSPLAPKLDLPTTPMYTISAPAPISL
                     EEVKKEQEREKEEQERERERKREQEKEEQKSRDAKRSSFVSLQSDGASIYESAMEDGD
                     EGYGPETDSSDDEEDAANYKMVKNDKVIRRGEMATGDPNYMKDDEEDEGSQVTIGARS
                     EPTAIAAAPPTLGAPASAIPRRRKSVRMAVPDSPSTESHPQVHVPQAPRPIAVSTEER
                     PRSRTPSPEPERVEQAWSTRIGRMREDTSEDEDEQDDYVRARKGLIKTNKWDAVNAAK
                     EKTKGLKKKGSVKSKGSVKSKASRA"
     misc_feature    524683..524774
                     /locus_tag="CNI01890"
                     /note="GA-rich"
     gene            525906..527928
                     /locus_tag="CNI01900"
                     /db_xref="GeneID:3259675"
     mRNA            join(525906..526275,526324..526535,526592..526734,
                     526789..526899,526948..527184,527236..527709,
                     527756..527928)
                     /locus_tag="CNI01900"
                     /product="tRNA (guanine) methyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41571809|gb|CF717650.1,gi|41571814|gb|CF717655.1"
                     /transcript_id="XM_572991.1"
                     /db_xref="GI:58271669"
                     /db_xref="GeneID:3259675"
     CDS             join(525968..526275,526324..526535,526592..526734,
                     526789..526899,526948..527184,527236..527709,
                     527756..527902)
                     /locus_tag="CNI01900"
                     /codon_start=1
                     /product="tRNA (guanine) methyltransferase"
                     /protein_id="XP_572991.1"
                     /db_xref="GI:58271670"
                     /db_xref="GeneID:3259675"
                     /translation="MLKSLCFVIRPAIVSRPQFRLPTIARLSLRQFQNQPQSVGFFTM
                     APLETRALALSPSATICPPSRIGTTELDRSAFDLDVQILSAVVEPGMIGKLRSHPSLK
                     DLVLDLPKTKPIVECPAGLAPVAARDVKGLKLLRFHLSKESELPEEAKEVLKGAKALV
                     KEVVRLGYDNWNASEILGACLPTTKSEDIPSSFTTTGHIGHMNLREEWLPFRYLIGQV
                     VLDKNPGLRTIVNKLDTIHAQFRYFDMEVIAGDNDYIATVNESGCSFTFNFSNVYWNS
                     RLHHEHERLISLFPPGCVIADVMAGVGPFAIPAAKKGCYVLGNDLNPESVKWMRENRL
                     RNKVEPTLRVSEIDGFEFIRIAPLEVWTRPFDPAPPPKVSNRQRDREAKEARRKREQA
                     KAAGQPVTETAPMSIPSQEVAIKPHPPQPPKLISHFIMNLPDSAITFLPSYVSCYTPL
                     LAERSFIDEYGGEEEAKRKVEMPMVHCYCFTKEIEIGKAEIDILQRASTNLSFNLTPQ
                     VENYNLHHVRSVAPNKDMYCLSFRLPREVAFRHNG"
     gene            complement(527963..531973)
                     /locus_tag="CNI01910"
                     /db_xref="GeneID:3259444"
     mRNA            complement(join(527963..528244,528296..529095,
                     529499..529569,529619..530178,530473..531137,
                     531206..531275,531324..531335,531383..531973))
                     /locus_tag="CNI01910"
                     /product="prib protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538161|gb|CF684002.1,gi|41538165|gb|CF684006.1,
                     gi|41541114|gb|CF686955.1,gi|41541122|gb|CF686963.1,
                     gi|41549837|gb|CF695678.1,gi|41556068|gb|CF701909.1,
                     gi|41568575|gb|CF714416.1"
                     /transcript_id="XM_572986.1"
                     /db_xref="GI:58271659"
                     /db_xref="GeneID:3259444"
     mRNA            complement(join(527963..528244,528296..529095,
                     529499..529569,529619..530178,530473..531137,
                     531202..531275,531379..531964))
                     /locus_tag="CNI01910"
                     /product="prib protein, putative"
                     /transcript_id="XM_572985.1"
                     /db_xref="GI:58271657"
                     /db_xref="GeneID:3259444"
     CDS             complement(join(528163..528244,528296..529095,
                     529499..529569,529619..530178,530473..531137,
                     531206..531275,531324..531335,531383..531843))
                     /locus_tag="CNI01910"
                     /codon_start=1
                     /product="prib protein"
                     /protein_id="XP_572986.1"
                     /db_xref="GI:58271660"
                     /db_xref="GeneID:3259444"
                     /translation="MKRAWDGSSSNSFPNGDSAQQSTNSEQVWVQMPSHPYAAAYSSM
                     ANPFTPSPLHSSTTFDAQTLNSASVNASGSGRQEKRPRTAGSDGKKNSPQGQTKDGDS
                     EGEGDDDDDDDDDENDDESGGNKSASNKKNNNMKMVKGPDGKPKTKLTRGSRACVACR
                     KIKMRCIPDDSAAGQGNGICKRCKAGGHECIFEESNRGKRSSRKNEAMAAKLSKMEAA
                     LKNIGVALSNIDQSSLESFSSALHSSTDDPDVIGLITSHAPVTPNLAVAMNRGSFSSS
                     FGDRAHDMSHEGGHTAQPPLSPRLHSLPDNVLSPLGLLAEASLQNDASKRNFTKGFGT
                     ANGLGKSLARPFSGDRLPEHRNGNVSMNGAATFRMATSDVRGGQVEDDEHFDVDHGLG
                     VSGQNYFKPGAICAIAARFYHKKPELHHSLSAYAKRLAFEVPSRGYKSVEVVQAYLLL
                     SLWTLGPEKTFEQDRTWLMLGMAIRMATDLNLHRKSIMSNLDTEEGRARDLEIINRER
                     CWLHCFVLDRSLSAQMGKPYSLREDYIIRNACESVWHQQKFSLPSDAALSAYVMLQQI
                     MSRAIDSIYSSTSTVSGLRHDCDYMLIVRSAHEELRRWLGDAKNNKWLLSLLKLLKPE
                     LRPYHDSEESIFNLVTEVADILEDCAADPSHQPAIYAAFIREIVRKTKDMRHGGTTTA
                     PASPGSHTIAGHMHGIVPGEAATLGMVGSARAASDASAASARTDTETNTSAANATVDG
                     AQGAQNGVYDPSLMGQNATNWHPDVLPHETQFTFIPQGGDMLILPSQAGPSIAPSPTS
                     AFLANPSGTNINAGNASGAAGTSGSHFGTPSGSNGWAEYLPTFMSSDGFDGWDGSMLL
                     PGFGKGQITLSGGLLHSQYGSGIITPLHQTPIQSRMGSRAGSRTQSPHPH"
     CDS             complement(join(528163..528244,528296..529095,
                     529499..529569,529619..530178,530473..531059))
                     /locus_tag="CNI01910"
                     /codon_start=1
                     /product="prib protein"
                     /protein_id="XP_572985.1"
                     /db_xref="GI:58271658"
                     /db_xref="GeneID:3259444"
                     /translation="MAAKLSKMEAALKNIGVALSNIDQSSLESFSSALHSSTDDPDVI
                     GLITSHAPVTPNLAVAMNRGSFSSSFGDRAHDMSHEGGHTAQPPLSPRLHSLPDNVLS
                     PLGLLAEASLQNDASKRNFTKGFGTANGLGKSLARPFSGDRLPEHRNGNVSMNGAATF
                     RMATSDVRGGQVEDDEHFDVDHGLGVSGQNYFKPGAICAIAARFYHKKPELHHSLSAY
                     AKRLAFEVPSRGYKSVEVVQAYLLLSLWTLGPEKTFEQDRTWLMLGMAIRMATDLNLH
                     RKSIMSNLDTEEGRARDLEIINRERCWLHCFVLDRSLSAQMGKPYSLREDYIIRNACE
                     SVWHQQKFSLPSDAALSAYVMLQQIMSRAIDSIYSSTSTVSGLRHDCDYMLIVRSAHE
                     ELRRWLGDAKNNKWLLSLLKLLKPELRPYHDSEESIFNLVTEVADILEDCAADPSHQP
                     AIYAAFIREIVRKTKDMRHGGTTTAPASPGSHTIAGHMHGIVPGEAATLGMVGSARAA
                     SDASAASARTDTETNTSAANATVDGAQGAQNGVYDPSLMGQNATNWHPDVLPHETQFT
                     FIPQGGDMLILPSQAGPSIAPSPTSAFLANPSGTNINAGNASGAAGTSGSHFGTPSGS
                     NGWAEYLPTFMSSDGFDGWDGSMLLPGFGKGQITLSGGLLHSQYGSGIITPLHQTPIQ
                     SRMGSRAGSRTQSPHPH"
     repeat_region   531485..531525
                     /rpt_type=tandem
                     /rpt_unit_seq="tcg"
                     /satellite="microsatellite"
     gene            532350..534916
                     /locus_tag="CNI01920"
                     /db_xref="GeneID:3259732"
     mRNA            join(532350..532977,533031..533217,533265..533523,
                     533571..533745,533798..534587,534638..534916)
                     /locus_tag="CNI01920"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540631|gb|CF686472.1,gi|41540640|gb|CF686481.1,
                     gi|41542816|gb|CF688657.1,gi|41544719|gb|CF690560.1,
                     gi|41569393|gb|CF715234.1,gi|41571074|gb|CF716915.1,
                     gi|41571084|gb|CF716925.1,gi|41574175|gb|CF720016.1"
                     /transcript_id="XM_572661.1"
                     /db_xref="GI:58271009"
                     /db_xref="GeneID:3259732"
     CDS             join(532404..532977,533031..533217,533265..533523,
                     533571..533745,533798..534587,534638..534857)
                     /locus_tag="CNI01920"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter"
                     /protein_id="XP_572661.1"
                     /db_xref="GI:58271010"
                     /db_xref="GeneID:3259732"
                     /translation="MSFGSCSRHALFTPGALPGSFRTMTTSCVKRVYTAQIRGGDALG
                     KRLPSVSSFPGQLPRHGSHFQSLAFFSTSRRRQTPPPPSPPTTSQSPTVPSKASTTPP
                     TSLNTSKPVATESQDKTDWSIIAKLAGNIWPKNNPNVKFRVIGALTLLVAGKVLNVQV
                     PFFFKTIVDSLNVPITESTTVWVLAGASIAGYGAARVLTTLFGELRNAVFASVAQNAI
                     RKVARETFEHLLNMDMKFHLERQTGGLTRAIDRGTKGISFILSSIVFHVIPTALEISM
                     VCGILSWKFGWDFAAVTAITMLLYTWFTIKTTAWRTTFRKQANAADNKGATVAVDSLI
                     NYEAVKSFNNEKYEVAQYDTTLKAYEKASVKIATSLAALNSGQNFIFSSALTMMMLLG
                     AQGIVKGTMTVGDLVLVNQLVFQLSLPLNFLGTVYRELRQSLIDMDVMFNLQSLDSAT
                     KDSPTAKPLHLKGGEIEFRNVAFAYHPERPIFRDLSFKIPAGQKVAIVGPSGCGKSTV
                     FRLLFRFYDSSSGQILIDGQDIKTVTLDSLRRSIGVVPQDTPLFHADILHNIRYGNLE
                     ATDEQVYEAARKAHVEGTIQRLPEKYATKVGERGLMISGGEKQRLAVARVLLKDPPVL
                     FFDEATSALDVYTETELMRNINSILTGQGKTSVFIAHRLRTISDADLIIVLQDGYVAE
                     QGTHEQLLAMPGGVYHGLWQAQLTESTQPTEEEIERQREELEVVDEKKKQQT"
     gene            complement(<535025..>535844)
                     /locus_tag="CNI01930"
                     /db_xref="GeneID:3259453"
     mRNA            complement(join(<535025..535123,535176..535266,
                     535403..535626,535722..>535844))
                     /locus_tag="CNI01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_572998.1"
                     /db_xref="GI:58271683"
                     /db_xref="GeneID:3259453"
     CDS             complement(join(535025..535123,535176..535266,
                     535403..535626,535722..535844))
                     /locus_tag="CNI01930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572998.1"
                     /db_xref="GI:58271684"
                     /db_xref="GeneID:3259453"
                     /translation="MAARSILALSLAAAVAQAIQITAPSNSSGWDTHGSQLIKWTSVS
                     TDPQNFTIAISKPNSSSRTDVVTTAVNTTDDSYIYMPSSDLKPGDGYRISFTSSDGGI
                     LAQSDEFSITDGTSTVSATASANSSTRTSSGVTVSLVDVSHTSKAASATQSSGAEQLT
                     TVTSGLLMLAGGALAMLA"
     gene            complement(<536329..>539117)
                     /locus_tag="CNI01940"
                     /db_xref="GeneID:3259746"
     mRNA            complement(join(<536329..536395,536444..537084,
                     537165..>539117))
                     /locus_tag="CNI01940"
                     /product="karyogamy-related protein, putative"
                     /transcript_id="XM_572660.1"
                     /db_xref="GI:58271007"
                     /db_xref="GeneID:3259746"
     CDS             complement(join(536329..536395,536444..537084,
                     537165..539117))
                     /locus_tag="CNI01940"
                     /codon_start=1
                     /product="karyogamy-related protein"
                     /protein_id="XP_572660.1"
                     /db_xref="GI:58271008"
                     /db_xref="GeneID:3259746"
                     /translation="MADPTQWSLLRGGPIPADIQATSPRIKELATRLAEADFKFVLLS
                     SESRAALSSASNLFDGLDVAGPSSESSTNVDPIIKLITAIALLHSFVQINWTGPDLPF
                     TPLDVLDASSSSIEDLNAASLPFLTLHGEPAYHLSQHSVFFLLARRLFLSLEADSSAL
                     PTLPLWLLRLHLVHLSLLDEPVSQPETLLDSIKTLLDNPVVQSDQDLIAQIHLELGLL
                     HYSLGTDKHANQEFLTAAKAGGLEFELTGALGKKTKYQVAAHSQLVLLAESRKRDGED
                     DKVEKESAAEEKAALPESLLLNDDTLLEETEFTKVTRDTSSTSRLAHLDPSDQPALHP
                     LDQSLLISFCLAQSNNTPSSGLTAQQMMPFLSRVISHPRNWSVHTTALLLRSRLEATR
                     SRTVERSTLQLQALIEQMPTSDSEPKERLRYFHQLPLPSKWEMERELAKRFMSVGVIR
                     SALEIFTRLEMWEDAIMCMQKMDKEEEAIGIVKDLLAGKKVESDLVPTLGRANVSESR
                     KQKLTAAREGKLWCLLGDLCLGTEAAQRDPSSARETAVEHYEKGWEVSEHTSSRAMRS
                     LGSLYMGTQEYEKAIPCFHSALEINPLYARVWFTLGVACLRLEKWKDARDAFRKQVGV
                     DEDDAEGWNNLAAVYLRLEEEGLPKDQILAFRALRQGLRYAYTNWRMWQNYMIVAVDV
                     GELSEAARAMTRVVEELANRDPEHAIDVDVLDKLVDSVTRDDFSLSKDESTKIVPKTS
                     NEGFGLLPIVERLFDVVILPRISDSPRVWRTHARLLRWKEDWEGAMEDYLRAWRFGPV
                     QDETVERDLGKWKDAVGELENLVAVLSVLGPKAKAAQEEQGEKKKKGDWKFQARGLVR
                     TFMGRTKESFEGEKDWQRLQDLMEELKRSD"
     gene            <539417..>540913
                     /locus_tag="CNI01950"
                     /db_xref="GeneID:3259698"
     mRNA            join(<539417..539584,539636..539791,539849..539997,
                     540063..540125,540218..540554,540622..540739,
                     540789..>540913)
                     /locus_tag="CNI01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_572993.1"
                     /db_xref="GI:58271673"
                     /db_xref="GeneID:3259698"
     CDS             join(539417..539584,539636..539791,539849..539997,
                     540063..540125,540218..540554,540622..540739,
                     540789..540913)
                     /locus_tag="CNI01950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572993.1"
                     /db_xref="GI:58271674"
                     /db_xref="GeneID:3259698"
                     /translation="MVNILEQKVDEVRLEGKLREGEDSAGESETEDIPAPDGEPSIKN
                     KKKKKKKKGKSKASSGANPLLGSIPDEEPAPPPETPEEKAKWDKELKKGCRTFSLPSW
                     YVLDDRTRPILNTFLTPSCKKFALQTPRLRLRQVEVGDTTGIRRIKMEPTVQRTQLYG
                     SPSISDIKESFQNRYIRSREEYVFAITALDPSSLAIKPAGNVRITNRLTSAEGYIGNI
                     ALSLLFTDSCPSLLPQKGQVYTQPTFEQFKKMGLVGKMFYEVHPQLWGQGIMSEAFVE
                     VLRFAMEEVGCTLVQSDPTVNNDASIRLCTKNGMHFVEKRDNEWDKPQLIHEISNGVG
                     RKFVDGVSILDLQRQRFNANIATGQNIVQGNVRERTG"
     repeat_region   539543..539579
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            complement(540983..542617)
                     /locus_tag="CNI01960"
                     /db_xref="GeneID:3259745"
     mRNA            complement(join(540983..541030,541087..542213,
                     542258..542617))
                     /locus_tag="CNI01960"
                     /product="exopolyphosphatase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545218|gb|CF691059.1,gi|41568345|gb|CF714186.1,
                     gi|41568357|gb|CF714198.1"
                     /transcript_id="XM_572843.1"
                     /db_xref="GI:58271373"
                     /db_xref="GeneID:3259745"
     CDS             complement(join(541004..541030,541087..542213,
                     542258..542612))
                     /locus_tag="CNI01960"
                     /codon_start=1
                     /product="exopolyphosphatase"
                     /protein_id="XP_572843.1"
                     /db_xref="GI:58271374"
                     /db_xref="GeneID:3259745"
                     /translation="MRLPRHSSLICLLFAFVTIPPVIFILLFLGYLDSSMRVCLPFSL
                     ARLSTTAHNTLSCQARPVSSIIMDNATIQSGSDNATVPEGKLAGFLSSQRDLFLQDLK
                     DGKGRGWSVVMGNQAGDLDSLASSVAFSQLSATLLASRVVPLILTPPKSMRLRPENLI
                     ALRNTSIPLTSLLHASQLPVSTTELASQGITFALVDHNKLLPEFAQGKVDAIIDHHED
                     ENAHTDASIREITIPTGSCASLVVKHFQPQWEASISRGSPVPPELATLLLSAIVIDTG
                     GLKPGGKATSVDYEAAAFLYSISTIAQGQAGSFSVTGEGGLPPSLKLLSDTLQDAKSD
                     VSNLTTYELLMRDYKEYEWPTQSPNFPTLKVGLSTVPLGLKTWIAKEPEGWETLMSGT
                     EQYMRERTLDIEGILTTYRSEKKGKHKRQLALIIRPGGVIRDPQEARSVFDRLAAGLE
                     ASEMLQLEEWKKEEKVKRQDDERLVKVWVQGNAKATRKQVAPLLKNLVSELQ"
     gene            542970..545717
                     /locus_tag="CNI01970"
                     /db_xref="GeneID:3259591"
     mRNA            join(542970..543094,543200..545224,545283..545470,
                     545530..545717)
                     /locus_tag="CNI01970"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546180|gb|CF692021.1,gi|41546185|gb|CF692026.1,
                     gi|41551015|gb|CF696856.1,gi|41551024|gb|CF696865.1,
                     gi|41552640|gb|CF698481.1,gi|41552649|gb|CF698490.1,
                     gi|41559528|gb|CF705369.1,gi|41559539|gb|CF705380.1,
                     gi|41568990|gb|CF714831.1,gi|41569001|gb|CF714842.1"
                     /transcript_id="XM_572974.1"
                     /db_xref="GI:58271635"
                     /db_xref="GeneID:3259591"
     CDS             join(543242..545224,545283..545470,545530..545572)
                     /locus_tag="CNI01970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572974.1"
                     /db_xref="GI:58271636"
                     /db_xref="GeneID:3259591"
                     /translation="MVSTKALPSSAIPAKQLRSPRSPHSPKSPRTKHTDAFAPLSEVL
                     TDSPSDVAMEPDASAGVGVSPAEPYLLRRVLSGGSNASTLPSNAGSPGMKSAPLSPSS
                     QGARTPKAGKAQQLASDMDGLNVRSPVSNDGSLPPPAGAPDIPEPMNSRKGPKSIDDT
                     KNGGSSDGVEQGPISGDTNGHHTKQRSYTGSTDSSNSQHPVPSPHLGSSYGPEGFPIL
                     HHSPEASPMAYSPYLAGAGASYFGGNGNFDPELAARQAALLAKADEAVRQLNNTATVF
                     QGPMPPGPAYPETFGQVPRNYANFVTPHQNPTVTRQSSTSSSLTDAASTSSEESDWCI
                     PTVEWVPANQWQHSTYLNSPGTVFNRQEKDRVPSNSRMPPPLGTRPTSSRHPSTGPAE
                     HPPLQHQNPLPFRSSAATPPLNTSHPSWATAPASESPDEDDDNQTVGHARDRSPSTSS
                     QSAQSGLDLLWRAAHGIKQPNMPRDVSFDHKGKRKAGAEAVDKWRASGIPTGPPPPVG
                     ASQDEVKPPTTSPPRKRRRSEVEMEEMEMDNAANVEAEEDEEAIAEDPTSDYRSPSTS
                     EGPVSDHDSEYGSGARRGRPIARGRGRGRAGTSARGRGGTANTALSSAPGGITKQGTI
                     KKVRKVGDSPNGTAKGGRKPAAVPPGGVQCDYVNPLPPYNRCTDVFTRKYDLPRHMAR
                     HARREGELVMEGKLSEDKAILWKTIKDKPKVVCDTCGESFTRMDALKRHQAKQHH"
     gene            545898..547529
                     /locus_tag="CNI01980"
                     /db_xref="GeneID:3259391"
     mRNA            join(545898..546365,546422..546559,546618..547529)
                     /locus_tag="CNI01980"
                     /product="zinc-finger protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533414|gb|CF679255.1,gi|41536054|gb|CF681895.1,
                     gi|41544859|gb|CF690700.1,gi|41557948|gb|CF703789.1,
                     gi|41557951|gb|CF703792.1,gi|41558211|gb|CF704052.1,
                     gi|41558219|gb|CF704060.1,gi|41575861|gb|CF721702.1"
                     /transcript_id="XM_572828.1"
                     /db_xref="GI:58271343"
                     /db_xref="GeneID:3259391"
     CDS             join(545948..546365,546422..546559,546618..547450)
                     /locus_tag="CNI01980"
                     /codon_start=1
                     /product="zinc-finger protein"
                     /protein_id="XP_572828.1"
                     /db_xref="GI:58271344"
                     /db_xref="GeneID:3259391"
                     /translation="MASATSSLPPTSPPASTHTMEPSQPQSSPLKAPSIIVSPSKNPV
                     MERVASQQLNSSPGPQWATENNPHPKAGGSYTGVSPAPSVDGHVDVDEEIDELLGDDD
                     VQEGAEEKNGEPEKQKCQWGECQGDFDSKQEFYGHVKDHINASKEYACEWRTCSRVGH
                     KQGRSLLLTHIRGHTGERPYSCTIPGCNKAFARTDALNKHKRTVHADVTNPNGAKPSK
                     GGKGKTKATPGTGKGKGKTKGVAPVPSDIPTPTPAITSKPKSKSLPPPLILSPSPPIP
                     PVSAPDEDLILDPELAELIPRLRSRWPIIPEGNDEIEALREARRRFPRHRLFPNYTKE
                     EDVEEKGSRVGLEELVADPLDDPVARPLRRNGEDEIEYRERVREYLTDTSRPPDADLP
                     MEELDYTLPPLVPEIAHTTEDPEDPEGEVVDVLGRSRWQVRYIMAKARLLLLEEENML
                     RRRYLQELAETR"
     gene            complement(<547749..>549936)
                     /locus_tag="CNI01990"
                     /db_xref="GeneID:3259695"
     mRNA            complement(join(<547749..548046,548098..548181,
                     548229..548405,548463..548559,548616..548696,
                     548746..548816,548874..548978,549031..549133,
                     549183..549466,549515..549648,549712..>549936))
                     /locus_tag="CNI01990"
                     /product="methylmalonate-semialdehyde dehydrogenase,
                     putative"
                     /transcript_id="XM_572841.1"
                     /db_xref="GI:58271369"
                     /db_xref="GeneID:3259695"
     CDS             complement(join(547749..548046,548098..548181,
                     548229..548405,548463..548559,548616..548696,
                     548746..548816,548874..548978,549031..549133,
                     549183..549466,549515..549648,549712..549936))
                     /locus_tag="CNI01990"
                     /codon_start=1
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="XP_572841.1"
                     /db_xref="GI:58271370"
                     /db_xref="GeneID:3259695"
                     /translation="MLPLIRRPLQLRAYTSAAFASTPSSSKLSPLALKAAEDVSSKWK
                     GTTANGGKTKIYIGGEFLDSKTDKWLEVRDPASQTLVNTVPETTPDEFRAAVDAASQA
                     FKTWSKTSIMRRQRAMFELQHLIRQHAPEIANSIVLEQGKTYADALGDVGRGLQVVEN
                     ATAITSTLLGDKLEVANDMDTYVRRLPLGVAAAISPFNFPAMIVLWSAALATVTGNTL
                     IVKPSERDPGATMIIAELCERAGLPPGVINVVHGTVPTVNRICDDPAIKAISFVGSDK
                     AGEHIYNRAIVQGKRVQANLGAKNHAIIMPDANKNLALNSVAGAAFGAAGQRCMALSV
                     AIFVGTAREMIPELIERAKGLKVTGGFEEGADLGPVISPQAKKRIEDYIGSVEEEGGK
                     ILLDGRGYNVSEYPDGSFVGPTIVEAVTTMKVYRNEVFGPVLTIVEADTLDDAIAIIN
                     ANKYGNGASIFTNSGSTARKFEIEAEPGQIGINVAVPVPLPMFGWSGNKASAKGDIPF
                     YGKSGLDFYTYKKTTTSLWPAADAVGNRVSVTFSNDLFLTFSML"
     gene            complement(550246..552951)
                     /locus_tag="CNI02000"
                     /db_xref="GeneID:3259447"
     mRNA            complement(join(550246..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552308,552373..552662,
                     552741..552951))
                     /locus_tag="CNI02000"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533670|gb|CF679511.1,gi|41542266|gb|CF688107.1,
                     gi|41542272|gb|CF688113.1,gi|41551425|gb|CF697266.1,
                     gi|41553830|gb|CF699671.1,gi|41557993|gb|CF703834.1,
                     gi|41568461|gb|CF714302.1"
                     /transcript_id="XM_572838.1"
                     /db_xref="GI:58271363"
                     /db_xref="GeneID:3259447"
     mRNA            complement(join(550246..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552308,552373..552634,
                     552741..552926))
                     /locus_tag="CNI02000"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533670|gb|CF679511.1,gi|41542266|gb|CF688107.1,
                     gi|41542272|gb|CF688113.1,gi|41551425|gb|CF697266.1,
                     gi|41557993|gb|CF703834.1,gi|41557999|gb|CF703840.1,
                     gi|41568461|gb|CF714302.1"
                     /transcript_id="XM_572839.1"
                     /db_xref="GI:58271365"
                     /db_xref="GeneID:3259447"
     mRNA            complement(join(550246..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552308,552373..552926))
                     /locus_tag="CNI02000"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531763|gb|CF677604.1,gi|41533670|gb|CF679511.1,
                     gi|41533672|gb|CF679513.1,gi|41542266|gb|CF688107.1,
                     gi|41542272|gb|CF688113.1,gi|41551425|gb|CF697266.1,
                     gi|41551436|gb|CF697277.1,gi|41557993|gb|CF703834.1,
                     gi|41568461|gb|CF714302.1"
                     /transcript_id="XM_572837.1"
                     /db_xref="GI:58271361"
                     /db_xref="GeneID:3259447"
     CDS             complement(join(550296..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552248))
                     /locus_tag="CNI02000"
                     /codon_start=1
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="XP_572837.1"
                     /db_xref="GI:58271362"
                     /db_xref="GeneID:3259447"
                     /translation="MTSISNGQPAPLAIRQPKDIECWGHRGASAHLPENTLASFRAAI
                     AEGCDGIESDVHATSDGVILMFHDPTLDRTTTGTGLIKDQPWKGVIEHVRTTKEPVQP
                     VPLFEQLISLLMEPQNRHVSLNIDCKMQNDPERLFPEMAKIIGQYENYETELSPRVIL
                     GLWHPLFIRPALKYLPTCRRFHIGFSIPVVKTFFWDVCDGFSMCFPLLMGSEGQAFLK
                     ECREKGKEVTVWTVNDETEMRVAMSWGVKAVLTDRVGAFVNLRKKVVENPEKLALQGM
                     EKYTFPWSHWRYYSVAHNWILRTQLDVMRTVCYQPGPLTMPDLGEFSMVEQGNQAKEE
                     TQNIPSLPRVPVAAQ"
     gene            complement(553762..556111)
                     /locus_tag="CNI02010"
                     /db_xref="GeneID:3259378"
     mRNA            complement(join(553762..554292,554340..554828,
                     554889..554981,555034..555174,555232..555460,
                     555510..555563,555627..555690,555748..555798,
                     555851..555881,555944..556111))
                     /locus_tag="CNI02010"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530699|gb|CF676540.1,gi|41530708|gb|CF676549.1,
                     gi|41539190|gb|CF685031.1,gi|41539205|gb|CF685046.1,
                     gi|41539724|gb|CF685565.1,gi|41539734|gb|CF685575.1,
                     gi|41559411|gb|CF705252.1,gi|41559427|gb|CF705268.1,
                     gi|41572424|gb|CF718265.1,gi|41572433|gb|CF718274.1,
                     gi|41576595|gb|CF722436.1,gi|41576603|gb|CF722444.1"
                     /transcript_id="XM_572983.1"
                     /db_xref="GI:58271653"
                     /db_xref="GeneID:3259378"
     CDS             complement(join(553791..554292,554340..554828,
                     554889..554981,555034..555174,555232..555460,
                     555510..555563,555627..555690,555748..555798,
                     555851..555881,555944..556065))
                     /locus_tag="CNI02010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572983.1"
                     /db_xref="GI:58271654"
                     /db_xref="GeneID:3259378"
                     /translation="MPFGFTHKPLVALANSAICSFFREIEVYGAENVPTEGPIIFACT
                     HANMAVDPALLSNTVPHGHLMHYWVKDSLFKNPAVGWLLHNAGNIAVDRTTRNNQMLF
                     RGTFEALALGECIGVFPEGTSHTEPHIIPLKDGTSWAALEYVRYLQGTEENKGAKKGK
                     KAVVVPVGIAYVDKAKYRSRVVVHYRKPITMEQFESQFLSDEPGANKVAVKNLTKAIT
                     LEFRKMTVNCPDWDTAFAAQMARELLWERESDLSLADYVQVSQTLVDLFCTPNSKIEN
                     LKTLLATYQRLLTSSRLSNAALVGLKLPRQLNPDSVTSLPSRFSTLWLLIKDSIACLI
                     RLPFFIVPMLLHIPVYIVGILGARLVEDELETQAQMKITFGLLLSFLTYPVLFFSLWA
                     VFRNWTLGTVMAAGAVWLLGRYHSALIDENYDAMKRLVAAWRLVVGVWLPRDFEMPLP
                     NFVAQYSLFAPDPPKVAGLPPATPPEKYQKPKRLSSRVLVKHILRVRAQAARELAELL
                     LELENGEEVVAQTWLAEEFGGKVLQQSQQDGAEEQLTGRWVKQGGTRSGREVLQYLKS
                     KGARLGFTAEEVGAVNASGVDTEME"
     misc_feature    556292..556314
                     /note="AT_rich"
     gene            556412..557938
                     /locus_tag="CNI02020"
                     /db_xref="GeneID:3259716"
     mRNA            join(556412..556623,556670..556770,556827..557698,
                     557753..557938)
                     /locus_tag="CNI02020"
                     /product="chaperone, putative"
                     /transcript_id="XM_572659.1"
                     /db_xref="GI:58271005"
                     /db_xref="GeneID:3259716"
     CDS             join(556442..556623,556670..556770,556827..557698,
                     557753..557809)
                     /locus_tag="CNI02020"
                     /codon_start=1
                     /product="chaperone"
                     /protein_id="XP_572659.1"
                     /db_xref="GI:58271006"
                     /db_xref="GeneID:3259716"
                     /translation="MPTKPSTELDAAVLAYLVKRGYTKAVKSLEKEAGVKLLPGQEDK
                     LENAWAATDVAAVAATSDEAEDSSSSESESEDSDSDSDSDSDDEKSTKAVDPATVPLP
                     ESSSSESGSDSGSDSDSSSSSSGSSSSSSTLKSSGKTSGFLDIEAEVSSDEEVSSDEE
                     SEDESESGSESDSSSSSSSSSSSSSSSGSSSSSGSSSSSGSSSSSSSSSSSDSSSSSS
                     KSKSEFKEEQEARPVIGKRKARSPSTSSSSSSSSSSSSSASESLPKSPAVTVVTTKKR
                     KLEDGTETITSTATITPAPKANSSRETSTPASAVGTPVGGKGKRVQGQRFERIKADSV
                     TFHDPGLMDNSFEARERTGANANDYGAKASRDLIVTRGAGFRKEKNKKKRGSYVGGEI
                     TLQTHSIKFDD"
     misc_feature    557075..557157
                     /locus_tag="CNI02020"
                     /note="CT-rich"
     misc_feature    557264..557310
                     /locus_tag="CNI02020"
                     /note="CT-rich"
     gene            complement(557951..>560326)
                     /locus_tag="CNI02030"
                     /db_xref="GeneID:3259412"
     mRNA            complement(join(557951..558133,558200..558434,
                     558485..559038,559105..559294,559346..559441,
                     559492..560014,560067..>560326))
                     /locus_tag="CNI02030"
                     /product="aspartate kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41561219|gb|CF707060.1,gi|41561229|gb|CF707070.1,
                     gi|41564555|gb|CF710396.1,gi|41564557|gb|CF710398.1,
                     gi|41569859|gb|CF715700.1,gi|41569868|gb|CF715709.1"
                     /transcript_id="XM_572658.1"
                     /db_xref="GI:58271003"
                     /db_xref="GeneID:3259412"
     CDS             complement(join(558027..558133,558200..558434,
                     558485..559038,559105..559294,559346..559441,
                     559492..560014,560067..560326))
                     /locus_tag="CNI02030"
                     /codon_start=1
                     /product="aspartate kinase"
                     /protein_id="XP_572658.1"
                     /db_xref="GI:58271004"
                     /db_xref="GeneID:3259412"
                     /translation="MTRDFDSLFFTGPIFVDYSFTARHLESFLSSFPPQVSHAMSSAS
                     TPTAPYLEDLVRNSLDQTLPWVVQKYGGTSVGKSLDNITKIVGSYIDNGSKVAIVCSA
                     RSTQTKSLGTTNLLLQASREALQPALSSSGDGRSGSMSGTATPFYPKRVGSGFFGKDQ
                     STSMVSSVSSLSQLEPQLGRSGSPSPFQSSSSRSPPRSPATPSQDSSVSQEPAFHATV
                     DLIKKGHLEAARASLKEGPLRDELEEEIERDCESLRSFLYAAQIIDEISPRSQDSIVG
                     TGERLACKIVAAALRDRGVDSELVVLDNIVDASMSAASEAISVDAGDQGVAQLGQEFY
                     DQLSFRLGERLRECGQRVPVVTGYFGPVPGSLLAQIGRGYTDLCAALCAVGLKASELQ
                     VWKEVDGIFTADPRKVPSARLVPIITPDEAAELTYYGSEVIHPFTMEQVIRARIPIRI
                     KNVENPSGAGTVIYPDLGFPRGLDTEPPKAERIVEGVDERMPTAVTIKDEIIVLNIHS
                     NRKTLSHGFLARIFGTLDRAGVVVDLISTSEVHVSMAMQDFLNRKRLERLVKDLEKIG
                     EVTVSKDMAILSLVGRNMRNAIGSAGLMFASLARAMINIEMISQGASEINISCVIENK
                     DAIKALNVIHESCLSYPRSPATEMAGLQLQ"
     gene            complement(561681..563066)
                     /locus_tag="CNI02040"
                     /db_xref="GeneID:3259764"
     mRNA            complement(join(561681..561827,561878..562219,
                     562282..562360,562412..562700,562755..562994,
                     563049..563066))
                     /locus_tag="CNI02040"
                     /product="dihydrodipicolinate synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536575|gb|CF682416.1,gi|41536582|gb|CF682423.1"
                     /transcript_id="XM_572656.1"
                     /db_xref="GI:58270999"
                     /db_xref="GeneID:3259764"
     CDS             complement(join(561690..561827,561878..562219,
                     562282..562360,562412..562700,562755..562935))
                     /locus_tag="CNI02040"
                     /codon_start=1
                     /product="dihydrodipicolinate synthase"
                     /protein_id="XP_572656.1"
                     /db_xref="GI:58271000"
                     /db_xref="GeneID:3259764"
                     /translation="MTTNNTSSGAPSRVWAGGPSVPLVTAMNDDESINYEALAKQTVR
                     LAKAGLGIVLLGTNGEASHLSPEERKQCTVVVRKALDDAGFVNEPLLVGTGAGSAQTT
                     IQVTKEAAEAGASHSIVITPGYFSFAMGRDRKAIKDFFRKVFDESPIPVMIYNFPGAA
                     AGIDLTSDEIIELSNHPNCFGVKLTCAMIGKGHRIAAYTQSPEYLAKHGSFLKSCTAT
                     GQFQVLPGFSESTLPALVSRHTGCITGTGNTIPKTIRRLWDKSVAGLQGDSKALAEAM
                     ELQDRVAEADWTIVKAGIQGTKYFLDHYVEKGMGGAVRLPLGTISDDVKKLIEVDLKG
                     AWEFEQSL"
     gene            563659..567317
                     /locus_tag="CNI02050"
                     /db_xref="GeneID:3259691"
     mRNA            join(563659..564035,564127..564160,564210..564289,
                     564349..564676,564767..565119,565168..565561,
                     565612..566065,566265..566383,566436..566637,
                     566685..566817,566870..567317)
                     /locus_tag="CNI02050"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538279|gb|CF684120.1,gi|41539651|gb|CF685492.1,
                     gi|41541703|gb|CF687544.1,gi|41541714|gb|CF687555.1,
                     gi|41542700|gb|CF688541.1,gi|41561455|gb|CF707296.1,
                     gi|41574664|gb|CF720505.1,gi|41574670|gb|CF720511.1,
                     gi|41574676|gb|CF720517.1"
                     /transcript_id="XM_572648.1"
                     /db_xref="GI:58270983"
                     /db_xref="GeneID:3259691"
     CDS             join(563757..564035,564127..564160,564210..564289,
                     564349..564676,564767..565119,565168..565561,
                     565612..566065,566265..566383,566436..566637,
                     566685..566817,566870..567220)
                     /locus_tag="CNI02050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572648.1"
                     /db_xref="GI:58270984"
                     /db_xref="GeneID:3259691"
                     /translation="MLNPSVAATFAGGNNYHRGNSAAPLNMLSHPPSRLSPPPGADIY
                     GVTASSSSQQLPVAGSSATYPTQLPQTAAPLTDTKKQGQNLPKRGYRACTNCRLRKAR
                     CDLGDVNSPSEPPCSRCRREQRDCVFLPSKRRRRTSVADPALREESLDLPQTEIYPVQ
                     AAARPSSANAHSGGAQGAPSVSQSLSQQGPPLASASSVNSSFPQLPKPAANKDDSSSR
                     MPFTQTGIWNETVQQPTSTEDQGSLGGSSAASTTALSPQYRTKKRKTEPSNRKIVNAN
                     LSNEMDALEILANAATDGDDEGEDGKRKQPHDPKKVTWNVGEQYKAPMRELSDFHLIK
                     AGILDEHGLHAMVDNFFRYYHPALPIFQTARIPRCREQLLDLAHNDSFLLTCIVAVAS
                     RHPSDNRYKDVHDKTWAVIRDAMSDYSFTGLPGSVGFVEGVLLLAEHLPRERGTPPRG
                     TSVDMLAGPGTESAGVHGTDNRRSWSLIGLAIRAAYLLGLDQISLEIDESSRTPDVER
                     ARSVWTWCYLYDRTIDKYYFTSSNNLWLTFSARLRTGLAFWSRGPALCFVGYSHISQT
                     GEVAARLNFPLQLSPGAELDGRAHDDSASLMQSLVELTQVMTNAHDILYPSKLRTEVL
                     VKQGEYFLFLDHFRRGALYISSFGYSAHIKRAQWRGDKEASTGRDGSRQAVQIFPRGS
                     ATSPDALYIYDSIAAANEILHISLRLAQMGSLRYLPSRYLINISYAAVFALKSSYSGA
                     VEEKDMHRIRELVDHVCTGLVLSCPDKDHPAVRYGQMLRMLAKRLEELHDASAVPSRY
                     PSPEPVETTSNSNASPQASQDQPSVFPWPAPPNASTEHSAPTPAFQLPPFPDMSFLTN
                     SQVNPDYLGENNTSNSEKQAAMFDYEDTKFDFDLKGFWDDFSLGEGSGFPFR"
     STS             563997..564772
                     /locus_tag="CNI02050"
                     /standard_name="Hind7"
                     /db_xref="UniSTS:470713"
     gene            complement(<567866..>569487)
                     /locus_tag="CNI02060"
                     /db_xref="GeneID:3259548"
     mRNA            complement(join(<567866..568196,568249..568379,
                     568435..568585,568636..568732,568783..568862,
                     568913..569119,569168..>569487))
                     /locus_tag="CNI02060"
                     /product="mandelate racemase/muconate lactonizing enzyme,
                     putative"
                     /transcript_id="XM_572835.1"
                     /db_xref="GI:58271357"
                     /db_xref="GeneID:3259548"
     CDS             complement(join(567866..568196,568249..568379,
                     568435..568585,568636..568732,568783..568862,
                     568913..569119,569168..569487))
                     /locus_tag="CNI02060"
                     /codon_start=1
                     /product="mandelate racemase/muconate lactonizing enzyme,
                     putative"
                     /protein_id="XP_572835.1"
                     /db_xref="GI:58271358"
                     /db_xref="GeneID:3259548"
                     /translation="MSANPPQPVNVTTDSSVKADREAVYLPPSDLALKYNKGLQCSLA
                     VQPHPSAGQAGSTKIKKIETFYVRPRWLFVRIETEGGVVGWGEGTLEGHTEAVQGSMK
                     DIARRLIGWDAMNIEEIYTYLYRHRFYRGGEVLMSAMSGVDIALWDIKGKVLGVPVWE
                     LLGGKVRERCDVYGWVGGDRPSDVAEQAKARKEQGFRFVKMNATESIGWLDSPHALDD
                     TVKRLAEVKAVGIDAGLDFHGRVHKGMAKQLAAGLEPHRPFFIEEPLLPGHVNELKDL
                     YNKTNIPIALGERLFTRLDVRPYLESGCIDLIQPDIAHAGGISETKKIAIMAEAYDVG
                     LAPHCPLGPLAFAASLHVGFSTPNFVICEMSLKMHYNVGKDLLSYMLNPEVFDIENGS
                     IGLLTAPGLGIELNEDMIRKEAAEAAELEPWINPLFRGEDGAMREW"
     gene            570856..573006
                     /locus_tag="CNI02070"
                     /db_xref="GeneID:3259658"
     mRNA            join(570856..571333,571391..571563,571619..571918,
                     571974..572237,572292..572604,572657..573006)
                     /locus_tag="CNI02070"
                     /product="nicotinamide mononucleotide permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537429|gb|CF683270.1,gi|41537441|gb|CF683282.1"
                     /transcript_id="XM_572830.1"
                     /db_xref="GI:58271347"
                     /db_xref="GeneID:3259658"
     CDS             join(571122..571333,571391..571563,571619..571918,
                     571974..572237,572292..572604,572657..572894)
                     /locus_tag="CNI02070"
                     /codon_start=1
                     /product="nicotinamide mononucleotide permease"
                     /protein_id="XP_572830.1"
                     /db_xref="GI:58271348"
                     /db_xref="GeneID:3259658"
                     /translation="MSLEEKLSQEHLDRVISEKDKLDDGVDRHLAVKIPESLVGLSPE
                     EVNAIDRKATLKLDLLLMPVLMALYILNYLDRQNISSAKIAGIMDDLGLTTTQYNTCV
                     AVLFAGYVSLQIFSNIFASKINYPGVYICVMCAIWGVISGCTGAVQSYAGLAVCRVVL
                     GFAESAFFPGAVYLNSCFYTKKQMALRTAILYSGSQIGNAFGGLFALAILNLDGAHGL
                     EGWRWLFIVEGVLTVGLAIIFATFIPNKPGTMKWLSQQERDRLTYRLEVDRSSKDATD
                     EVTVWTAFKMASCDPKTWLLCAVLYCNYIAASVTNFFPVVVSGLGFNRTVTLAITCPP
                     YVLCCFSILIIGWHSDKKNERTLHIICPFFITIIANILAISTTKIAPRYVAMCLLPSS
                     FYGATCCVLSWISSSITGPAVKRAIAIAIINAVCNTPNIWTSYLYYDAPRYVAAFGVD
                     LAASVLTIAFAALTYLYLRRQNSKIERGEPLPVSGPSVVQLEAGFRYQL"
     gene            573390..575763
                     /locus_tag="CNI02080"
                     /db_xref="GeneID:3259487"
     mRNA            join(573390..573480,573592..574625,574678..574928,
                     574978..575085,575135..575341,575389..575763)
                     /locus_tag="CNI02080"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530460|gb|CF676301.1,gi|41530470|gb|CF676311.1,
                     gi|41532746|gb|CF678587.1,gi|41532751|gb|CF678592.1,
                     gi|41533704|gb|CF679545.1,gi|41533710|gb|CF679551.1,
                     gi|41536246|gb|CF682087.1,gi|41536260|gb|CF682101.1,
                     gi|41539754|gb|CF685595.1,gi|41544179|gb|CF690020.1,
                     gi|41544185|gb|CF690026.1,gi|41552213|gb|CF698054.1,
                     gi|41552231|gb|CF698072.1,gi|41553801|gb|CF699642.1,
                     gi|41553806|gb|CF699647.1,gi|41555452|gb|CF701293.1,
                     gi|41555457|gb|CF701298.1,gi|41556746|gb|CF702587.1,
                     gi|41556754|gb|CF702595.1,gi|41564113|gb|CF709954.1,
                     gi|41564131|gb|CF709972.1,gi|41565446|gb|CF711287.1,
                     gi|41565483|gb|CF711324.1,gi|41567604|gb|CF713445.1,
                     gi|41567609|gb|CF713450.1"
                     /transcript_id="XM_572646.1"
                     /db_xref="GI:58270979"
                     /db_xref="GeneID:3259487"
     CDS             join(573689..574625,574678..574928,574978..575085,
                     575135..575341,575389..575511)
                     /locus_tag="CNI02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572646.1"
                     /db_xref="GI:58270980"
                     /db_xref="GeneID:3259487"
                     /translation="MSPSFLPLISSVFAIHILFFAFTSFTQTHAYPHNRRQGVALTRE
                     GSEPSHEAAQSILTNSGSELGQSSTAWNQPDSTSAAVSRIASVTSGPTTNELTSNAMS
                     TLSPTTVASDSSLTETLTSSTPVTTSFTPVSGLAFPSVTPSPSITASSYKTLTSFIPY
                     ILSNANSIAVHSWELGAFTETLLEVYYPQLTPFGWDCRAFDGEDIPWSVLKIAKDAIS
                     HYNWTGAPGQDFGKNLPDYLFPDTTPHAHVSQALVGGDGALGDPVSLVPAVWLLARFA
                     RQDDVRDKLGLRCPEDYAWAVGNQLDYLFNGPASDNGTISQREAGFEVWSDMGYMIPP
                     SLAYLGLDISDDSLLKKALEQFSLESSAMLDTDQLIYQHIPATDARLWATGNGWMTYG
                     LMRDLASVKMSSFAEDLSSLKSDAEQTIAGVFKALFDQLGEDSLLPDYMLQGNSTLAL
                     GDTAGTALSVAAYYRFLEIAPHLTSQDLTAKAEKAFDGVVAKIDDDGWVTHCVDPMGT
                     YGWVVYPEDHSLHSPEGQAFAAKMWKARTDAGY"
     gene            complement(575571..579503)
                     /locus_tag="CNI02090"
                     /db_xref="GeneID:3259643"
     mRNA            complement(join(575571..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..579038,579105..579490))
                     /locus_tag="CNI02090"
                     /product="f-box protein pof6, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535576|gb|CF681417.1,gi|41550010|gb|CF695851.1,
                     gi|41550013|gb|CF695854.1,gi|41551712|gb|CF697553.1"
                     /transcript_id="XM_572981.1"
                     /db_xref="GI:58271649"
                     /db_xref="GeneID:3259643"
     mRNA            complement(join(575778..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..579061,579105..579503))
                     /locus_tag="CNI02090"
                     /product="f-box protein pof6, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535592|gb|CF681433.1,gi|41551718|gb|CF697559.1,
                     gi|41574775|gb|CF720616.1"
                     /transcript_id="XM_572980.1"
                     /db_xref="GI:58271647"
                     /db_xref="GeneID:3259643"
     CDS             complement(join(575794..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..579061,579105..579399))
                     /locus_tag="CNI02090"
                     /codon_start=1
                     /product="f-box protein pof6"
                     /protein_id="XP_572980.1"
                     /db_xref="GI:58271648"
                     /db_xref="GeneID:3259643"
                     /translation="MDKWAPIAPSRPQFQSASHLSNRFASVLKPSKHGPRSGAPAQFI
                     GRWPEDVILRIIELLPIPDLPNAARVNRAFAHLVKDERGWEWRCTLLGIEHESIAPFT
                     ANLKDNELKPPVSTQRKPSFPAQQASVLEDDFGDFTGQDKDVFEDVDFGDFETAKPTV
                     PQGKFGTNTQQWGTSKEQNLLDFEDLPLPSRPTGSSSSHGRTTGFFALTPTMPLPSAS
                     FSSHSPGPYYLAYKTHHLSLLPFCKHLRSSPSPSSTLSLLFPPSPTTALPPSLSHQSS
                     VLLSLIRFLSPQLQPLRDWGFLRQALLAAADRFDSTCLVAFEVSDGKKDEEGMKEAAE
                     SSWKVWEAGGGDREKWECGRVWVEKREVFYDTSRWDSLENIIKVQTQSGATIRQLDFT
                     PMDAFMSHVLEAFRIDAEIAHSVFPSKAKVVLSFCDRLSNEVIGEYIHPLLSQARAVS
                     QDLFLRAAAATFVQAWKLVDVAMEVLGDEQNVIKKEQVEDSVFHMFEEHLDDYLDDET
                     ERVKHHLEDICRIWEQQLGTSDSEQLSKSHTPTFLISANPDQVKRNVLASFKDALLLP
                     VTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQKWTGKGGVVKEVKDGEEVVFEVTDVD
                     EKTAEDMTNDDIMEGVRVTENVENVKEALEPSHASSSNDSHARSAAGSLESSHPSTPS
                     PKNNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFVKYPGKVGTKVREAIEEIFIFL
                     LKAVGDRHIAPGFKIATNQMSTYKPAEHEETTSVAPLLQFFELVHIGDTIQSMVQVYF
                     DKELSPYVDKTDFLNAVMREKKRFESVLDDAVAAGLNAGIEVLMNQVEHIILVKTGPR
                     EYYPVEGTPMELGPTQGCKEAIMCLEMHCNLLKGSTSKEVLEVFYQEVGIRLEAIIQR
                     HIKRQIISLEGGFQVIADLNAYYDFVSSLKQQRITDDFSDLKMLGNVYIVSDAKDLAQ
                     IVRDVSRYGGAFTPEDIYEFIQRRSDWKKIEKTVDKAMYALSVREDCVVM"
     CDS             complement(join(575794..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..578723))
                     /locus_tag="CNI02090"
                     /codon_start=1
                     /product="f-box protein pof6"
                     /protein_id="XP_572981.1"
                     /db_xref="GI:58271650"
                     /db_xref="GeneID:3259643"
                     /translation="MPLPSASFSSHSPGPYYLAYKTHHLSLLPFCKHLRSSPSPSSTL
                     SLLFPPSPTTALPPSLSHQSSVLLSLIRFLSPQLQPLRDWGFLRQALLAAADRFDSTC
                     LVAFEVSDGKKDEEGMKEAAESSWKVWEAGGGDREKWECGRVWVEKREVFYDTSRWDS
                     LENIIKVQTQSGATIRQLDFTPMDAFMSHVLEAFRIDAEIAHSVFPSKAKVVLSFCDR
                     LSNEVIGEYIHPLLSQARAVSQDLFLRAAAATFVQAWKLVDVAMEVLGDEQNVIKKEQ
                     VEDSVFHMFEEHLDDYLDDETERVKHHLEDICRIWEQQLGTSDSEQLSKSHTPTFLIS
                     ANPDQVKRNVLASFKDALLLPVTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQKWTGK
                     GGVVKEVKDGEEVVFEVTDVDEKTAEDMTNDDIMEGVRVTENVENVKEALEPSHASSS
                     NDSHARSAAGSLESSHPSTPSPKNNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFV
                     KYPGKVGTKVREAIEEIFIFLLKAVGDRHIAPGFKIATNQMSTYKPAEHEETTSVAPL
                     LQFFELVHIGDTIQSMVQVYFDKELSPYVDKTDFLNAVMREKKRFESVLDDAVAAGLN
                     AGIEVLMNQVEHIILVKTGPREYYPVEGTPMELGPTQGCKEAIMCLEMHCNLLKGSTS
                     KEVLEVFYQEVGIRLEAIIQRHIKRQIISLEGGFQVIADLNAYYDFVSSLKQQRITDD
                     FSDLKMLGNVYIVSDAKDLAQIVRDVSRYGGAFTPEDIYEFIQRRSDWKKIEKTVDKA
                     MYALSVREDCVVM"
     gene            complement(580631..581911)
                     /locus_tag="CNI02100"
                     /db_xref="GeneID:3259692"
     mRNA            complement(join(580631..581424,581487..581652,
                     581712..581911))
                     /locus_tag="CNI02100"
                     /product="expressed protein"
                     /transcript_id="XM_572833.1"
                     /db_xref="GI:58271353"
                     /db_xref="GeneID:3259692"
     mRNA            complement(join(580795..581059,581118..581424,
                     581487..581652,581712..581911))
                     /locus_tag="CNI02100"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41562908|gb|CF708749.1"
                     /transcript_id="XM_572832.1"
                     /db_xref="GI:58271351"
                     /db_xref="GeneID:3259692"
     CDS             complement(join(580891..581059,581118..581424,
                     581487..581652,581712..581885))
                     /locus_tag="CNI02100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572832.1"
                     /db_xref="GI:58271352"
                     /db_xref="GeneID:3259692"
                     /translation="MAYPRYNNYEQGVPPVQPAAYYSTPSTSALPSREPLSREPHRVL
                     FAGLPPDITASDLRDLLLSEPLHLSPLTTSVTSLHSENGDFQGVMLVYVETAEDAERI
                     RAQYSGQPIDGSLVLQVHHVLPSHVSLPLTNSVAPARPANQQSKTIPTGPKASSGPTQ
                     TNQQAQRHSAQRNSMSGKKAAGAMHAQAESAPPGLALLKRIGKAGQEDDRRKQQGGAN
                     KQKANVKSHSAGADLLSRLNPSPGDHSKNNKKNKNTKASNGSAKVNRAKGKAA"
     CDS             complement(join(581114..581424,581487..581652,
                     581712..581885))
                     /locus_tag="CNI02100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572833.1"
                     /db_xref="GI:58271354"
                     /db_xref="GeneID:3259692"
                     /translation="MAYPRYNNYEQGVPPVQPAAYYSTPSTSALPSREPLSREPHRVL
                     FAGLPPDITASDLRDLLLSEPLHLSPLTTSVTSLHSENGDFQGVMLVYVETAEDAERI
                     RAQYSGQPIDGSLVLQVHHVLPSHVSLPLTNSVAPARPANQQSKTIPTGPKASSGPTQ
                     TNQQAQRHSAQRNSMSGKKAAGAMHAQAESAPPGLALLKRIGKAGQEDDRRKQQGG"
     gene            complement(582225..585229)
                     /locus_tag="CNI02110"
                     /db_xref="GeneID:3259505"
     mRNA            complement(join(582225..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584456,584508..584924,
                     584976..585229))
                     /locus_tag="CNI02110"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541947|gb|CF687788.1,gi|41556269|gb|CF702110.1"
                     /transcript_id="XM_572977.1"
                     /db_xref="GI:58271641"
                     /db_xref="GeneID:3259505"
     mRNA            complement(join(582225..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584924,584976..585229))
                     /locus_tag="CNI02110"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538303|gb|CF684144.1,gi|41541140|gb|CF686981.1,
                     gi|41566187|gb|CF712028.1,gi|41570163|gb|CF716004.1"
                     /transcript_id="XM_572978.1"
                     /db_xref="GI:58271643"
                     /db_xref="GeneID:3259505"
     mRNA            complement(join(582225..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584456,584508..584611,
                     584976..585167))
                     /locus_tag="CNI02110"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41570167|gb|CF716008.1"
                     /transcript_id="XM_572976.1"
                     /db_xref="GI:58271639"
                     /db_xref="GeneID:3259505"
     CDS             complement(join(582706..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584456,584508..584924,
                     584976..585127))
                     /locus_tag="CNI02110"
                     /codon_start=1
                     /product="nuclear mRNA splicing protein"
                     /protein_id="XP_572977.1"
                     /db_xref="GI:58271642"
                     /db_xref="GeneID:3259505"
                     /translation="MASLRRPSTAIPRGPASVQFDRGARPPLPNDNKQKRMSKVGEKI
                     KKRLSMRYGGNESFSVPPPLPGASDFLTADPYGGLDIETPGEDLAASPFGLYGASDLK
                     ESSIQSSQPLDTQEHLVDESIGRRGAADATLEEEWNLEELSNEKVDAQAYVKKVLTGA
                     DEEEKRRFVAALMREKQANKKELQRTVFKHYAEFVAISKEISTLENDMLELKELLGQW
                     KDLPQLMGMEDTLAPTLDRNGNLERRRTQRKSVFDLQNLYRNQLTQLWSIVEGSQKYL
                     PVVAGRHLVFELHGVVELNPATYKPKQNVSIFLLNDVLLIAGKRRNKGGSTTSVGDEK
                     DRDRGRMVAERCWNLIELGIVDVKDGGELVNVIKVHRGKEHCVYRTQKSDDKRALINA
                     FRQISREANEKKRKDSEKEQERRKTMWLGDKNGNGTGNSGHPLSTIGPSMADSKDLRW
                     IDEYGDELTMAIAIRDWEESVKLVEKGQALSKSIESNSSAHSLLVSRLEQLVPSLVSQ
                     ISHDLSSSNLRKSSSARLISLLVRLDLADHARDSFLESRRELMFKRVRSIKCDGDVSI
                     YINELAVVIFTIIRHTSDWYMNAFKENNMASGFVTWAKQQIETFADLFRRQMDAPNIS
                     ESTVNECLHVTATQNRKLLRDVGLDFTFLLSSLLQPSSNPSDYPHSVFTSV"
     CDS             complement(join(582706..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584924,584976..585127))
                     /locus_tag="CNI02110"
                     /codon_start=1
                     /product="nuclear mRNA splicing protein"
                     /protein_id="XP_572978.1"
                     /db_xref="GI:58271644"
                     /db_xref="GeneID:3259505"
                     /translation="MASLRRPSTAIPRGPASVQFDRGARPPLPNDNKQKRMSKVGEKI
                     KKRLSMRYGGNESFSVPPPLPGASDFLTADPYGGLDIETPGEDLAASPFGLYGASDLK
                     ESSIQSSQPLDTQEHLVDESIGRRGAADATLEEEWNLEELSNEKVDAQAYVKKVLTGA
                     DEEEKRRFVAALMREKQANKKELQRTVFKQQVFPLLSIHECSYIKHSYAEFVAISKEI
                     STLENDMLELKELLGQWKDLPQLMGMEDTLAPTLDRNGNLERRRTQRKSVFDLQNLYR
                     NQLTQLWSIVEGSQKYLPVVAGRHLVFELHGVVELNPATYKPKQNVSIFLLNDVLLIA
                     GKRRNKGGSTTSVGDEKDRDRGRMVAERCWNLIELGIVDVKDGGELVNVIKVHRGKEH
                     CVYRTQKSDDKRALINAFRQISREANEKKRKDSEKEQERRKTMWLGDKNGNGTGNSGH
                     PLSTIGPSMADSKDLRWIDEYGDELTMAIAIRDWEESVKLVEKGQALSKSIESNSSAH
                     SLLVSRLEQLVPSLVSQISHDLSSSNLRKSSSARLISLLVRLDLADHARDSFLESRRE
                     LMFKRVRSIKCDGDVSIYINELAVVIFTIIRHTSDWYMNAFKENNMASGFVTWAKQQI
                     ETFADLFRRQMDAPNISESTVNECLHVTATQNRKLLRDVGLDFTFLLSSLLQPSSNPS
                     DYPHSVFTSV"
     CDS             complement(join(582706..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584456,584508..584560))
                     /locus_tag="CNI02110"
                     /codon_start=1
                     /product="nuclear mRNA splicing protein"
                     /protein_id="XP_572976.1"
                     /db_xref="GI:58271640"
                     /db_xref="GeneID:3259505"
                     /translation="MREKQANKKELQRTVFKHYAEFVAISKEISTLENDMLELKELLG
                     QWKDLPQLMGMEDTLAPTLDRNGNLERRRTQRKSVFDLQNLYRNQLTQLWSIVEGSQK
                     YLPVVAGRHLVFELHGVVELNPATYKPKQNVSIFLLNDVLLIAGKRRNKGGSTTSVGD
                     EKDRDRGRMVAERCWNLIELGIVDVKDGGELVNVIKVHRGKEHCVYRTQKSDDKRALI
                     NAFRQISREANEKKRKDSEKEQERRKTMWLGDKNGNGTGNSGHPLSTIGPSMADSKDL
                     RWIDEYGDELTMAIAIRDWEESVKLVEKGQALSKSIESNSSAHSLLVSRLEQLVPSLV
                     SQISHDLSSSNLRKSSSARLISLLVRLDLADHARDSFLESRRELMFKRVRSIKCDGDV
                     SIYINELAVVIFTIIRHTSDWYMNAFKENNMASGFVTWAKQQIETFADLFRRQMDAPN
                     ISESTVNECLHVTATQNRKLLRDVGLDFTFLLSSLLQPSSNPSDYPHSVFTSV"
     gene            585403..>587496
                     /locus_tag="CNI02120"
                     /pseudo
                     /db_xref="GeneID:3259754"
     gene            complement(<588702..>589652)
                     /locus_tag="CNI02130"
                     /db_xref="GeneID:3259626"
     mRNA            complement(join(<588702..588749,588876..589095,
                     589147..589247,589296..589373,589428..>589652))
                     /locus_tag="CNI02130"
                     /product="single-stranded nucleic acid binding protein,
                     putative"
                     /transcript_id="XM_572996.1"
                     /db_xref="GI:58271679"
                     /db_xref="GeneID:3259626"
     CDS             complement(join(588702..588749,588876..589095,
                     589147..589247,589296..589373,589428..589652))
                     /locus_tag="CNI02130"
                     /codon_start=1
                     /product="single-stranded nucleic acid binding protein"
                     /protein_id="XP_572996.1"
                     /db_xref="GI:58271680"
                     /db_xref="GeneID:3259626"
                     /translation="MQSTQPVASSSSTPVGPNADRLYVGNLSPTVDEFTLIQIFSKYG
                     KITKLDFMFHKTGILKGKPRGFAFIQFLDKADALKAMVKLHDRLLRGRKLVVTYASTA
                     PPDNSMLPTKGRRAEPTKTTTLSLLKSQRKPQSTAAQIAAMEAKLASMQQRKPPDENW
                     IPGSGVGSPAEASNSASPIPNLPAEELLGDIEGEKAAAELEREMQSELPVKKGFASLP
                     KKPVF"
     gene            <589943..>597256
                     /locus_tag="CNI02140"
                     /db_xref="GeneID:3259524"
     mRNA            join(<589943..590206,590259..590610,590664..591292,
                     591343..591491,591540..591690,591745..592005,
                     592060..592758,592810..593037,593090..593347,
                     593397..593673,593723..593842,593894..594072,
                     594132..594331,594384..594602,594652..594801,
                     594855..595170,595221..595427,595475..595756,
                     595808..595981,596036..596419,596468..596714,
                     596765..596796,596855..597192,597241..>597256)
                     /locus_tag="CNI02140"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541679|gb|CF687520.1,gi|41555829|gb|CF701670.1,
                     gi|41566161|gb|CF712002.1"
                     /transcript_id="XM_572644.1"
                     /db_xref="GI:58270975"
                     /db_xref="GeneID:3259524"
     CDS             join(589943..590206,590259..590610,590664..591292,
                     591343..591491,591540..591690,591745..592005,
                     592060..592758,592810..593037,593090..593347,
                     593397..593673,593723..593842,593894..594072,
                     594132..594331,594384..594602,594652..594801,
                     594855..595170,595221..595427,595475..595756,
                     595808..595981,596036..596419,596468..596714,
                     596765..596796,596855..597192,597241..597256)
                     /locus_tag="CNI02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572644.1"
                     /db_xref="GI:58270976"
                     /db_xref="GeneID:3259524"
                     /translation="MFVHILIFNREDGLVSSQPLLPRIADPRSLDEPLHLHILTSLAS
                     SYAAHPSNSDEQPIHALTRGLPQTALSTSAGQGLPGSDEEDDEWTELEINHAISYAHY
                     VYSLPITSLNLAASVEKLKKLLWGLIRQGTIVVDPIASPASSSSARADVGLAGSVGQA
                     QLCQDLIKAMIWAGWSSEEARSDVGETLVRLGQQIADLCSSNAQTTFPLVLLNSIHSV
                     ITHCPLPPFPTSIVARLVSAFLPISSPKFLVKLVRQSSSAASTPHFRLPKNSPFLAQY
                     PSSPVAVVMLVTEAITALLGNSLFSQPDINEVQKAFVKHSDQMNSPFLPNSEPSGSRP
                     VLEHQINQLVSFPVEGHGLSSTPEGRAVLAEADRMSLRWWSDLMGSTYVDAERELPGR
                     RGNLFAHGRNEPEEEVDLTVAVLHLMNMIVLRQPDGDKTQLARLKMLLSESSTITDAR
                     VLEAAFTCTTILVRNNPSLGTPMTHHIRRLLMTPLPAFEGEIAGLGGDVPPAVVAAGK
                     CLSVCIEMSANDDLTSSTLYSLLNTLSHGQGNSGSAGVNSIRSLPLHYQGGEADTYTL
                     KTTLTGGKGSEEQRRLVAAAAVQVVSRLALELGKDDILHLSLAMLLQRLRGVDIATEA
                     TIVANLVPLALASSNADLIEVYRAFSQIARSSHPEDPRRSSNAILAALTTLAKGMYKR
                     LDCADGYLVELLTLFADKGTQTQMISMAAHAFDSKDREQLAQLRTEGNTRVADMKSWL
                     SALLIPISTLLSHPHYHPDQAASPELVTHFRNLWFTLVVFGLSGSVGKNNLNEHEWEA
                     LGVIAEKTPVLVLESSNDFVESELEYNSTLRKDFAASIQHRQSTALNEYLPQQRQSYD
                     TRNLSTPQITFLMAVHDLEEMRTLRHRPSVVLQYFCNVSLNTSSLIGCLDAIVQKVSK
                     SFLRQLYHQAITHSLPPIISKEVCKILVACTHRMSKVREKALAYAHLILETFSALLCD
                     KEVVFTLLEILTLMRRSCETQYTDEYSPVYEFSSDRMDLTLHLTDDYAVRNEIVTQLH
                     TVTCTWLTLAISRAPIEVQSILQSYLNEARDVLLIDSVEMGAGLALHFSKAISKLDRQ
                     ETIMPNIGGWPSDSSNLVASQFASKNYHTGELSGARLVLSQGLSDLQKGSPTESSQAE
                     LAAFKFQMAQSVSNIRINSKSLDVPEIRRLLLRGVSVLVASRRMDRDILHYLVELPMV
                     AFTPLAIAAGVDAWTWLLRQRPEAEVAIVGAITAGWMQTIIEKKGFFNNSMNYQDPFE
                     RPVEYSPSDKKITDLELAKARRLLRPHTLLVQVLSSQFHAIKYRERAMTIALIRLMMR
                     SLEAHREMSTHPLAREVRFSFLLFGFQILSSSRMEALLELRLRDNLYNAAFSWFSVRP
                     QWSYGSDRIQVGAEIKLLQDFLSAVANDGIRAEHYTSSMADRTPAFLIPGASSIQEYL
                     VQHKDRVRLLQLLVENEISRLAVWSNPVNEHGRTSAPAVGSLERSTSATDWTRLLQTA
                     WKLNPAMAVQMGERFKISSLQAEISHLVKSDPKAVQDVAEALHFLLGDKLEQDAKAAL
                     KWLPLWAAVPPVTAIVYFQPRYGNHPLILQYAMRVLEQHPVELTFFFVPQVVQALRAD
                     GLGYVERFIFETSKISQLFCHQIIWNMKANTYRDDDASQPDPMKPLLDRMIDMIVHGL
                     SGKSKAFYDLEFDFFDEVTSISGKLKPFIKKSKPEKKAKIDEEMAKIKLSVGVYLPSN
                     PDGVVVDLDRKSGRPLQSHAKAPFMATFKVQKEKLDLPSNQSIENPDEAKMVKTTYDV
                     WQAAIFKVGDDCRQDVLALQIIAMFKNVFTSIGLTLYLYPYRVTATAPGCGVIDVVPN
                     ATSRDEMGRAKINDLFSYFVDKYGGVDTASFQKARLNFIQSMAAYSVACYILQIKDRH
                     NGNIMIDGEGHIVHIDFGFLFDIGPGGMKFEPSSFKLNHEMVALMGGRDSQGYKMFTE
                     LTVKAFLAIRPHADQIIDAVHLMLGTALPSFKGEGTIIRLRNRFQLQLGERQAAEFMM
                     GVIRNAHENMRSNVYDGFQKMQNGIPY"
     gene            597580..598913
                     /locus_tag="CNI02150"
                     /db_xref="GeneID:3259537"
     mRNA            597580..598913
                     /locus_tag="CNI02150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572849.1"
                     /db_xref="GI:58271385"
                     /db_xref="GeneID:3259537"
     CDS             597610..598506
                     /locus_tag="CNI02150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572849.1"
                     /db_xref="GI:58271386"
                     /db_xref="GeneID:3259537"
                     /translation="MSYIFRPALVISRASRTASLPWAGAAGMVANFASSSRVRLDTTP
                     SSFSRVNTTSASTTTFVGEEMPEPLPSLEAEGEAERSVSAHQSPSTSNPNPDPIPNHQ
                     IPPQKASPIPQPSPLGSLSSPSSSLPRPSHIPQFTTSRQVARSPYAGLRWTPETIDFS
                     YPISNSDLTPTHTLHIRSTRNNVLLTLTDGLGPLFGTVTGGTDRTFKNAQRSTYEAAA
                     QAAIKMFERVAEWSRETKTSKKHEPKLRISYNGLFGSAREAVTTTLAGPQGSDIRRLI
                     VRVEDRTKVKIGGVRARKPRRL"
     gene            complement(<599180..>601497)
                     /locus_tag="CNI02160"
                     /db_xref="GeneID:3259628"
     mRNA            complement(join(<599180..599482,599535..600251,
                     600304..600565,600707..>601497))
                     /locus_tag="CNI02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_572642.1"
                     /db_xref="GI:58270971"
                     /db_xref="GeneID:3259628"
     CDS             complement(join(599180..599482,599535..600251,
                     600304..600565,600707..601497))
                     /locus_tag="CNI02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572642.1"
                     /db_xref="GI:58270972"
                     /db_xref="GeneID:3259628"
                     /translation="MGHDGNFSGSNGTDDGDSQSQPRQQSHANSQPLGGKSLEARAYR
                     STPSVSSAISGSAVIPEDTFGTIKKHVQSLFPPSDLRPKASDGTSIAGDDSNSSRPSR
                     RPLADISATANRTPTSAGIASEFSTPAELSFGPQSLPFMLRKRELVNEGTPSKPTSTA
                     TVTNLSKDPNGPSTGTQFSGRQQLILDHHNESHETHKSSVNHDTNLHQSSVDHSNKPL
                     FEKKLTSWRRDQIKKAKQPELILASTPKPIPTFYGPLSLPYARNPSMIGTESVRSISS
                     ATQSSGVQSFRSASGSSVLYSTGKKNLGTKLASEDSISIGETYKAMPLVLRDTYQNNG
                     IKADNSILALGSKVAHDSIPRKFDPTSPNSSSETAETTQEATDTYSRSAIFPNPQGKK
                     RVVSDTELLERKLGTSVIGPSKSHANLRQLISLSPIPGSPADYQRKSDITAIRNACKA
                     RVRSTSMSRVKPTPTQSEEEDYTSSYATPIRIPAFLPVFFNPSSMTCEINVSPDRAIA
                     QTPVPGHQTIYVKSGSSLPSKADVSHNWRHKPRSQVFRSKQALQPSRALAQTPSARPL
                     HTDAARHAGQIMTIDKLFEKFSPQVEETQALFKSPVMGELSSSDSTSLAGPNLSPVPS
                     KVIQDPDGEIYVDKVNSGASDAFKTANTPLKPHSDDVYVAPPAPYLSKATPGAGRLLN
                     NARQSGRK"
     gene            <602204..602768
                     /locus_tag="CNI02170"
                     /db_xref="GeneID:3259416"
     mRNA            join(<602204..602253,602299..602528,602564..602637,
                     602689..602768)
                     /locus_tag="CNI02170"
                     /product="60s ribosomal protein l31, mitochondrial
                     precursor (yml31), putative"
                     /transcript_id="XM_572851.1"
                     /db_xref="GI:58271389"
                     /db_xref="GeneID:3259416"
     CDS             join(602204..602253,602299..602528,602564..602637,
                     602689..602721)
                     /locus_tag="CNI02170"
                     /codon_start=1
                     /product="60s ribosomal protein l31, mitochondrial
                     precursor (yml31)"
                     /protein_id="XP_572851.1"
                     /db_xref="GI:58271390"
                     /db_xref="GeneID:3259416"
                     /translation="MFGAFRPTSFVSGGLLWKNPWRLSPTRKANQRKRLKRVDDVISM
                     VAESGVTTRSLVKALALPTEAEMSPRGKLKCLRLRLARCMQVVYGQRREYKYTTFSKR
                     DPGYRKSQHKVPKWTRLTLRENPKGF"
     gene            complement(602858..607174)
                     /locus_tag="CNI02180"
                     /db_xref="GeneID:3259755"
     mRNA            complement(join(602858..603352,603403..603510,
                     603572..603649,603699..603832,604516..605398,
                     606074..606247,606533..607174))
                     /locus_tag="CNI02180"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534204|gb|CF680045.1,gi|41534214|gb|CF680055.1,
                     gi|41535488|gb|CF681329.1,gi|41535501|gb|CF681342.1"
                     /transcript_id="XM_572995.1"
                     /db_xref="GI:58271677"
                     /db_xref="GeneID:3259755"
     CDS             complement(join(602909..603352,603403..603510,
                     603572..603649,603699..603832,604516..605239))
                     /locus_tag="CNI02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572995.1"
                     /db_xref="GI:58271678"
                     /db_xref="GeneID:3259755"
                     /translation="MIQKMSSDRSIRSRVSFDSTRSRGTRSNLEYESDDGYSTGIDDS
                     SLGIINGIGPTGEPVEVIGLGKKKPKHRVFQANMLKPALRSSTKLASRSTVNETNSGT
                     SWGERSDKPLPSRPVSYVGPVMGSLSSLRDDTRNNTGSRSRHPSHEANPINYHSERRS
                     DPPTKTHNPRALTHARSSSQPTGLGLRSLFSNISLTNQSPSTFTLLSSRHSFITPAEN
                     LLDYLRLAKIPSWDRWPGRGAKNVRPPSVLDLSAIKEFEKTRGGEGWCPYDKETWIGD
                     AGQANLLQAQVYDSCVQNQVYFFAVTNLRYWVFGQFNAGYTSCTVGPAIDRKSREPSL
                     MQCLTAWVIRSVDERPKAQHSERRPTTPTTSHPSRTPRFHQSLRPMDTHAPPYTEGSR
                     RRKKRLQSLPINNCYDDFSPGNPPNYFVGSMQQGMNMMPGYYDQPLGLGQVANVPYPQ
                     PSSAPSMTYSTGWGQRPFSPNVGVQMPYNSGLSWYGGGISWPGMG"
     gene            <608546..>608969
                     /locus_tag="CNI02190"
                     /db_xref="GeneID:3259575"
     mRNA            join(<608546..608896,608925..>608969)
                     /locus_tag="CNI02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_572714.1"
                     /db_xref="GI:58271115"
                     /db_xref="GeneID:3259575"
     CDS             join(608546..608896,608925..608969)
                     /locus_tag="CNI02190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572714.1"
                     /db_xref="GI:58271116"
                     /db_xref="GeneID:3259575"
                     /translation="MARLLSEILDAVVYNITLVTFKLDEIIACVKWQPSVVREMDYHA
                     GLEGLHIENNDDEKEKNSASKQGTLHAFNPDHGWSGCIRVPSSATQPIQLFRLKTASE
                     LAKGLKHGDSDALIERKLRNLSVLTDSGP"
     repeat_region   609344..609396
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(609900..611633)
                     /locus_tag="CNI02200"
                     /db_xref="GeneID:3259669"
     mRNA            complement(join(609900..610031,610094..610393,
                     610448..610479,610531..610940,610996..611257,
                     611303..611633))
                     /locus_tag="CNI02200"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553529|gb|CF699370.1,gi|41553536|gb|CF699377.1,
                     gi|41557454|gb|CF703295.1,gi|41557469|gb|CF703310.1,
                     gi|41565251|gb|CF711092.1,gi|41565258|gb|CF711099.1"
                     /transcript_id="XM_572994.1"
                     /db_xref="GI:58271675"
                     /db_xref="GeneID:3259669"
     CDS             complement(join(609969..610031,610094..610393,
                     610448..610479,610531..610940,610996..611257,
                     611303..611609))
                     /locus_tag="CNI02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572994.1"
                     /db_xref="GI:58271676"
                     /db_xref="GeneID:3259669"
                     /translation="MGVHALIPAAIQNSGHVEAFHDSVPASHHPHTDTASALYESYPS
                     YASTVQQGSNHDNSQSGPSRVTLDSMRTASSHSLHPKDAQDIEQGDYEAEEEYGPIIT
                     VTWKTMSRLYLLVPIITLAWLVLLVLLATYAWPPTKKEREAGQQYPHPLLPYPFIIGI
                     FASCTVQTMRVPIFVVVEWFRFSPTAIGFTSRILHSTLHEAFRLLTLPLIIPSPASGF
                     HSSYYLGLGWGVAEVTWGIVQGWEQLSLYQEIMPSSDKIYLPDEEDHIDGENEQERAK
                     REGMLSAVEERDEEESNGEIEEEEDEEEDELDESELEKKVEILERMRARRDLEQVIGV
                     PFPNIPFPFHLLWRLDTLLLNLGLTLILSAFYFNPTLIYRHSHPSPLSDGAAVEAEFV
                     LETKPDRDASKYLWLAWVIVVLVHVGVNLAWKVVGRLGVGAVTWGALIIALGSVFAGL
                     GCWGGLV"
     misc_feature    610592..610657
                     /note="CT-rich"
     gene            611860..612853
                     /locus_tag="CNI02210"
                     /db_xref="GeneID:3259756"
     mRNA            join(611860..611886,611925..611987,612107..612190,
                     612242..612290,612346..612369,612431..612620,
                     612688..612853)
                     /locus_tag="CNI02210"
                     /product="ubiquitin-conjugating enzyme e2-18 kda,
                     putative"
                     /transcript_id="XM_572712.1"
                     /db_xref="GI:58271111"
                     /db_xref="GeneID:3259756"
     CDS             join(611884..611886,611925..611987,612107..612190,
                     612242..612290,612346..612369,612431..612620,
                     612688..612751)
                     /locus_tag="CNI02210"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme e2-18 kda"
                     /protein_id="XP_572712.1"
                     /db_xref="GI:58271112"
                     /db_xref="GeneID:3259756"
                     /translation="MSNLAQARLHEERKQWRKDHPFGFYARPTKAADGTLNIMSWEVG
                     IPGKAGTDWEGGMYVVKMNFPDEFPTKPPKCKFDPPLFHPNVYPSGTICLSILDEEKS
                     WKPSITVKQICLGIQDLLEHANVNDPAQVEAYHMFKNDRTSYDKRIRQQAVERRPK"
     gene            613060..617556
                     /locus_tag="CNI02220"
                     /db_xref="GeneID:3259736"
     mRNA            join(613060..613197,613233..615413,615463..616029,
                     616081..616181,616230..616581,616637..617060,
                     617129..617183,617238..617323,617383..617556)
                     /locus_tag="CNI02220"
                     /product="SCP160 protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530308|gb|CF676149.1,gi|41530314|gb|CF676155.1,
                     gi|41531079|gb|CF676920.1,gi|41531088|gb|CF676929.1,
                     gi|41550522|gb|CF696363.1,gi|41554954|gb|CF700795.1,
                     gi|41555932|gb|CF701773.1,gi|41568419|gb|CF714260.1,
                     gi|41568423|gb|CF714264.1,gi|41569931|gb|CF715772.1,
                     gi|41569942|gb|CF715783.1"
                     /transcript_id="XM_572710.1"
                     /db_xref="GI:58271107"
                     /db_xref="GeneID:3259736"
     CDS             join(613168..613197,613233..615413,615463..616029,
                     616081..616181,616230..616581,616637..617060,
                     617129..617183,617238..617323,617383..617456)
                     /locus_tag="CNI02220"
                     /codon_start=1
                     /product="SCP160 protein"
                     /protein_id="XP_572710.1"
                     /db_xref="GI:58271108"
                     /db_xref="GeneID:3259736"
                     /translation="MAFSAADLQKQHQELEGAPDPFPALAHAPTPVAKKVQSAPAPLD
                     TSSEDAFPSLAAPSAPSSKGNAKPAISMWASKSSAVKTGATRPMAPGGLGRTGTPTAG
                     SHPFAETFSIPANELVQGKAASDVVKKVQDQTGAIVESSTQMRTGLKTFHVKAADQKK
                     LAQAKRMIEGGLRKPVTVQVEVPITTLGTIIGPKGATLKGITDATGAKVDVPRRETLP
                     SYIPKDNGSDAGSDDEDGEPQVSITISGPATGCADAKDRILSLISHKVSQTSASIKTI
                     PSAFYTIISTQVSELEQGPGEGKVTVKIPTPAVWKALERQAQADAEGEKVVVDGEAPI
                     KVKGDRENVKAVVDEITKSYDSLVQSFNLKKVSIPKRQHRFLIGSAAEDILAQTGCVV
                     ELPPVDDPSDRVVIRGPQAKLVAAQSLVFEKANAVSVEPLDLVSVFRRTTSDPVTHAT
                     NILRYLRASKLKGVSSAHPNVQIFPPFPSTVANTGAVIIEIVGEDGEEVSKVVDEITS
                     LAKGVLPSAVSIVQVDHLAHSLLVGKKGTRIAQFEKAHNLTVVFPPASEESSNVLLVY
                     TGPAGKDVKLEEVFEGASKDLTELAKEVADIKTEILEVEKKWHKYIIGQSGSVLNAII
                     GEDALVSVKVGASPTKFPSTGSEDSVTIRGPRNEVDRVTKQIKQVVEDAKNDDIVNGY
                     TVKFDVEKKYVPHLVGQAGAAINKLRETLGVKVNFEDAPEKETKKGPKKVLVNCSIVG
                     RKEPVEEAKKRLIAQIEKLEDETTEVLSIKRAIQPALIGAGGKYAIRLEEKYGVKLSF
                     PRDSKDKESGANPDQVTIRGGRKGVAAAKAELLEAAAFETESRQEATFKVPSKAVAQI
                     VGKGGATINAIKNDTGAQIDIEREGGEDKQTTITVRGDKQAIAAAKEAVLNVVKEIGD
                     EITVELTIEQKYHRNLIGQGGQNLRDLIASAGGPSEGYKQAGLVTFPKNGDETTDKVR
                     LRGDSKVVKKIQAELEKQVAVLKETIVIGVVVPAAQHATKIGRGGMALQDLQRKTGAV
                     IHFPGSRQYSSVGEIENLDELEGVSEGDIVKVIGTKEVTQKAAELLQITSERGQRNDS
                     RQGRATPDLVSCPVSIPNKYYHAIAETPNLIRQIRAIGGYLNIPQPAPAKPSPKRPEP
                     KSGDDLAAKTARIDLEGDEDVPDVQGEWSLVKNFEGADDEKSEWIVRAKEEDLERAVK
                     VLEQALEKAKKATHVGYLTGLPRSAFPRIIGSKGATISRMRLETGADIQVGKEDDLIT
                     IVGDEESVLQAKDAILSIVSRPGRERY"
     gene            617877..>620351
                     /locus_tag="CNI02230"
                     /db_xref="GeneID:3259588"
     mRNA            join(617877..618088,618144..618241,618289..618494,
                     618546..618655,618704..618779,618842..618951,
                     619005..619050,619161..619196,619254..619295,
                     619350..619670,619721..619797,619849..619966,
                     620016..>620351)
                     /locus_tag="CNI02230"
                     /product="nad-dependent malic enzyme, putative"
                     /transcript_id="XM_572853.1"
                     /db_xref="GI:58271393"
                     /db_xref="GeneID:3259588"
     CDS             join(617910..618088,618144..618241,618289..618494,
                     618546..618655,618704..618779,618842..618951,
                     619005..619050,619161..619196,619254..619295,
                     619350..619670,619721..619797,619849..619966,
                     620016..620351)
                     /locus_tag="CNI02230"
                     /codon_start=1
                     /product="nad-dependent malic enzyme"
                     /protein_id="XP_572853.1"
                     /db_xref="GI:58271394"
                     /db_xref="GeneID:3259588"
                     /translation="MPSATLIRLSKSLSMSSSNSTVRVALRGGAILNNPRFNKGSAFT
                     HQERSEFALRGRLPYAVDSLEIQVKRAYEQYKSRETNILKNSFLQSMKAQNWTLFYAL
                     LQAHLVEMFPIVYTPTEADAIADYSHLFRRSEGLYLTPPGEKNMEEDFLDACEGRELE
                     LIVVSDGEAILGIGDQGSGGIGISGAKAVIYSLIAGVDPAKCLAITLDVGTNNQDLLN
                     DPLYIGYREKRLRDDRYDQFVDKFVGLVKKHQPECLLHFEDLVSPMLNDSSEDIGARF
                     NDDIQGTGAVTLAAVQAAISVTKSSLKDQRIVIYGSGSAGLGIARQLRDAIALDSSGS
                     PSEAAKQFWLIDKHGLIKKSLGKDKIRSEIEDEFIRDEGDWGEGETGLKEVVKKIKPT
                     ILVGTSTQAGAFTEEVVKEMSKHVDRPIIFPLSNPTRLCEAQPKDVSEWSKGKALMST
                     GSPFDPVDISDSGEKYIVAECNNALIYPGLGLGSILAKSSKMTDKMIIAGAQRLGQLA
                     PALVKKNANKSLLPDFGDAQKVNFEVALAVLEQAMEDGVARAKDIPEDKDERRKWAEN
                     NRWSPGYPNFKYDPEGLK"
     gene            complement(620366..621664)
                     /locus_tag="CNI02240"
                     /db_xref="GeneID:3259560"
     mRNA            complement(join(620366..620721,620770..620946,
                     620999..621178,621233..621380,621437..621664))
                     /locus_tag="CNI02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572881.1"
                     /db_xref="GI:58271449"
                     /db_xref="GeneID:3259560"
     CDS             complement(join(620438..620721,620770..620946,
                     620999..621178,621233..621380,621437..621643))
                     /locus_tag="CNI02240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572881.1"
                     /db_xref="GI:58271450"
                     /db_xref="GeneID:3259560"
                     /translation="MSRWSLALWAITIFFAIIAIQTFQARIASYTLKGVQSAIKNNAF
                     REQSFSTMSEANTSKVGDVYFLSHGGPPTIEQYDSAPYEGWRKFGKILQANPPKGIVV
                     VSAHWENQEAFRSGVIVNNNSSNPLIYDFYGFPKHFYELTFRSRAEPELQNKVVEALK
                     ESGITVSRANRGLDHGVWVPFRAALGDETNFPLVQVSLPASSDPRESVKVGKALASLR
                     QEGYAIIGTGQVVHNLRDLFTGGDLSYTSPFLSAVSIAVSEPDLVASTLKLTTHPLYR
                     RAHPTDEHFFPLLVASGAVQPGEKVEEIYKGVVDMGGRNVKNDGLGWGMWRWTAA"
     gene            complement(622419..625515)
                     /locus_tag="CNI02250"
                     /db_xref="GeneID:3259750"
     mRNA            complement(join(622419..622986,623050..623088,
                     623140..623169,623220..623330,623384..623447,
                     623503..623538,623596..623650,623786..623857,
                     624155..624348,624411..624557,624633..624807,
                     624844..624978,625042..625078,625208..625515))
                     /locus_tag="CNI02250"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535173|gb|CF681014.1,gi|41535176|gb|CF681017.1,
                     gi|41564012|gb|CF709853.1,gi|41568970|gb|CF714811.1,
                     gi|41568978|gb|CF714819.1,gi|41574138|gb|CF719979.1,
                     gi|41574149|gb|CF719990.1"
                     /transcript_id="XM_572708.1"
                     /db_xref="GI:58271103"
                     /db_xref="GeneID:3259750"
     CDS             complement(join(622651..622986,623050..623088,
                     623140..623169,623220..623330,623384..623447,
                     623503..623538,623596..623650,623786..623857,
                     624155..624348,624411..624557,624633..624807,
                     624844..624978,625042..625078,625208..625372))
                     /locus_tag="CNI02250"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein"
                     /protein_id="XP_572708.1"
                     /db_xref="GI:58271104"
                     /db_xref="GeneID:3259750"
                     /translation="MDGSNASDRLTTQEMEEGHLQPVQDDSALTDEATLFASPLPIVG
                     ERKTTTRKEVWSWYIYYVGNSGLGPFNFAISAWQNLLYLAGWDPAYPTGTVPCGDGAC
                     NLIAFGSERSVNSIVLITNGLSFAFQAVLFLIMGSFADYGIIRPHITTAFTVLAWAVS
                     FAWLGVEDPSKWQAGTALYILGLIGYQGALTFWTAAFPGLARDLPEIKDSEEKLARGD
                     TDRKSHDRLDMLARNRLANVSFLVCSLGELVVLAILAGILEGVINDDADSNTKALSIV
                     CAYSAGVWTSLLLTVPSRRPIFSWAIASILSVLIATLQNEVVSYDTKMLNYLLIDGIA
                     AQALGIGLFWAVQKRYTIPTKTMLLFNAFWILLLAAWGCVGITQTRFGFHNAWEFWAY
                     QAFYGIAVCPWYAISQAMISEVIPRGKEFLFFALFSIIGKTSSFIGPFVSSAIIDDSG
                     NTNMPFTFLLGLGVVSVGILACVDVEKSRKECRKYLEDEAIRVYGMDLADVVVISGQS
                     IEMNKAGRTGASVEETEKGDLIA"
     gene            626649..>629467
                     /locus_tag="CNI02260"
                     /db_xref="GeneID:3259534"
     mRNA            join(626649..627625,627672..627704,627751..628021,
                     628076..628291,628435..628520,628571..628702,
                     628795..628951,629005..629054,629113..629318,
                     629349..>629467)
                     /locus_tag="CNI02260"
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536420|gb|CF682261.1"
                     /transcript_id="XM_573002.1"
                     /db_xref="GI:58271691"
                     /db_xref="GeneID:3259534"
     CDS             join(626700..627625,627672..627704,627751..628021,
                     628076..628291,628435..628520,628571..628702,
                     628795..628951,629005..629054,629113..629318,
                     629349..629467)
                     /locus_tag="CNI02260"
                     /codon_start=1
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /protein_id="XP_573002.1"
                     /db_xref="GI:58271692"
                     /db_xref="GeneID:3259534"
                     /translation="MKRRASSRRSSAGSWASSDNDSDYDAQVGTGGILSALLGLYGNE
                     ASYKKRKALRSLLRRSDKDNEDSHRGRARKRWSTESLFALPSRNSSRSASRSVSRGAT
                     SAPDGPEVARRMRDEREKVHRNRRHQRLPHRSQDLNQPYIPSARYSNPLQPAPNVTAA
                     QRFRTFMTGRSAPATLLGAPDAVDHSKSQEESRYRTMAALLITTNSLMSIGSPILAHV
                     APASGQEGESSGGHRKISWYESVAEKERAEQEREQKEEHDLGLIDGEEDNIRAMEEGM
                     CGGKRKRKRTRGKRIQREMAVTKHVSNLIQRKKFIEELAKAVVNYGAPAHSVEAWLAS
                     TADILSVEASFVYLPTVLLVAFRDTDVHSTDVLFIRPSGGLELYRLSLVHEVYRRVTH
                     DKISASQGRRALKRIGRETLPYSRLTLILTAAVASAISARVAFSGSFIDILMSGALGA
                     LFTLVQFTVSKENRVFSNIFEIGMAGILSFVAASIVLILPGWHICLGALELGSKNIIA
                     GGIRLVWAVVYTLFLSLGLGIGSEIWDSFGPPQPGNDSNSSDATEVHINTASDWWLFL
                     LVPVFAFSLAVWFRADWRSKDIVVMVLVACAGYVVNYFLSGQISQINVTSAVSAFAVG
                     VLGNLYSRLGRGSAFPSMVCGILLLVPNAIAAAGGLATNSIDQSDSTNSNNEQEINTA
                     VIVSIRMILVRFSMMADVLQVGVGLAVGLFASTVAIYPFGKTRRYIFSY"
     gene            complement(629688..630413)
                     /locus_tag="CNI02270"
                     /db_xref="GeneID:3259807"
     mRNA            complement(join(629688..630024,630081..630216,
                     630279..630413))
                     /locus_tag="CNI02270"
                     /product="expressed protein"
                     /transcript_id="XM_572879.1"
                     /db_xref="GI:58271445"
                     /db_xref="GeneID:3259807"
     CDS             complement(join(629907..630024,630081..630216,
                     630279..630366))
                     /locus_tag="CNI02270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572879.1"
                     /db_xref="GI:58271446"
                     /db_xref="GeneID:3259807"
                     /translation="MSANEQIRQNEQAINSYAAKAGAGRQSDSTVDSGVNEQVTAQFP
                     GSTVQVGGTKRGENPPIPDEEGGGINPGTGHQTKAQDFEGPGGPEEKQARTAYQRPGD
                     QNVPNFLEQGQ"
     STS             630308..630501
                     /standard_name="CT16"
                     /db_xref="UniSTS:470712"
     STS             630310..630505
                     /standard_name="AG2"
                     /db_xref="UniSTS:470716"
     gene            complement(631103..633686)
                     /locus_tag="CNI02280"
                     /db_xref="GeneID:3259598"
     mRNA            complement(join(631103..632128,632178..632549,
                     632599..632865,632913..632972,633023..633447,
                     633495..633529,633577..633686))
                     /locus_tag="CNI02280"
                     /product="cell wall chitin catabolism-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41549614|gb|CF695455.1,gi|41549625|gb|CF695466.1,
                     gi|41556888|gb|CF702729.1,gi|41556900|gb|CF702741.1,
                     gi|41558944|gb|CF704785.1,gi|41558952|gb|CF704793.1,
                     gi|41559366|gb|CF705207.1,gi|41573285|gb|CF719126.1"
                     /transcript_id="XM_572877.1"
                     /db_xref="GI:58271441"
                     /db_xref="GeneID:3259598"
     CDS             complement(join(631117..632128,632178..632549,
                     632599..632865,632913..632972,633023..633447,
                     633495..633529,633577..633655))
                     /locus_tag="CNI02280"
                     /codon_start=1
                     /product="cell wall chitin catabolism-related protein"
                     /protein_id="XP_572877.1"
                     /db_xref="GI:58271442"
                     /db_xref="GeneID:3259598"
                     /translation="MPSPTAVAHAKRLSIASNSPKGKMEQFTFTLGKLDAGMAILLGP
                     NAHLLEFPSLLLPTPSPDAPPLGPGSILTITVSRDLAAEYAAQKAFKELQDSILNAFS
                     IPPKVPVVRLRNVTQTNVTVEWDRIDVGSAEFRGLEMHRNGQRWGRVGGEYGGGIQEK
                     TEWKTGGLQSGEEYTFQLVLKTTAGTYPSNIIRVRTHTMDNLTGLLICFGPMHPPQLV
                     DQLRHCLRQIGARESPQVALDTTHFVCTTPMVGSDEHGRGGGVDPEYQEALRMNLPVV
                     GPGWLFAVADQRKLFPISNYILPSLPSNASLDTAPPPPFRRPSPLKRASLPIPSAPQS
                     PIRDDDDAPRSPSPETIARMSMVPASPTLPSHAPGDFSEQRRESLGAGEVPRVKSPRP
                     EAQDAPRSRSPKPEADGKLDRGFKFPLSSPASAASSSSQSSPLSGSQFTSPTAGEAQV
                     PATDPASTLVSTPGDAQATYDYADIPLQTVSPPAEIEEEVKGISTEPIVVEEPRGATE
                     QLPIKTELPVQINGQQEREGGKAQTIDEAVKEFENVVSGGASNLHAESIASPIPIENV
                     ETATHPDAEYHAADLPQTEPSKNPEPLEHRAAPSEEALSEESTAKKAEANVLPEVVES
                     VQLIPVEDGTAGKDMDLESRPAEDIVKANSSHSPAKKEEDTPSNIEQPKEAIIAESEP
                     QSDIIPENATPTASTPARSSQSTPVSKSQKKKNKKKKKAQASAAAAAPREESEANGNG
                     EGLEDVDLN"
     repeat_region   631207..631235
                     /rpt_type=tandem
                     /rpt_unit_seq="ttc"
                     /satellite="microsatellite"
     gene            634526..636783
                     /locus_tag="CNI02290"
                     /db_xref="GeneID:3259705"
     mRNA            join(634526..634827,634879..634900,634965..635110,
                     635160..636019,636078..636187,636236..636309,
                     636360..636783)
                     /locus_tag="CNI02290"
                     /product="polysaccharide synthase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533125|gb|CF678966.1,gi|41538544|gb|CF684385.1,
                     gi|41538555|gb|CF684396.1,gi|41539692|gb|CF685533.1,
                     gi|41539705|gb|CF685546.1,gi|41552105|gb|CF697946.1,
                     gi|41553222|gb|CF699063.1,gi|41559173|gb|CF705014.1,
                     gi|41559181|gb|CF705022.1,gi|41571220|gb|CF717061.1,
                     gi|41571669|gb|CF717510.1,gi|41571678|gb|CF717519.1,
                     gi|41572783|gb|CF718624.1,gi|41572795|gb|CF718636.1"
                     /transcript_id="XM_572855.1"
                     /db_xref="GI:58271397"
                     /db_xref="GeneID:3259705"
     CDS             join(634794..634827,634879..634900,634965..635110,
                     635160..636019,636078..636187,636236..636309,
                     636360..636463)
                     /locus_tag="CNI02290"
                     /codon_start=1
                     /product="polysaccharide synthase"
                     /protein_id="XP_572855.1"
                     /db_xref="GI:58271398"
                     /db_xref="GeneID:3259705"
                     /translation="MLYLTADKFPVFVPFGVIGFYRYLWYIIRLLARATYRPIPLPEN
                     PTYVAHEDVTIIVPTIDAGEEFKDAAKSWLAGNPKEIIIVTEAKMEGPLQDLANQVDP
                     ERIRVLTVPAANKRLQMSHGIRNTTTDIIVFADDDAIWPETLLPYVLACFEDQQIGGV
                     GTSQRVKAVNSRMTVWEVLAAFRLTIRNIEIASSTHIDGGIPCLSGRTAAYRTIILKD
                     PDFLHGFTNDFWLGKYHLNSGDDKFLTRWMVSHGWNTYVQVCKEAELLSTMKPNWRFL
                     LQVLRWTRNTWRSDFRSIFTERYVWTKHPYVAYTMIDKFINPLTLLVGPCLVIYLIVK
                     STKDVLDGGYHLAAWDIVVSYLVWLMCTRTLKLLPHLWNNPKHIIYVPAFIAFGYYFA
                     IMKLYALFTLHETGWGTRAGIGNITEATMAAEKENEASNFARQQQPDFQYPAARRKA"
     gene            complement(636723..>637594)
                     /locus_tag="CNI02300"
                     /db_xref="GeneID:3259767"
     mRNA            complement(join(636723..637122,637232..>637594))
                     /locus_tag="CNI02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_573008.1"
                     /db_xref="GI:58271703"
                     /db_xref="GeneID:3259767"
     CDS             complement(join(636799..637122,637232..637594))
                     /locus_tag="CNI02300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573008.1"
                     /db_xref="GI:58271704"
                     /db_xref="GeneID:3259767"
                     /translation="MMWKETTSQHRELLFITVWKNAKSSINDNLIQLCQQYSSSKAIL
                     YLHHQIISNLDSPEMSSLLEDSYTALPLSTTKSQPSPPIQSYQLRQSICEVETELLIQ
                     TFDDRILAIVTQNGKVGCLSNGHPSNLHILSILPPPPHSACLTPLLGSPPQQTLHELY
                     VSQIATLVWWALQTSGQMRRHVVVGLSLKQNGRRARDEDDAKEEALVESERERYAGIM
                     DMVSRWPGPE"
     gene            <637718..641383
                     /locus_tag="CNI02310"
                     /db_xref="GeneID:3259597"
     mRNA            join(<637718..638355,638409..638479,638531..639106,
                     639158..640021,640074..640203,640261..641383)
                     /locus_tag="CNI02310"
                     /product="telomeric DNA binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544584|gb|CF690425.1,gi|41544589|gb|CF690430.1,
                     gi|41548792|gb|CF694633.1,gi|41548800|gb|CF694641.1"
                     /transcript_id="XM_573004.1"
                     /db_xref="GI:58271695"
                     /db_xref="GeneID:3259597"
     CDS             join(637718..638355,638409..638479,638531..639106,
                     639158..640021,640074..640203,640261..641305)
                     /locus_tag="CNI02310"
                     /codon_start=1
                     /product="telomeric DNA binding protein"
                     /protein_id="XP_573004.1"
                     /db_xref="GI:58271696"
                     /db_xref="GeneID:3259597"
                     /translation="MAFEDTLKQLRDFLRLPTPSLEDLTFRISSTLSTLHIHPTSLPP
                     SSIPLTDLKALARYLPAVQNLLLQDVLPHFVSILDDRNQELVRELFVPQKKVEGLEIR
                     RNIALVSYFTLPSYLNAPKQNYPTLPKPMRSFFISLLDTLSTEFGLDDLYCTVFPNKE
                     GITKEGKDGVKILQWEDALRSIIGIPAKTGNAIGRWELEEAVKIDVPVTLLSRPYFDR
                     LVRHLENLLYEMSQRPSPDVTPLRLVIEKLSNIGLLTSQSPNTSSRSPSLLFPLLPPL
                     LSHLHPPSSSPSLPYPPTFLPSVFLPLPSSILSAFINALTTHLSFYLIDPANPLQPHK
                     PDERVKRAVQVFQSIIGNAEVGNEAWQAVVQSVVAKKGKSRMRLGEWREQARNRLIVG
                     WIAQGGDVAVKAFIEIVVDTWTDPKYVKFSMFSEQFSLTHVLLLSLSLLPTYSPWLIQ
                     LSHRSRFILAFQSYLSHPDPSIRRLGMVVGEIMSELTIPDTEVDQSEKKKQEDEIEEL
                     RKGLEVDEDNEDTKPKTTATRSGSVRLKFKGMWDGNGDGREESRWLRGNVGIKDANAL
                     TGDDDEQWLLGWKDIPSSPTVEPQPVPESSLGRRATRPANTKPASPKPREKKPKVVML
                     DPDQQDDPLSGYASSSPSSSRAPSPTPEYLDEIAADPSLGLDEANKKKVTRPVYIPQL
                     VALLKERDKPENVEMGLSWGEGLVRAKREFGTELAENAVGVTLMVLGLNDSFDIENFE
                     EKKQGLLNALVACAPKQVAPFLCEQYFNSQFSLQHKASILTALAMGARELAGLSVPQT
                     PRTTRSIDFPSKTLPPTLHSKYISSADVPSNPLLGYGPDDQLDQAIDGVRNLILSKGA
                     SKGEETVPELAREKRLRVGEIRRPKVAPVNSLASSQMGQLARPPPVVAFKDIAAEIFI
                     LPLINRFWQHFQDSSIREERAVMLGARYRAAGAGLVLFPMAMEKFMMALALMLDAARY
                     SPLWLSVICPEALELAMTIGIRHPPRPLLSGEEGIDPSRAEAQVLSAALELTLVCLDV
                     SVDLDGGRTLAMDKSALVMAVGEWASGVFKVESEGGEVSVGQGGRIEGKIKAEAAGVV
                     VKVGEIGEKWGRMGMDMGF"
     gene            complement(641361..642998)
                     /locus_tag="CNI02320"
                     /db_xref="GeneID:3259711"
     mRNA            complement(join(641361..641650,641714..641966,
                     642047..642138,642194..642998))
                     /locus_tag="CNI02320"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546790|gb|CF692631.1"
                     /transcript_id="XM_572992.1"
                     /db_xref="GI:58271671"
                     /db_xref="GeneID:3259711"
     CDS             complement(join(641419..641650,641714..641966,
                     642047..642138,642194..642945))
                     /locus_tag="CNI02320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572992.1"
                     /db_xref="GI:58271672"
                     /db_xref="GeneID:3259711"
                     /translation="MTASKNPSAGSSRPSSDKERPQRPKSDYSDISTEIDSDKEIAVC
                     NFGNVEKEKPAPNPLQYPLRTTGAKKTVNLEEHDKRTSERREIKPSSGINANRMEDDT
                     DSDVSDDDYSTDITAVESDTKVESWENRSKSSSSRKPNYSPSSKSNTKKRSRLTQEDY
                     LSRSQKLHNSYIQRPPAWASCCGDCSRCWKGTWSWWGWKWLVRKLPFLLALAMLLCGA
                     VCAVTGPQTGIWALEAGGYKFGGLGWCDSQESNCQEGILYTDVTASSQWPAMTVPILL
                     LCFGFLAIIQLTFLLFTFLFVRHIFLSCCSDPESQSQNVRSQKQNPRRVKSLIWFERI
                     MTFCGIAYSVVAVILAIWVSQTNAEGDVGYKLSTFLLVSPLVWFFLSISYRSRWAYNS
                     DAFLSSASLRQKRGGKYEETSYEDPDEDEVIVSRDGIDPVGRPKRKLRKY"
     gene            complement(643250..>645945)
                     /locus_tag="CNI02330"
                     /db_xref="GeneID:3259374"
     mRNA            complement(join(643250..643332,643392..643911,
                     643968..644283,644337..644603,644650..645077,
                     645131..645171,645226..645671,645724..645916,
                     645922..>645945))
                     /locus_tag="CNI02330"
                     /product="NAD+ kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532414|gb|CF678255.1"
                     /transcript_id="XM_573007.1"
                     /db_xref="GI:58271701"
                     /db_xref="GeneID:3259374"
     mRNA            complement(join(643250..643332,643392..643911,
                     643968..644603,644650..645077,645131..645171,
                     645226..645671,645724..645916,645922..>645945))
                     /locus_tag="CNI02330"
                     /product="NAD+ kinase, putative"
                     /transcript_id="XM_573006.1"
                     /db_xref="GI:58271699"
                     /db_xref="GeneID:3259374"
     CDS             complement(join(643294..643332,643392..643911,
                     643968..644283,644337..644603,644650..645077,
                     645131..645171,645226..645671,645724..645916,
                     645922..645945))
                     /locus_tag="CNI02330"
                     /codon_start=1
                     /product="NAD+ kinase"
                     /protein_id="XP_573007.1"
                     /db_xref="GI:58271702"
                     /db_xref="GeneID:3259374"
                     /translation="MRLMLLFPGPLFNGYESDQSSVNEYGTRTPNLLAASGLLGDGLL
                     EGDEEGNGSLTKQLAETAQGVREMSKELGRTKVRSRIQNVLIVTKARDNRLIKLTREL
                     ALYLMQKRPTASPDGSSSRHGNGTRGRGLVVYVDAQLQTSKRFDAAGLQREYPHLFVP
                     MARQRSSSSASVNTLSHISAFSSTTSMGEAAKQATNGEGQLRYWTSELCSATPHLFDF
                     VITLGGDGTVLFTSWLFQRIVPPVLPFALGSLGFLTNFDFYGYKETIDKVVDEGIRVN
                     LRMRFTCTVYRAVASGDITVSKGKKRKAIKKRGGEILMSRVDKGGWESLEGPTPAASP
                     SDFEGEDKEIMCYSTRPVEQFEVLNDLVVDRGPSPYVSLLELFGDEHHLTTVQADGLT
                     VSTPTGSTAYSLSAGGSLAHPQIPAILITPICPHTLSFRPMLLPDSMELRVCVPYNSR
                     STAWASFDGRGRVELKQGDHIKVTASKYPFPTVCADKASTDWFSSISRTLRWNEREKQ
                     KSFVVVEEASDPPERSRDRKEDAKAGLFEEGRAKQKFEKDANARGDLVESEDEEDDEE
                     IFDIDDKSGPSSPPVQQQQQPTKNEMFPHQLHYLLSSHQNGLETPNRFVTPYSAPPAL
                     SQRHLVEAIHKAKIDEKENEKGQRDSTRESPSALRVDRSRHLSQLGRTVSQSTEETEA
                     EGVEREEEKSRKEEETPKHGQQQRHHHHHHHHHHHGHKPKRTPSNLAEKVADCKAKAF
                     AFFGQDDSASDCSGSEE"
     repeat_region   643476..643508
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     CDS             complement(join(644299..644603,644650..645077,
                     645131..645171,645226..645671,645724..645916,
                     645922..645945))
                     /locus_tag="CNI02330"
                     /codon_start=1
                     /product="NAD+ kinase"
                     /protein_id="XP_573006.1"
                     /db_xref="GI:58271700"
                     /db_xref="GeneID:3259374"
                     /translation="MRLMLLFPGPLFNGYESDQSSVNEYGTRTPNLLAASGLLGDGLL
                     EGDEEGNGSLTKQLAETAQGVREMSKELGRTKVRSRIQNVLIVTKARDNRLIKLTREL
                     ALYLMQKRPTASPDGSSSRHGNGTRGRGLVVYVDAQLQTSKRFDAAGLQREYPHLFVP
                     MARQRSSSSASVNTLSHISAFSSTTSMGEAAKQATNGEGQLRYWTSELCSATPHLFDF
                     VITLGGDGTVLFTSWLFQRIVPPVLPFALGSLGFLTNFDFYGYKETIDKVVDEGIRVN
                     LRMRFTCTVYRAVASGDITVSKGKKRKAIKKRGGEILMSRVDKGGWESLEGPTPAASP
                     SDFEGEDKEIMCYSTRPVEQFEVLNDLVVDRGPSPYVSLLELFGDEHHLTTVQADGLT
                     VSTPTGSTAYSLSAGGSLAHPQIPAILITPICPHTLSFRPMLLPDSMELRVCVPYNSR
                     STAWASFDGRGRVELKRKWLDPTRYLHR"
     gene            complement(647248..650103)
                     /locus_tag="CNI02340"
                     /db_xref="GeneID:3259398"
     mRNA            complement(join(647248..647379,647433..647730,
                     647784..647937,647997..648078,648131..648140,
                     648194..648300,648351..648364,648433..648483,
                     648812..648966,649021..649242,649296..649516,
                     649574..649677,649727..649765,649816..649840,
                     649981..650103))
                     /locus_tag="CNI02340"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530643|gb|CF676484.1,gi|41557635|gb|CF703476.1,
                     gi|41564100|gb|CF709941.1,gi|41564106|gb|CF709947.1,
                     gi|41573143|gb|CF718984.1"
                     /transcript_id="XM_572990.1"
                     /db_xref="GI:58271667"
                     /db_xref="GeneID:3259398"
     CDS             complement(join(647345..647379,647433..647730,
                     647784..647937,647997..648078,648131..648140,
                     648194..648300,648351..648364,648433..648483,
                     648812..648966,649021..649242,649296..649516,
                     649574..649677,649727..649765,649816..649840,
                     649981..650020))
                     /locus_tag="CNI02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572990.1"
                     /db_xref="GI:58271668"
                     /db_xref="GeneID:3259398"
                     /translation="MANESVEGSNWGRVLICGGTDWATNGRKERSSGKVPTDLMEPHI
                     LRSLCNVKASKIITGPSANYAIILDIHGAAYLFGRPPAMVQSNGVISENTPLKISPSS
                     VGSPKGTKWVNGAAGRSHFLLVDSNGDVWGCGNNVVGQIGVPVAMVVEKLTKVAGPWV
                     RDPEAKVVQVTAGHTFSLFLTFTGQVYASGSSEFGQLGNGKTGERLVKAGKIAYDIEL
                     SQGLVQGLENVKITEIASGNQHSLALDDNGYVYSWGFAGYSRLGLQDQKDRLIFALTG
                     STGQPYTRFKHIQDVMACKVIKTSSGGCTHFITTPDPEGGVMTVGFGQGVLYGELGLG
                     SDSAKSATKPQKIIPLSGVDMIDVVGGAFFTLFLARPNSALSDLDRYPLHINSASLCL
                     VCNTDHEQDAPLECERCDQPYHIGCLSPPLSAVPEGEWFCPECALEADAGPDEPFKPA
                     LGITIPKLANGKKGAKQDVVESRGNPEAAVSATNGALTPSKSVKGGKRSWDEERSAQG
                     SGKKARNSKN"
     gene            650363..652357
                     /locus_tag="CNI02350"
                     /db_xref="GeneID:3259760"
     mRNA            join(650363..650670,650729..651165,651218..651258,
                     651304..651731,651790..652056,652118..652357)
                     /locus_tag="CNI02350"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530182|gb|CF676023.1,gi|41530195|gb|CF676036.1"
                     /transcript_id="XM_572857.1"
                     /db_xref="GI:58271401"
                     /db_xref="GeneID:3259760"
     CDS             join(650376..650670,650729..651165,651218..651258,
                     651304..651731,651790..652056,652118..652287)
                     /locus_tag="CNI02350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572857.1"
                     /db_xref="GI:58271402"
                     /db_xref="GeneID:3259760"
                     /translation="MSPISSDKASESFRPMREQASSVAPTTSSPHPDKISQCFVHSLF
                     KKRCLAALLSNESQSEKTPENQTPYYEDEDEEDESLTKQLAETAQSVREMNKELGRRI
                     VRSRIQHVLIVTKVNDNQLVSLTRELTLHLMQKSPSIPRGTNNRYGTASLGRGMVVYV
                     DSEFEASKAFDVPGLQRDHPELFEPMISNRSSSSLSSMNTPNESSTDEGPVTSGSSTP
                     VGEGQLRYWTYKLCSNSPHLFDLVITLGGDGTVLYTSWLFQRIVPPVLPFALGSLGFL
                     TKFDFKDYKEIIDKVIRDGIRVSLRMRFCCTVYRTSTPGDIDGPKAKKRRIIKDGSAT
                     ALKKRVHKSGWESLEDEEMDSHLSDAGSEEDVIMRHSTKPEEQFEVLNELVVDRGPNS
                     SMSSLELFGDDYHLTTVQADGLTVSTPTGSTAYSLSAGGSLTSPQTSNILITPICPHT
                     LSFRPVVLEDSIDIRVCVPFDSRTTAWTSFDGRSRLELKQGDHIKVTASKYPFPIILY
                     ADKSFPDWASSLSRKLRWNERERQKPYVLVEEARQQK"
     gene            complement(652874..>654469)
                     /locus_tag="CNI02360"
                     /db_xref="GeneID:3259776"
     mRNA            complement(join(652874..653016,653075..653171,
                     653230..653665,653727..653967,654024..654120,
                     654178..654246,654307..>654469))
                     /locus_tag="CNI02360"
                     /product="NADPH dehydrogenase 2, putative"
                     /transcript_id="XM_572706.1"
                     /db_xref="GI:58271099"
                     /db_xref="GeneID:3259776"
     CDS             complement(join(652938..653016,653075..653171,
                     653230..653665,653727..653967,654024..654120,
                     654178..654246,654307..654469))
                     /locus_tag="CNI02360"
                     /EC_number="1.6.99.1"
                     /codon_start=1
                     /product="NADPH dehydrogenase 2"
                     /protein_id="XP_572706.1"
                     /db_xref="GI:58271100"
                     /db_xref="GeneID:3259776"
                     /translation="MTVIQSPKLFTPIQVGEYELKHRIVMAPLTRLRAETKTAIPSEW
                     AETYYSQRASDGGLIVSEGTFIAEELRGYENVPGIYTPEQIAVWKKITSGVHSKGGRI
                     FCQLWVLGRVADPNVIPVIYSVGTIRDDSPSYIAAPEPEGQRKPLTPVTEADMDRFIG
                     HYIQASKNAIEAGFDGVEIHGANGYFIDQFLQTNSNDRTDQYGGSLENRMRFPLRVLN
                     AVCDAIGPKRVGIRMSPFSEFQSMRMEDPLATFVPWAQAIVEAQPELAFIHAVEGRGI
                     LTPENEWYIQDNLNPIREVILNKGKSVRFIPAGGYMPDTAFEHAEKYPEDLIAFGRYF
                     ISNPDLPNRVRNGWPLHKYDRTTFYSQSSVGYNDYKDYKPETEALAQDEAAPKEGTTK
                     A"
     gene            complement(654945..656668)
                     /locus_tag="CNI02370"
                     /db_xref="GeneID:3259465"
     mRNA            complement(join(654945..655484,655539..656039,
                     656096..656342,656392..656668))
                     /locus_tag="CNI02370"
                     /product="mannose-6-phosphate isomerase"
                     /note="supported by cDNAs and ESTs:
                     gi|41534860|gb|CF680701.1,gi|41534865|gb|CF680706.1,
                     gi|41540728|gb|CF686569.1,gi|41542211|gb|CF688052.1,
                     gi|41542218|gb|CF688059.1,gi|41544253|gb|CF690094.1,
                     gi|41545452|gb|CF691293.1,gi|41545459|gb|CF691300.1,
                     gi|41547196|gb|CF693037.1,gi|41547206|gb|CF693047.1,
                     gi|41557288|gb|CF703129.1,gi|41557296|gb|CF703137.1,
                     gi|41559658|gb|CF705499.1,gi|41559673|gb|CF705514.1,
                     gi|41560005|gb|CF705846.1,gi|41565632|gb|CF711473.1,
                     gi|41565639|gb|CF711480.1,gi|41566763|gb|CF712604.1,
                     gi|41567545|gb|CF713386.1,gi|41571092|gb|CF716933.1,
                     gi|41571100|gb|CF716941.1,gi|41572104|gb|CF717945.1,
                     gi|41572110|gb|CF717951.1"
                     /transcript_id="XM_572705.1"
                     /db_xref="GI:58271097"
                     /db_xref="GeneID:3259465"
     CDS             complement(join(655069..655484,655539..656039,
                     656096..656342,656392..656532))
                     /locus_tag="CNI02370"
                     /codon_start=1
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="XP_572705.1"
                     /db_xref="GI:58271098"
                     /db_xref="GeneID:3259465"
                     /translation="MSPSVFKISPGINSYDWGKKGSASLAAQLATTSIPDFSIDEDKA
                     YAELWMGTHPNNPSRLSDNTLLSEHLKSHPELIGSSVSSKFEDCKDGSLPFLFKVLSI
                     GTALSIQAHPDKPLAKKLFDEKPDVYKDPNHKPEMAIALTPFLAFLNFLPLSVLLLHL
                     LTVPELQEFVDSSLTESLASSLGLPTSQPPDTSLFKPTESPATAEQKDILKQIFAALM
                     SADKKLVEEAISKLIKRYQAKRDIKENEKSLVDLALRLNDQYPGDVGVLCVFLLNVVE
                     LKRGEAAFLGANEPHAYIEGDIIECMATSDNVVRAGLTPKLRDVDTLVSMLTYEAAPG
                     NKQLLQPTPFQKGDDTTKLYDPPIAEFSVLRTELSKGMKTSHRPVEGPSLCVITEGEG
                     VVRNGNDRSEFVRGDVIFVGAGKEVEWEAIKGLEMFRAYVEA"
     gene            complement(657109..659024)
                     /locus_tag="CNI02380"
                     /db_xref="GeneID:3259610"
     mRNA            complement(join(657109..657665,657722..657890,
                     657950..658086,658133..658363,658415..658648,
                     658700..659024))
                     /locus_tag="CNI02380"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533116|gb|CF678957.1,gi|41533123|gb|CF678964.1,
                     gi|41537868|gb|CF683709.1,gi|41537880|gb|CF683721.1,
                     gi|41563172|gb|CF709013.1,gi|41563180|gb|CF709021.1,
                     gi|41566752|gb|CF712593.1,gi|41566756|gb|CF712597.1,
                     gi|41570809|gb|CF716650.1,gi|41570822|gb|CF716663.1"
                     /transcript_id="XM_572704.1"
                     /db_xref="GI:58271095"
                     /db_xref="GeneID:3259610"
     CDS             complement(join(657174..657665,657722..657890,
                     657950..658086,658133..658363,658415..658648,
                     658700..658993))
                     /locus_tag="CNI02380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572704.1"
                     /db_xref="GI:58271096"
                     /db_xref="GeneID:3259610"
                     /translation="MNDQTLPPFLRVNPSPVPPPSHARLQALYASTSAQRTANPTGYA
                     ANAQWWAGVLEETLRTGWLNGEGGDRLVLKVDNGVLGRLEDEKGSRPRGLGGVVETLA
                     TTTPPTLHALTHFMTSATPLHVPASLTSRFVGRPLWWAFSQLNPFGGSEKVVKEEALW
                     AKYGQGKEYVHMPLLEQSAAAFTAHMLKSPILSYTSSLYDLDTFLAEYGEACFPTGPT
                     AKELPKGKHGLSKRDAEVLVKWLSRDCQLVVTDGSVIKVLDADQIAENHPISEADRGA
                     VSVLNALRRVEKQIVGIEEQISQSHEKAKKYLASKQKNIALSYLRSKKHLEDLLAKRV
                     ASSEQLRAVIRSIDQAKGDVEIMAAYETSTSTLTQVLAHPLLSPERIAATTDALAEAM
                     ADQEEIDQAVRIGGEVAMGGKRVEIDEDELAKELEALVEEEKEAEQEKTEKKTPVEAE
                     KKPDMTTELPRTPLSAPASGKEEKEEGPVADEERLWQQRYEEAQARKQAEKERFETER
                     LRKEEKIVAE"
     gene            659264..>661097
                     /locus_tag="CNI02390"
                     /db_xref="GeneID:3259513"
     mRNA            join(659264..659470,659517..660251,660306..660369,
                     660414..660982,661032..>661097)
                     /locus_tag="CNI02390"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41557774|gb|CF703615.1"
                     /transcript_id="XM_572703.1"
                     /db_xref="GI:58271093"
                     /db_xref="GeneID:3259513"
     CDS             join(659273..659470,659517..660251,660306..660369,
                     660414..660982,661032..661097)
                     /locus_tag="CNI02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572703.1"
                     /db_xref="GI:58271094"
                     /db_xref="GeneID:3259513"
                     /translation="MPPSSLPLVRLPPKAVVHRFGAPTSAPPSSALLRFPVQGWTINR
                     ESAKPEGWAIVGDADGRKVAVETLLSRHRIQPFSPPPGPFPYITSLISSSTDSWSSTT
                     EAPSKPIRHLAFARPPTTGEFTDFTARYGALLEEDRLSYRENLQNLHPRPSDEDIERV
                     AKLMRIGHLLDLPTVSFSSGQTRRGRIASALLTRPVLLLLEDPMAGLDVPSRKEVSNL
                     LGELNASETIKIVLILRGKGGEEMPTWITDVAEVRNGEVWIGKRDEYEQKHAEEQVRN
                     QAKVEQVAEKSDEVPGEPVIKLDGVSVSYGEGTRQVLKDIKWTVKPGEKWHLIGANGS
                     GKTTLLSLILGHHPRSYSLPASSLLLFSKPRRSIPSPTLRTLIGHTSPEIFASFPRGM
                     GLSALEAVGSGFEGIFSRRNLTSEQKERVKYLLGQFKDLLKPSSLSGKPAPDVTVQEI
                     ANRNFAHFTPPQQGLLLFLRAIVRKPKLLILDEPSQGMDEVIWERCKGLLEKEWEDEG
                     KGMAVIVVSHYEDEVPWKKGRGKVLKLDQGVATVQ"
     gene            <661977..>662822
                     /locus_tag="CNI02400"
                     /db_xref="GeneID:3259783"
     mRNA            <661977..>662822
                     /locus_tag="CNI02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_572702.1"
                     /db_xref="GI:58271091"
                     /db_xref="GeneID:3259783"
     CDS             661977..662822
                     /locus_tag="CNI02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572702.1"
                     /db_xref="GI:58271092"
                     /db_xref="GeneID:3259783"
                     /translation="MTFEPTINHILSLPNLLQPISPPHAALHLARLRLLYSIPADGQS
                     VSETSSSSSSSSGTRSKLTLGGWCNHCGGLRKGMGGAQRGGRGQNKDKEKEEKTKAIR
                     ERARKRVRELSNLTENEKEEKKMARKLEIAGAVQKRRQPAECTTCGAVYTRPKPDKKT
                     LAAFPSSRKTRKQVAEAKAEEEAKSLALKAEVEAAGKIEREAQPPQTLLSHPAFSHIP
                     SSPPNLPTHPPPLPMKNYAGSTSATTDVAKKKTKTKKSGLSKLLAENKERNESAKGAG
                     MWGLG"
     repeat_region   662119..662141
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            complement(662891..>664534)
                     /locus_tag="CNI02410"
                     /db_xref="GeneID:3259805"
     mRNA            complement(join(662891..663164,663221..663315,
                     663386..663466,663522..663674,663724..663758,
                     663811..663894,663945..664043,664092..664236,
                     664348..>664534))
                     /locus_tag="CNI02410"
                     /product="Short chain 3-hydroxyacyl-CoA dehydrogenase,
                     putative"
                     /transcript_id="XM_572874.1"
                     /db_xref="GI:58271435"
                     /db_xref="GeneID:3259805"
     mRNA            complement(join(662897..662969,663019..663164,
                     663221..663251,663308..663315,663386..663466,
                     663522..663674,663724..663758,663811..663894,
                     663945..664043,664092..664236,664348..>664534))
                     /locus_tag="CNI02410"
                     /product="Short chain 3-hydroxyacyl-CoA dehydrogenase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556597|gb|CF702438.1,gi|41575838|gb|CF721679.1"
                     /transcript_id="XM_572875.1"
                     /db_xref="GI:58271437"
                     /db_xref="GeneID:3259805"
     CDS             complement(join(662952..662969,663019..663164,
                     663221..663251,663308..663315,663386..663466,
                     663522..663674,663724..663758,663811..663894,
                     663945..664043,664092..664236,664348..664534))
                     /locus_tag="CNI02410"
                     /codon_start=1
                     /product="Short chain 3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="XP_572875.1"
                     /db_xref="GI:58271438"
                     /db_xref="GeneID:3259805"
                     /translation="MITPVLRSAMSSQRAATYRLSTVQRHLSTTSATRKVEELTVFGA
                     GLMGAGIAQVGAQNGLKVELTDDPAILRNGINIISKSLARVAKKKSPDDIEGFTNNVL
                     KNISTTTDSSQAVENADLVVEAIIESIKVKRDLFGFLDGKAKSDCIFATNTSSLSVTE
                     IAEACSPERQAKFAGLHFFNPVPAMKLVEIIRTPQTSQETYETLREVTLQMGKSPVTC
                     NDTPGFIVNRLLVPYLLEAIRMIERGDATAEDIDTAMELGAGYPMGPFKLLDFVGLDT
                     TSYIAEGWREKAASGAISKELVSPIPLLDKLVKEGKLGRKSGHGFYKYEGKK"
     CDS             complement(join(663015..663164,663221..663315,
                     663386..663466,663522..663674,663724..663758,
                     663811..663894,663945..664043,664092..664236,
                     664348..664534))
                     /locus_tag="CNI02410"
                     /codon_start=1
                     /product="Short chain 3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="XP_572874.1"
                     /db_xref="GI:58271436"
                     /db_xref="GeneID:3259805"
                     /translation="MITPVLRSAMSSQRAATYRLSTVQRHLSTTSATRKVEELTVFGA
                     GLMGAGIAQVGAQNGLKVELTDDPAILRNGINIISKSLARVAKKKSPDDIEGFTNNVL
                     KNISTTTDSSQAVENADLVVEAIIESIKVKRDLFGFLDGKAKSDCIFATNTSSLSVTE
                     IAEACSPERQAKFAGLHFFNPVPAMKLVEIIRTPQTSQETYETLREVTLQMGKSPVTC
                     NDTPGFIVNRLLVPYLLEAIRMIERGDATAEDIDTAMELGAGYPMGVSVSSYIVPYLD
                     TNWFLSSHSSCSTLSDSIPPRILPKDGERRRRLVRSPRSWFRPFLFWTSLSRRASWAG
                     RVVMDFTK"
     gene            664938..666615
                     /locus_tag="CNI02420"
                     /db_xref="GeneID:3259765"
     mRNA            join(664938..665111,665164..665238,665295..665366,
                     665434..665451,665516..665652,665705..665840,
                     665895..665957,666010..666286,666342..666615)
                     /locus_tag="CNI02420"
                     /product="uricase (Urate oxidase), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540911|gb|CF686752.1,gi|41540919|gb|CF686760.1,
                     gi|41548069|gb|CF693910.1,gi|41548073|gb|CF693914.1,
                     gi|41549086|gb|CF694927.1,gi|41549094|gb|CF694935.1,
                     gi|41573585|gb|CF719426.1,gi|41573591|gb|CF719432.1"
                     /transcript_id="XM_572701.1"
                     /db_xref="GI:58271089"
                     /db_xref="GeneID:3259765"
     CDS             join(665075..665111,665164..665238,665295..665366,
                     665434..665451,665516..665652,665705..665840,
                     665895..665957,666010..666286,666342..666462)
                     /locus_tag="CNI02420"
                     /EC_number="1.7.3.3"
                     /codon_start=1
                     /product="uricase (Urate oxidase)"
                     /protein_id="XP_572701.1"
                     /db_xref="GI:58271090"
                     /db_xref="GeneID:3259765"
                     /translation="MSHPGYLSAARYGKDLVKVARVVRDGEQHHIVEYTLRVLLEGEI
                     ETSYTEADNSCVVATDTVKNTCNIFAKTSPYVLDAPVFALHLGLHFVTKYKHIHKCFV
                     DIIGLKWSRISVDGKPHKWSFIRDGDEKAIVECVVDGTAGPDAATANVKIGIKDLLVL
                     KTSGSAFENFHRDENTTLADVADRIFSTSVSLQCSISLPPNTPLTIDNLGSIAKELDF
                     PKMKELILKDVLDTFATDESASVQATLYLTLQKILASCPAVKDASMQLPNKHYIPVNL
                     SAFGLDNKLGYEGGAEVFYPAADPSGYITATVTRK"
     gene            666869..666977
                     /locus_tag="CNI02430"
                     /db_xref="GeneID:3259585"
     tRNA            666869..666977
                     /locus_tag="CNI02430"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:3259585"
     gene            <667597..668198
                     /locus_tag="CNI02440"
                     /db_xref="GeneID:3259623"
     mRNA            join(<667597..667612,667640..667714,667764..668008,
                     668078..668198)
                     /locus_tag="CNI02440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572700.1"
                     /db_xref="GI:58271087"
                     /db_xref="GeneID:3259623"
     CDS             join(667597..667612,667640..667714,667764..668008,
                     668078..668104)
                     /locus_tag="CNI02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572700.1"
                     /db_xref="GI:58271088"
                     /db_xref="GeneID:3259623"
                     /translation="MISQECFVGGLAISLLGAILLFLGATGAFATLFAVGGIISLIGT
                     GFLIGFKTQLEKMFKPVRIVATVLMLASIIMTFVSAFVLPTILCIIFVIIQYLAYLWY
                     SLSYIPYARTMVKNMVGW"
     gene            complement(668181..669721)
                     /locus_tag="CNI02450"
                     /db_xref="GeneID:3259773"
     mRNA            complement(join(668181..668548,668600..669476,
                     669521..669721))
                     /locus_tag="CNI02450"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535957|gb|CF681798.1,gi|41535961|gb|CF681802.1,
                     gi|41576010|gb|CF721851.1,gi|41576017|gb|CF721858.1"
                     /transcript_id="XM_572988.1"
                     /db_xref="GI:58271663"
                     /db_xref="GeneID:3259773"
     CDS             complement(join(668231..668548,668600..669476,
                     669521..669711))
                     /locus_tag="CNI02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572988.1"
                     /db_xref="GI:58271664"
                     /db_xref="GeneID:3259773"
                     /translation="MSLNSVVNRLVRAAAGISQDISDVELDAHVAQLLAEEAKAKELK
                     WSELGLTGLLGNSMAAGRDSPDPSLPKPNKRFLASVIRTVDGHNNALLRSQAEAAKQA
                     RNERMPGPSRVNTIGSSRRTTGGAANRLFGGAVKDMARNDSARTRGREREHRGDERTV
                     KRQDEERREGKVRSSRYNDDLRGEKRHRKNNDRRPMNVDKDSPDNTRESRSDDYDRFD
                     RRHERRRDRSHERQGYGSDEDQSPGKFWRGDADDDNERNRERRRRRHGRDSCSPSPPK
                     RRHSSIKLSPAPKPPREPIPPAPPQDLFGSPSPPPISKMDKYFESSYDPRLDLPAVPA
                     QGLVAEVGWDNMLAILKERGKKKQRNSPSLLDDESAPPPGILPRKRAYSPDTLARKAE
                     RKERKAGREERRKRRGDSDSEDEKDRVKRRERRKDKEKEKANGEQQGGGLLGGYEYTK
                     KGSVREWDMGK"
     gene            669925..672251
                     /locus_tag="CNI02460"
                     /db_xref="GeneID:3259493"
     mRNA            join(669925..670012,670069..670111,670163..670221,
                     670279..670314,670371..670556,670609..671222,
                     671281..671844,671899..671958,672013..672251)
                     /locus_tag="CNI02460"
                     /product="t-complex protein 1, zeta subunit (tcp-1-zeta),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530801|gb|CF676642.1,gi|41530811|gb|CF676652.1,
                     gi|41536146|gb|CF681987.1,gi|41536154|gb|CF681995.1,
                     gi|41542450|gb|CF688291.1,gi|41542612|gb|CF688453.1,
                     gi|41542622|gb|CF688463.1,gi|41550483|gb|CF696324.1,
                     gi|41550496|gb|CF696337.1,gi|41552690|gb|CF698531.1,
                     gi|41552699|gb|CF698540.1,gi|41553098|gb|CF698939.1,
                     gi|41553106|gb|CF698947.1,gi|41553944|gb|CF699785.1,
                     gi|41553953|gb|CF699794.1,gi|41556059|gb|CF701900.1,
                     gi|41556061|gb|CF701902.1,gi|41556525|gb|CF702366.1,
                     gi|41556532|gb|CF702373.1,gi|41556825|gb|CF702666.1,
                     gi|41556832|gb|CF702673.1,gi|41557010|gb|CF702851.1,
                     gi|41557059|gb|CF702900.1,gi|41557069|gb|CF702910.1,
                     gi|41559454|gb|CF705295.1,gi|41560029|gb|CF705870.1,
                     gi|41560033|gb|CF705874.1,gi|41560278|gb|CF706119.1,
                     gi|41561451|gb|CF707292.1,gi|41561939|gb|CF707780.1,
                     gi|41561948|gb|CF707789.1,gi|41566429|gb|CF712270.1,
                     gi|41566441|gb|CF712282.1,gi|41566757|gb|CF712598.1,
                     gi|41567199|gb|CF713040.1,gi|41567215|gb|CF713056.1,
                     gi|41567887|gb|CF713728.1,gi|41567892|gb|CF713733.1,
                     gi|415"
                     /transcript_id="XM_572859.1"
                     /db_xref="GI:58271405"
                     /db_xref="GeneID:3259493"
     CDS             join(669941..670012,670069..670111,670163..670221,
                     670279..670314,670371..670556,670609..671222,
                     671281..671844,671899..671958,672013..672037)
                     /locus_tag="CNI02460"
                     /codon_start=1
                     /product="t-complex protein 1, zeta subunit (tcp-1-zeta),
                     putative"
                     /protein_id="XP_572859.1"
                     /db_xref="GI:58271406"
                     /db_xref="GeneID:3259493"
                     /translation="MSSIELINPKAESLRRTQALQVNTAGAVGLANVVKSNLGPRGTI
                     KMLVDGSGQIKMTKDGKVLLSEMQIQNPTAAMIARTAVAQDEQCGDGTTSVVLLVGEL
                     LKQADRYIQEGVHPRVIGDGFDIAKKEALNFLDTFKQTPKLDRANLISVAHTSLATKL
                     HAKLAQKLSADVVDAVLAIQPPEVTEPGAYREPIDLHMIEVMKMQHKTDTDTQLIRGL
                     VMDHGARHPDMPKRVENAYILTLNVSLEYEKTEVNSGFFYSSAEQREKLVESERRFVD
                     SKLKKIVELKNAVCDVVVGSNEKPKNFVVINQKGIDPMSLDVLAKNGILALRRAKRRN
                     MERLQFACGGVAQNSVEDLTPDVLGWAGLVYEHTLGEEKYTFVEDVKEPKSVTMLIKG
                     PNAHTMTQIQDALRDGFRSIKNAIEDNSVIPGAGAFELACSAHLNSSLKTLAKGRAKL
                     GVQAFAEAMLVIPKTLAANGGYDVQDAIVGLQQELEEAGEDGVVGLDLKSGEPMDPVV
                     EGVWDNYRVKRQMLHGAATIAVNLLNVDEVLRAGRSSLKEGPGP"
     gene            complement(672237..675548)
                     /locus_tag="CNI02470"
                     /db_xref="GeneID:3259443"
     mRNA            complement(join(672237..672629,672682..672748,
                     672801..673130,673178..673327,673384..674259,
                     674307..674875,674928..674997,675050..675193,
                     675319..675548))
                     /locus_tag="CNI02470"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41553322|gb|CF699163.1,gi|41555297|gb|CF701138.1,
                     gi|41567727|gb|CF713568.1,gi|41567734|gb|CF713575.1,
                     gi|41570108|gb|CF715949.1,gi|41570115|gb|CF715956.1"
                     /transcript_id="XM_572872.1"
                     /db_xref="GI:58271431"
                     /db_xref="GeneID:3259443"
     CDS             complement(join(672520..672629,672682..672748,
                     672801..673130,673178..673327,673384..674259,
                     674307..674875,674928..674997,675050..675193,
                     675319..675465))
                     /locus_tag="CNI02470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572872.1"
                     /db_xref="GI:58271432"
                     /db_xref="GeneID:3259443"
                     /translation="MNADLKRVRENTLDDSPSPSAKRRLNSNASSPIQPSDDEGMAEW
                     MKIVEVKRKEAIYRQMLEYRRISEHETKRANDLEAQRRVLEASFHAVELCWTQIVAAV
                     RDLAGAENLQLKEEEVLEPLLDPSTPVPELEKALRSRLPTTRQLVTRFVDLVAHNATR
                     PASEADLQARCLKLEAEASALRSNSKLLESEISALKGSRDEAQRDLQRIRKALDRERM
                     EHGKAQEEWKEERTRGGQATPNLRANGSGHSTPNGKVEADKKFYSGAGPSMAGVLQDT
                     SELEQLAASRLKQLEQLRFEQTQLQQEVDRLKILANHPSEAALRESPFFQVYLHQLST
                     SINRAESLQTRFTATESKLDQLRDSNGEFREAVLAEARGQTETLRAQMAKKDSDIARL
                     RGQRDELNSEIMERRAKEVEKCKYTEQIENLANSRQERISFLTSEVRRLKGKLAAAHS
                     SDGYLSFLKESGIDGDYVKDLEAKVVTSQDQINALTSQLERVSSDTAAAKSETEVRTE
                     LESAKRLLARYERILGPNPEAAEDVRYLSQQLEKKEKERASLEMKLEEAEAATNALYS
                     EVEGLSKLWEALDQTVKSKVLELRDGEQKITRLATEKAKADNKYFAAMRAKEAVDMEA
                     KAAQRSVEKQLRLLERAQEVETSLRSQITANEKGLTALKNNALDLQNQLATVVAEKTQ
                     LELRLQQSQNALVEAQQIMHQRVAEAIAEKEARAKLQDEADGQMKIIKKLKERQDAVA
                     AASQTGMSDHEWAITQERDKLLKLLKCSCCEQNFKQQVIVKCMHTFCKQCLEQRIASR
                     QRKCPACGLAFAKEDIQTLYWQ"
     gene            675737..678171
                     /locus_tag="CNI02480"
                     /db_xref="GeneID:3259703"
     mRNA            join(675737..675909,675961..676233,676284..676432,
                     676483..676619,676668..678171)
                     /locus_tag="CNI02480"
                     /product="ER to Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41549825|gb|CF695666.1,gi|41550543|gb|CF696384.1,
                     gi|41555227|gb|CF701068.1"
                     /transcript_id="XM_572862.1"
                     /db_xref="GI:58271411"
                     /db_xref="GeneID:3259703"
     mRNA            join(675756..675909,675961..676049,676106..676233,
                     676284..676432,676483..676619,676668..678171)
                     /locus_tag="CNI02480"
                     /product="ER to Golgi transport-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41549831|gb|CF695672.1,gi|41550561|gb|CF696402.1"
                     /transcript_id="XM_572861.1"
                     /db_xref="GI:58271409"
                     /db_xref="GeneID:3259703"
     CDS             join(675803..675909,675961..676049,676106..676233,
                     676284..676432,676483..676619,676668..678139)
                     /locus_tag="CNI02480"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_572861.1"
                     /db_xref="GI:58271410"
                     /db_xref="GeneID:3259703"
                     /translation="MSAGHPVLDLPPTMPSASVHTMPSSSPMVDDEDDITFDSPEEEI
                     AHYREKYRQALDMLTDTRAELEEFQQSSKELEDEMEQELAANDKQQADLREKIKRLDA
                     EKEEWRTKHIALQKMHSSTTSAMQREMDNLRSERDKTLVALRDLEMGNDELERNERVA
                     ISSLLDLESKYNRAIEEKTLLEQDLAQKDELETETQRLKDELREANEEISILKDQLAR
                     AIATPPSSVSTSSPIHDAACDLSRIHLSDDINASPLPPPVPSKNKSITPEGHSPRRGL
                     SRSGTMSSIPVASPSTKRFSQQIPHSPSFSTLSRSTTSRNLAAAAGTPGSPALARSRS
                     GIPQASPARGIVLASHQQTKSRGFKLLHDLQARLKATDDKLGGAKVPRRNVSNPASVF
                     GVGKRVTSTTSTTSSTTTAPAPHARVTALAKDHNTTPTAQSQQFPGSGIMSPGWVLVG
                     EGEGEDTPTGPWSMTLPAEPNSPLDPTFRSSSTTSNRSLPSRPGIPSPLASGSARSTT
                     SGTAQRQAGQRPSSRLGLKASRRDSEARPLSPSMIPVPSFSSRPMSPDVYQPLRSATP
                     TSGFSSFSASASTSNPPRPNSRTGKRNPIGRGPPPLSSSTRLHHQRSRQSLSGAGPTP
                     TTGADKVERAKRGPRRSSLSNMDKPSLMSASSGSRTPSGRPTSVHVFRETPPPVPRIP
                     SAILKESKVKK"
     CDS             join(676144..676233,676284..676432,676483..676619,
                     676668..678139)
                     /locus_tag="CNI02480"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein"
                     /protein_id="XP_572862.1"
                     /db_xref="GI:58271412"
                     /db_xref="GeneID:3259703"
                     /translation="MEQELAANDKQQADLREKIKRLDAEKEEWRTKHIALQKMHSSTT
                     SAMQREMDNLRSERDKTLVALRDLEMGNDELERNERVAISSLLDLESKYNRAIEEKTL
                     LEQDLAQKDELETETQRLKDELREANEEISILKDQLARAIATPPSSVSTSSPIHDAAC
                     DLSRIHLSDDINASPLPPPVPSKNKSITPEGHSPRRGLSRSGTMSSIPVASPSTKRFS
                     QQIPHSPSFSTLSRSTTSRNLAAAAGTPGSPALARSRSGIPQASPARGIVLASHQQTK
                     SRGFKLLHDLQARLKATDDKLGGAKVPRRNVSNPASVFGVGKRVTSTTSTTSSTTTAP
                     APHARVTALAKDHNTTPTAQSQQFPGSGIMSPGWVLVGEGEGEDTPTGPWSMTLPAEP
                     NSPLDPTFRSSSTTSNRSLPSRPGIPSPLASGSARSTTSGTAQRQAGQRPSSRLGLKA
                     SRRDSEARPLSPSMIPVPSFSSRPMSPDVYQPLRSATPTSGFSSFSASASTSNPPRPN
                     SRTGKRNPIGRGPPPLSSSTRLHHQRSRQSLSGAGPTPTTGADKVERAKRGPRRSSLS
                     NMDKPSLMSASSGSRTPSGRPTSVHVFRETPPPVPRIPSAILKESKVKK"
     gene            complement(678206..679369)
                     /locus_tag="CNI02490"
                     /db_xref="GeneID:3259479"
     mRNA            complement(join(678206..678358,678411..678541,
                     678590..678724,678786..678921,678978..679369))
                     /locus_tag="CNI02490"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41571772|gb|CF717613.1,gi|41574864|gb|CF720705.1"
                     /transcript_id="XM_572699.1"
                     /db_xref="GI:58271085"
                     /db_xref="GeneID:3259479"
     CDS             complement(join(678319..678358,678411..678541,
                     678590..678724,678786..678921,678978..679210))
                     /locus_tag="CNI02490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572699.1"
                     /db_xref="GI:58271086"
                     /db_xref="GeneID:3259479"
                     /translation="MPNPLTLRSETSSTSTPGPSSAKGDSSGAKRKAIDLEGLSPAEK
                     AAQRRLINKLPASEKRELYKEYKKGGRYIVPEALEQRATEEFEIDPAQNEGAAFAFHD
                     VKRKKTERMQMHGGDCECCKGYYEAVGVMPKFHRAPTWKDQEQIEEENGEQAVREHLN
                     KVSRHREDWVKPPTPPGYWKIGFPTTQEVEEQNRKADEMARERDEKIRKEAMQKDGKW
                     RKKSNV"
     gene            <680936..681676
                     /locus_tag="CNI02500"
                     /db_xref="GeneID:3259539"
     mRNA            join(<680936..681004,681039..681138,681200..681388,
                     681428..681525,681584..681676)
                     /locus_tag="CNI02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_572698.1"
                     /db_xref="GI:58271083"
                     /db_xref="GeneID:3259539"
     CDS             join(680936..681004,681039..681138,681200..681388,
                     681428..681525,681584..681658)
                     /locus_tag="CNI02500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572698.1"
                     /db_xref="GI:58271084"
                     /db_xref="GeneID:3259539"
                     /translation="MPGGKDGDAAKTMRRELQARLAQLIFGYPRQIQERMFEMSKYNL
                     QVNGQNYEDFVQATEGFDEVLDRKIWGLHTEKVDHETRIAERRKKMPESINRLEVDLE
                     MRRTEAEWLPDELEEENDVKQVEEIPKPLRHDEVRETFQTVASNLSEVVKSAPLQLQR
                     AQRAQAVRDEITSMPL"
     repeat_region   681674..681696
                     /rpt_type=tandem
                     /rpt_unit_seq="ta"
                     /satellite="microsatellite"
     gene            <682509..>685341
                     /locus_tag="CNI02510"
                     /db_xref="GeneID:3259542"
     mRNA            join(<682509..682831,682882..683623,683672..683954,
                     684005..>685341)
                     /locus_tag="CNI02510"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41541336|gb|CF687177.1"
                     /transcript_id="XM_572864.1"
                     /db_xref="GI:58271415"
                     /db_xref="GeneID:3259542"
     CDS             join(682509..682831,682882..683623,683672..683954,
                     684005..685341)
                     /locus_tag="CNI02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572864.1"
                     /db_xref="GI:58271416"
                     /db_xref="GeneID:3259542"
                     /translation="MGKPGAKALGKRKAPASKPPAPKKAKAASAEDNTQVNGRPKRKP
                     DQPKKVKLRDQKTIPVPKSVYATGSGDEDDGMGSDMLGNLGEEEGLGLENAAFLAGID
                     TTALSRSVKETKRLHELAKTREIIPQSKKQKSKTSVRQPGSDESDGFDSDPEFDSDLQ
                     SDMGSDVDLGSEDDQSLESDDEDEFSGSEDDVDVTAAFDDFSSDEEKDEPERRKRKKK
                     EEEAEYELAGRSRWAAKPEEPEEDSVEVGRLPIKLPTGEIQMVQGSTRIAVPQPKKPV
                     TKAESEDEETDEVDEEEENSDDGAQAMRMASQKGKFGRMGIAEIVGRKGWKNVQRLEA
                     AKEQVAQLGSEILAGGELVDIGPVLTRLSSFGLPTVPALEEGQPPLSVPASIRGLVFL
                     SQLAVYKDLIPGYRIRELTALEEAEKVRDEVKRLREGEKMLVKSYKGYLKMLEAEIKS
                     KTNLATISLRCMCELLTSVTHFNFSENIMGVLVGRLGRRSWDGDSDLVLQTFIRVFRD
                     DISGQHSQTLVRLIARMIKERHFQVHPNVLFCLLHLRLKDELDQMRRGKNAKGSNKEK
                     GGKDEIKGKKFKSEKRKKWATKNQKKREREMKEVQKEMAEAEAEVDKEERARVQTETL
                     KNLFVLYFSILKNPKRTPLLPAALEGISTYSHFINIDFFRDLLVVLRKIIADQQLSDA
                     TNKQEEESEDESSQQLDVVGASQRIRNRLLAIATAFDLLSGQGEALNIDLSDFINQLF
                     SLLRPLCLDTGIEDPPFLPASTKSSSGAVHTLSTSALLFRCLNASFFSRHSRSPANRS
                     AAFAKRLTECALHFPPRTGKQAIAFARSLLSKEPKIEGLLDTEERMADGAYRPELDDP
                     QLVNPFTTSWWEAGVLGSKHWDREVRLEMSKLRDGKVV"
     gene            complement(<685590..>686720)
                     /locus_tag="CNI02520"
                     /db_xref="GeneID:3259641"
     mRNA            complement(join(<685590..685769,685861..686028,
                     686083..686139,686190..686344,686391..686462,
                     686512..686520,686579..>686720))
                     /locus_tag="CNI02520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572868.1"
                     /db_xref="GI:58271423"
                     /db_xref="GeneID:3259641"
     CDS             complement(join(685590..685769,685861..686028,
                     686083..686139,686190..686344,686391..686462,
                     686512..686520,686579..686720))
                     /locus_tag="CNI02520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572868.1"
                     /db_xref="GI:58271424"
                     /db_xref="GeneID:3259641"
                     /translation="MSTPIDPVNLDPVPPLSDSYVFHSSLPAAEQTPGEGWIMGIDEA
                     GRGPVLGPMVYAAAYCPLSFKPILESIGFDDSKALSAETRQTLWESFGVHPPLCYSSS
                     TLSPQDISSNMLRKVPINLNRQAEDATVGLIQAALNRGINVTECYVDALGPAPQWQAR
                     LTAIFPTIKFTVCPKADSLFKIVGAASIVAKVTRDRYVHGWSQDEEEVIRGSGYPSDP
                     KTQAYLKGSIDPVFGYKGIVRFSWATVKVLLDKQGVESKWSA"
     gene            <687153..>688100
                     /locus_tag="CNI02530"
                     /db_xref="GeneID:3259466"
     mRNA            <687153..>688100
                     /locus_tag="CNI02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_572696.1"
                     /db_xref="GI:58271079"
                     /db_xref="GeneID:3259466"
     CDS             687153..688100
                     /locus_tag="CNI02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572696.1"
                     /db_xref="GI:58271080"
                     /db_xref="GeneID:3259466"
                     /translation="MSATVPTLAAAEEPVIDPALMDENEAVVDQAVTLSVEKESDNGS
                     NGQGPSTLQAAITASDPVPQESTHVVDSSAVEALADIASPSPTAEASNNAVAGPSSLV
                     HAASASAEPPCSVLVQASSYTLPDAEATLVAPSPPHGPWLSREEAEEAIRAYALANNF
                     DVTITHSDVYRHVITMACVKGGKYRCTRGPTHDEVRQRGKRTGKTGCNWRVTIRDENY
                     KPHRYHDEKQKWDYVPMSDLVNTHNHPPILPKDNPKVRHKTITPQVKELIYKEVNKGT
                     PTRKVLEKIQKEFPDCLANMVDVKNLIGRRKKELPTMGL"
     gene            <688545..>689932
                     /locus_tag="CNI02540"
                     /db_xref="GeneID:3259417"
     mRNA            join(<688545..688580,688697..688753,688815..688927,
                     688981..689290,689364..689636,689708..689844,
                     689890..>689932)
                     /locus_tag="CNI02540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572866.1"
                     /db_xref="GI:58271419"
                     /db_xref="GeneID:3259417"
     CDS             join(688545..688580,688697..688753,688815..688927,
                     688981..689290,689364..689636,689708..689844,
                     689890..689932)
                     /locus_tag="CNI02540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572866.1"
                     /db_xref="GI:58271420"
                     /db_xref="GeneID:3259417"
                     /translation="MRDNYNEHGVDEYYRKVAATYRNPFYPGIKKAVWALMNRWWEAE
                     GRDMFSQEEKRGRKNLKVLDMAAGSGEGTLCLLEWARTGSTNASAEATSSASQPSLSV
                     PDPLALLRSTAPSTSARQAFVPPNVRRPVVPPPKPTASAKVSSSGNQVFGSMIPARLP
                     EGFEIDVIATDPYTSPAYTERTSRPCHSLSFTDLAQGLLPPTSAMTSPRSEDPNNNSE
                     PIWDIIICSFALHLVTNPSELFALLFELSGKARWLIVVAPHKKPEIKETWGWARWDIA
                     SWTAAGEARLYGGGKPKGDGDDGETELEIVRDKHPKVPILIIPVAE"
     STS             689431..690224
                     /standard_name="Hind20"
                     /db_xref="UniSTS:470714"
     gene            complement(691261..695111)
                     /locus_tag="CNI02550"
                     /db_xref="GeneID:3259612"
     mRNA            complement(join(691261..691609,691659..691971,
                     692025..692144,692199..692276,692327..692437,
                     692495..692777,692836..692963,693010..693102,
                     693157..693260,693314..693995,694045..694301,
                     694357..694498,694551..694641,694692..695111))
                     /locus_tag="CNI02550"
                     /product="vacuolar protein sorting 41, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531845|gb|CF677686.1,gi|41549177|gb|CF695018.1,
                     gi|41549184|gb|CF695025.1,gi|41565722|gb|CF711563.1,
                     gi|41565733|gb|CF711574.1"
                     /transcript_id="XM_572694.1"
                     /db_xref="GI:58271075"
                     /db_xref="GeneID:3259612"
     CDS             complement(join(691311..691609,691659..691971,
                     692025..692144,692199..692276,692327..692437,
                     692495..692777,692836..692963,693010..693102,
                     693157..693260,693314..693995,694045..694301,
                     694357..694498,694551..694641,694692..695107))
                     /locus_tag="CNI02550"
                     /codon_start=1
                     /product="vacuolar protein sorting 41"
                     /protein_id="XP_572694.1"
                     /db_xref="GI:58271076"
                     /db_xref="GeneID:3259612"
                     /translation="MSSSSHSSLSPPSKPAFVHDTPEAGPSVQSLRSRTSSLSSTSSS
                     VSRKGKERARVPNGDDLDSELSETESGDENSEEEEEEDDDEEKEGSQSSERSGHESEN
                     KDGPSTKEKSIEDDEEQIEDDDEEDSEESSDEEEEEPALKYSRLKGRIPEILAKDSAS
                     TISVSPRSVALGTHNGMVHILSYEGVKINSFRPHAASVTCLRMDESDDFVATSSVEGR
                     VVIHSLSTPESYAFDYKRPMRAVALEPDFAKKKSRAFVCGGMAGNLILQEKGWMGYKE
                     QILHSGEGPIWAIEWRRNLIAWANDLGVKIYDTNTGQRIGYIDRGASAPRAELFKCTL
                     QWKDDQTLLIGWADHIKSVRVRSRPSSQASGNLPPLTVEMTAIYQVDCMISGIAPFGG
                     SYVILAYIAPDRYENEATDDPIEQRRKAANRPELRIIDKGEETNADALSLANYHMYGC
                     NDYSLVKSQKPGEEAFLVISPADVIVVRPRDEADHIEWLVEKERFQEALEAAEEMQKK
                     HGSALDMKGIGLKYMRHLVSKEQFEQAAELAPKILEQDVAAWEKWIDIFVQHQQLPVI
                     IPYIPTQKPRLGRRVYEMVFTHLLINDKQALLKVITSWPTEIYDLTTLVDAIQGELQA
                     SHDDPVLLECLGELYLINRLPAKALPYFLRIRKPYVFDLIREHNLFTAVRDQALQLVT
                     FDQERKKAQGKRENQRGEKTDDAEMGSVEGDKSKHGAAIQLLVDHVHSIPIERVVHQL
                     ETKPHYLYMYLDALLDKDPQYSLPYSDRMVELYAAYDVDRLMPFLRTSNFYDLEKAYA
                     VCKERDYVPEMVFLLGRMGNNKRALMLLIERLGDVERAIEFAKEQADEDLWEDLLAYS
                     ESRPDFIRALLEHVGAEINPIRLISRIRNGMEIPGLKPALVKILQASNLQVSLLEGCQ
                     HILNGDCAGLMGQLQKGQTNGLKASFTSTCAVCSKPAFTNSPSLVLIYLCRHLVHAEC
                     VLPEGVDLPVRQENASVAYLLADEGRMGGRRGAAWKARNLGARLGYAAAVRVRVKQCP
                     VCESKQGH"
     repeat_region   694843..694882
                     /rpt_type=tandem
                     /rpt_unit_seq="tcc"
                     /satellite="microsatellite"
     gene            complement(696041..>697194)
                     /locus_tag="CNI02560"
                     /db_xref="GeneID:3259477"
     mRNA            complement(join(696041..696446,696496..696668,
                     696735..>697194))
                     /locus_tag="CNI02560"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532887|gb|CF678728.1,gi|41532891|gb|CF678732.1"
                     /transcript_id="XM_572692.1"
                     /db_xref="GI:58271071"
                     /db_xref="GeneID:3259477"
     CDS             complement(join(696081..696446,696496..696668,
                     696735..697194))
                     /locus_tag="CNI02560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572692.1"
                     /db_xref="GI:58271072"
                     /db_xref="GeneID:3259477"
                     /translation="MSRLPRLSTLTRAFRRMHTDGRQIDHNGPSTPPPHHHPPADPSA
                     HAPLPQPIITDAPPLATPEPRSTKKGKPIFTRAARQVTVHLPSGYPEPTKYPPPPEYY
                     EGLEEKRKEPHPLWQFFHVPVKSQGRPTDVYPSQGFGSLESLAPEDANLHSGRAWTAA
                     ELRQKSFKELHTLWYVLLRERNVLATQREERRRLGIGSRVDGVLNAKRGFRCRKSMAR
                     IKYVLNERRLGLIAAAGPHLPIDAPHIPWSSSPTTDPAGATAAIRGERPDSKRIAEFE
                     GAGFGGGSRQSESFIEDEDVAEEEVEARDEGFGGGKEAEKFVDEVEVKDGKVEKKE"
     gene            complement(697808..699568)
                     /locus_tag="CNI02570"
                     /db_xref="GeneID:3259557"
     mRNA            complement(join(697808..698336,698400..698555,
                     698616..698700,698754..698816,698910..698944,
                     699001..699123,699176..699249,699304..699568))
                     /locus_tag="CNI02570"
                     /product="glycosyl-hydrolase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41547660|gb|CF693501.1,gi|41547676|gb|CF693517.1,
                     gi|41565244|gb|CF711085.1,gi|41565253|gb|CF711094.1,
                     gi|41574253|gb|CF720094.1,gi|41574257|gb|CF720098.1,
                     gi|41574616|gb|CF720457.1,gi|41574627|gb|CF720468.1"
                     /transcript_id="XM_572690.1"
                     /db_xref="GI:58271067"
                     /db_xref="GeneID:3259557"
     gene            <697889..699572
                     /locus_tag="CNI02580"
                     /pseudo
                     /db_xref="GeneID:3259373"
     CDS             complement(join(698017..698336,698400..698555,
                     698616..698700,698754..698816,698910..698944,
                     699001..699123,699176..699249,699304..699488))
                     /locus_tag="CNI02570"
                     /codon_start=1
                     /product="glycosyl-hydrolase"
                     /protein_id="XP_572690.1"
                     /db_xref="GI:58271068"
                     /db_xref="GeneID:3259557"
                     /translation="MLLSVITPLLLAAASYAQQSTPRVLVYSATAPDGYRHDSIPTAI
                     NVLGQNADKYGVQFVFSEDMQMFTNETLSGFDGVMFVSNSEEVLDAPGKAALQTFFQS
                     GGVYTGVHSASTCLTDDVNYGLALGAFFDYHPPLQTATFERLNTTHPAVANVPDRWTF
                     QEEVYYFSTNPRDNGAVVILTVDETSYVNNGSSQGDYSNIHGSPHPIAWYIESPLSAQ
                     PFAESVSKAGRSFYTSLGHLNSTWEDETFIGHLMGGLLWALDGASTKAYGVGVVGNAT
                     APSTNQSTATVGGSSTHGGSTAATTAVTAVAASGSSSSESNGSEQVLPSSVLMALGVS
                     ILGAVFGMGLAL"
     repeat_region   698875..698903
                     /rpt_type=tandem
                     /rpt_unit_seq="taaaaa"
                     /satellite="microsatellite"
     gene            complement(700068..700424)
                     /locus_tag="CNI02590"
                     /db_xref="GeneID:3259517"
     mRNA            complement(join(700068..700238,700289..700374,
                     700411..700424))
                     /locus_tag="CNI02590"
                     /product="expressed protein"
                     /transcript_id="XM_572688.1"
                     /db_xref="GI:58271063"
                     /db_xref="GeneID:3259517"
     CDS             complement(join(700106..700238,700289..700374))
                     /locus_tag="CNI02590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572688.1"
                     /db_xref="GI:58271064"
                     /db_xref="GeneID:3259517"
                     /translation="MPGPLYRDPWAAREAWRKSPIFSNKAMFRSMFPGLGTAIVAFTA
                     YVIYDDFFAAKSSHGHAHGKEHPKTLAM"
     gene            700566..703541
                     /locus_tag="CNI02600"
                     /db_xref="GeneID:3259748"
     mRNA            join(700566..700781,700831..701358,701410..703541)
                     /locus_tag="CNI02600"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41551693|gb|CF697534.1,gi|41552483|gb|CF698324.1,
                     gi|41557593|gb|CF703434.1,gi|41557600|gb|CF703441.1,
                     gi|41562147|gb|CF707988.1,gi|41562154|gb|CF707995.1,
                     gi|41575135|gb|CF720976.1,gi|41575139|gb|CF720980.1,
                     gi|41576483|gb|CF722324.1,gi|41576493|gb|CF722334.1"
                     /transcript_id="XM_572997.1"
                     /db_xref="GI:58271681"
                     /db_xref="GeneID:3259748"
     CDS             join(700607..700781,700831..701358,701410..703433)
                     /locus_tag="CNI02600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572997.1"
                     /db_xref="GI:58271682"
                     /db_xref="GeneID:3259748"
                     /translation="MSLRSLSERTRDAVLALLGQQIRPPDTDQQWTHLLQPTSQTNRS
                     IILWLLVFVFLLIGAVVTNPSETCFRSHLTELSFRSAMADFRRSEDEANDEHGNKQGS
                     LPVTGADTPTLQPISPLRFANRVAISLRTPTLYYRSFFLLSIAITPPLQSPAYLSDSR
                     QTKKNASIKERHLLWVGTWGSWSEVMLIPLYLEWVWRVVTRGAKEKSRKRASVDKPGV
                     FEIRSVALKEEPVTPNPKASLSPATAKHLRRSDSSTNIPDVLPLHSRPPSPTSRPPSI
                     VNLVPPSSPAPEIASPLINSLKAELAAAQNVVQELQNQLSTHDQSVHEAHAHLQSTLD
                     DLRNRRKEDDAERQELKARTKNLEEQKRQAESARREAEKKLRAVEIMRDGLENKIKGA
                     EGSVKGTREQIGGSQQSVKVLQQEGDRHAVGARQEVERKQQELRNVEAAIGMVEAKNE
                     ELESRVKEAEEKLKGVIEAGEAARKIGPEEEMMMMAAAYEVAAQEGYLHGYQHAHGGN
                     SHWATQAAAYMAEAGMPHLGYDYTARPTSHISTTGFGHLSKGTFASSSSRDLKELRYT
                     DVSGFEDFGPGSASVSRRVSGVDAGKKQESTASDSESDVYGHDPGSPNGGISSSFSAN
                     LLPQGLFSSLEGETPYVGAGDESSTFDDPLKLDLGEQDVHADNFSNSSASSPEQPALS
                     HHSSFSNPTTAHVEPIKRPSGSASHSLLPYPSSTSPSLGPNGLAPPAHSTTPPLIPGL
                     PTLPGSRRWFSGTLSNDSLPNKSTSSFSTSGFPSGVTKLGYQHPTTTTSNDSLHMGIG
                     NSGAGGYESPFAPTEGEKKALAMAQGKWGGLSKRWTGGGEGWPSGLGWGRRDVGMVEG
                     RASSEGHRIEISQVVGQSQGEMRQGEEGDKPGLKSKFSFLRKSQNQLSESRS"
     gene            complement(703557..>704588)
                     /locus_tag="CNI02610"
                     /db_xref="GeneID:3259388"
     mRNA            complement(join(703557..704024,704118..>704588))
                     /locus_tag="CNI02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_572686.1"
                     /db_xref="GI:58271059"
                     /db_xref="GeneID:3259388"
     CDS             complement(join(703764..704024,704118..704588))
                     /locus_tag="CNI02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572686.1"
                     /db_xref="GI:58271060"
                     /db_xref="GeneID:3259388"
                     /translation="MVLRVQPRPFLRPFSLPRLAATRFAHSAPQAPTRTCPSCSRPVP
                     LPLSPCPSCSSILPLPSNLSHHSMLYLSAPISSSGSPAGPFDIPQELAHLPCNGYTVD
                     KADLRSNWVRRQRELHPDKYSTRGDGVVDLARELSGRVNEAYAVLGDDLRRAEYITRL
                     TILCSLPRSSRREKNSKTPRHLKKSIGYGKPTRVRFPQFLHNSLLSLDVIPKLIAFWL
                     YIYRARERDNWVPRTSIFRYTSRPG"
     gene            complement(704754..706022)
                     /locus_tag="CNI02620"
                     /db_xref="GeneID:3259409"
     mRNA            complement(join(704754..704955,705029..705082,
                     705134..705196,705302..705488,705621..705720,
                     705793..706022))
                     /locus_tag="CNI02620"
                     /product="mitochondrial import inner membrane translocase
                     subunit tim17, putative"
                     /transcript_id="XM_572685.1"
                     /db_xref="GI:58271057"
                     /db_xref="GeneID:3259409"
     CDS             complement(join(704906..704955,705029..705082,
                     705134..705196,705302..705488,705621..705720,
                     705793..705824))
                     /locus_tag="CNI02620"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit tim17"
                     /protein_id="XP_572685.1"
                     /db_xref="GI:58271058"
                     /db_xref="GeneID:3259409"
                     /translation="MSAADHGRDPCPYVILNDFGGAFSMGAIGGGIWHGIKGARNSPR
                     GERLVGSLSAIKARAPVLGGNFGVWGGLFSTFDCAVKGYRQKEDPWNAIISGFLTGGS
                     LALRSGPKSAFGSAVGCAILLGVFEGVGVVANRMMAQPIPQMQLPEQAPPPVAPAVAT
                     A"
     misc_feature    705111..705132
                     /note="AT_rich"
     misc_feature    706097..706120
                     /note="AT_rich"
     gene            <706215..706954
                     /locus_tag="CNI02630"
                     /db_xref="GeneID:3259437"
     mRNA            join(<706215..706262,706319..706352,706415..706690,
                     706813..706954)
                     /locus_tag="CNI02630"
                     /product="DNA-directed RNA polymerases i, ii, and iii 17.1
                     kda polypeptide, putative"
                     /transcript_id="XM_572883.1"
                     /db_xref="GI:58271453"
                     /db_xref="GeneID:3259437"
     CDS             join(706215..706262,706319..706352,706415..706690,
                     706813..706928)
                     /locus_tag="CNI02630"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases i, ii, and iii 17.1
                     kda polypeptide"
                     /protein_id="XP_572883.1"
                     /db_xref="GI:58271454"
                     /db_xref="GeneID:3259437"
                     /translation="MAESSNIIFDDRFTVDTVDKDGKKFDRVSRITATSHSLSMSLTL
                     DIANELYPLEQSETFTLTLARSLVPSELETLDSRADGDEGEEGSEVRRVKRELWRSHE
                     QGLAEDYDYVMYGKVGKGGSTAYFSFGGLLMALRGSYRHLAGVVVGENVYLLMRK"
     gene            complement(706945..>707858)
                     /locus_tag="CNI02640"
                     /db_xref="GeneID:3259558"
     mRNA            complement(join(706945..707360,707409..707610,
                     707655..>707858))
                     /locus_tag="CNI02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_572684.1"
                     /db_xref="GI:58271055"
                     /db_xref="GeneID:3259558"
     CDS             complement(join(707011..707360,707409..707610,
                     707655..707858))
                     /locus_tag="CNI02640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572684.1"
                     /db_xref="GI:58271056"
                     /db_xref="GeneID:3259558"
                     /translation="MRPPRPLALLALALPAAAFRDTSPLLIWLPHAPHAPLAPPLADA
                     AAVYSQLHTLGCDWHSAVAVHVDDLHSSCTADYAIPPDAHVHIPYLSRPDRRALDDSL
                     EAWARTCGAVVDDAVDAAVGGKRLVRLSVANGEPIPPLPPSSILLITGSPSGSRPHKR
                     QEERPFPTHSSLTTRPTASPPKHNATVPADGPLFDRVQILTTPIITALLVTFGIFIPL
                     AAFGVSALASIQVPPRMMEIGKGLVVGKERKDQ"
     misc_feature    707736..707853
                     /note="G-rich"
     gene            708047..710131
                     /locus_tag="CNI02650"
                     /db_xref="GeneID:3259576"
     mRNA            join(708047..708203,708254..708261,708311..708408,
                     708460..708836,708886..708980,709033..709123,
                     709173..709258,709311..710131)
                     /locus_tag="CNI02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_572999.1"
                     /db_xref="GI:58271685"
                     /db_xref="GeneID:3259576"
     CDS             join(708053..708203,708254..708261,708311..708408,
                     708460..708836,708886..708980,709033..709123,
                     709173..709258,709311..709751)
                     /locus_tag="CNI02650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572999.1"
                     /db_xref="GI:58271686"
                     /db_xref="GeneID:3259576"
                     /translation="MSSSPARDDKPAPAKKPAPRPRAAAAKPPADHKFDIGDIVLARL
                     RGYPPWPARIANPETLPRNVLKTRPGKNPNLYCCQFFPAGDFSWLQNKDIKALSASDI
                     SSFLAQPHRKSSGGLREAYQTAQDPTEWDAQQEEIHKQQEEAEANVDELEDEDEAEVV
                     VKAGKRKREEPKRKKAAKKEEEPKPKKAKAVSKAVSKAGDKKAVSKTEVDEDPLASDP
                     ECVKVKDWRHKLQKAFLGESMPAEPEMSHWNEVFESIESYDSMTIEALQYSKIGKVMK
                     KIMGLTTIPLNDKYDFTRRAGKLMHQWQEFIDAANRGRVTNGQKKSARPPSAPSAAAT
                     AAEEETPAKEDKPADETPAEEKKEESAEPVAEKKEESAEPVTEKKEESAELVTEGKME
                     LDEKEKEAAAEEPAAAEKTEEVGAGAGEEAEAAEAPEPEAAEKPEANGEDKMQVDA"
     misc_feature    709641..709677
                     /locus_tag="CNI02650"
                     /note="G-rich"
     misc_feature    710034..710079
                     /locus_tag="CNI02650"
                     /note="T-rich"
     gene            711130..714139
                     /locus_tag="CNI02660"
                     /db_xref="GeneID:3259656"
     mRNA            join(711130..711262,711334..711763,711821..712710,
                     712763..714139)
                     /locus_tag="CNI02660"
                     /product="integral to membrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540917|gb|CF686758.1,gi|41541731|gb|CF687572.1,
                     gi|41547209|gb|CF693050.1,gi|41569364|gb|CF715205.1,
                     gi|41569370|gb|CF715211.1,gi|41571550|gb|CF717391.1,
                     gi|41571555|gb|CF717396.1,gi|41571762|gb|CF717603.1,
                     gi|41571769|gb|CF717610.1"
                     /transcript_id="XM_573001.1"
                     /db_xref="GI:58271689"
                     /db_xref="GeneID:3259656"
     CDS             join(711430..711763,711821..712710,712763..713845)
                     /locus_tag="CNI02660"
                     /codon_start=1
                     /product="integral to membrane protein"
                     /protein_id="XP_573001.1"
                     /db_xref="GI:58271690"
                     /db_xref="GeneID:3259656"
                     /translation="MRIPLFILTFLFSLFSLATTPVAADSGVLYTDAVTYCAEAKAVI
                     VDEFDITYHRSNGSVTFSFSLASVESNLNTSVNLYINAYGIQIINQTLELCELLQGVI
                     CPLPQVNFTGYGTYPIPEEYLSKIPSIAYTVPNIEAYARVQLIRVENNEVAACLQATL
                     ANGKTAHQKGVIWASAMFTLVAFLVAIWHTASGTSTSPIQYRWFDILFIFQAAAASGL
                     LHLNYPLVYTNFVQNFHWALGLFYSSNMQSSIKKMREKTGGSMDSTAYSDVQYINRKL
                     SPYNVYMSNDGILSSPESLAAFFKENALSKRSLEHFAKRATIPSVLPQNVTTDINTGL
                     PVYTNTLKIPEANAYDTIWFVFLALIGIFVAFHVLLFGIVFLFDRMGRNRSHLGWAAR
                     LRRMWWPFCIGNSLRLCLIGFFPIWIFAFWQFHIGDSGLSIFWAVFGILLTLVPLATA
                     FVLSLLRARRISSTSPEINSLYTSFRYFHSIGVLYRQYRQKFHYFWFAPFILAMIARA
                     GFIAFGPTSAWAQVIGNLVVEFIILVALLACRPHKDKKGDWLGAFLSLCRLIAIGLLI
                     AFIPDMNVTPIPRAVIAFVIIVFYGVPVVLLFIGFLWNIGYGYLWCKHSTRIEDGLEV
                     ERFSPTSSNSSVPPPMMKNIDAATFVSSDGAAASRGSLSMGGAGATGAGAGFGGGAAA
                     AGAGLGRRSSLMEPVGDNVYEASGSSADGALSSPPVTTYNPYGKEEIGYPYDPQNSQL
                     AYEQAAMGRGGVNGAGSPIDEKQWSRRY"
     gene            complement(714326..717611)
                     /locus_tag="CNI02670"
                     /db_xref="GeneID:3259686"
     mRNA            complement(join(714326..714909,715051..715416,
                     715487..715565,715615..715696,715752..715821,
                     715876..715941,715999..716257,716314..716329,
                     716382..716663,716716..717611))
                     /locus_tag="CNI02670"
                     /product="MAP kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546319|gb|CF692160.1,gi|41557078|gb|CF702919.1"
                     /transcript_id="XM_572911.1"
                     /db_xref="GI:58271509"
                     /db_xref="GeneID:3259686"
     CDS             complement(join(714398..714909,715051..715416,
                     715487..715565,715615..715696,715752..715821,
                     715876..715941,715999..716257,716314..716329,
                     716382..716663,716716..717266))
                     /locus_tag="CNI02670"
                     /codon_start=1
                     /product="MAP kinase"
                     /protein_id="XP_572911.1"
                     /db_xref="GI:58271510"
                     /db_xref="GeneID:3259686"
                     /translation="MTSPSAQPMIPRSQPPRPSHTQSSPAINSTGIKPNGPPSVIRRA
                     PSVPVNPSTAAASGSLSSLLKSENTAQAVSRSSPPTEPNDLPRPIEPTPMLPITGLPN
                     SSSSSSNARHGSSSSISRGPSVTGTLTPATTALGAPIEPTPPQTGASKMAAAAKRGLD
                     GSAGNNVKVYEEGHPLNEETLKQRGYQTLNILNHPFHLPDRWKLLRPLGQGAYGLVIQ
                     VQDAETEIPIAVKCVTRVFDKVILARRALREITLLRHFGEHDNLTGLVDMDNVWDGYN
                     EIYLYMEPMEADLHQIIRSGQPLGNAHIQFFIYQLLRGMKYIHSANVIHRDLKPGNLL
                     VNSGCELKICDFGLARGFNPVKGEEPQGEEGKLTEYVATRWYRAPEIMLSNRRYTTAI
                     DVWSIGCILAELLGLKPVFKGKDYIEQMTLILETLGTPDEETMARVASEKALTFLKTL
                     PTYEKKDLGSIFPDADPLAVDLTDKLLEFDPTRRIDVPSALTHAYVERYHDPEDEPSC
                     DKIFDKWEEVESLSTIEELKEAITREIQGFREEVRMAAEEDDEDEEWAEGEYLDDENV
                     FHDSPGPALASTLEKFTYPDHIAPTGSAPRTREHSPTTTFITSAEDYFTAQHGFGGPN
                     GRASRRSSSHSTSGRRPASFLFSPFGAGMTQIVPTPNAYPRSHAQASPELTTAEKTPR
                     DRRSSGLWRTRSRAQSQSGNLVLERLSSLEINDHKDGEKNRIDALHAVVGLGGDGEVP
                     PMTVSPSDAPPSEVPKSFGY"
     gene            complement(717775..719496)
                     /locus_tag="CNI02680"
                     /db_xref="GeneID:3259389"
     mRNA            complement(join(717775..718379,718437..718659,
                     718711..718774,718832..718853,718903..718968,
                     719105..719496))
                     /locus_tag="CNI02680"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41532426|gb|CF678267.1,gi|41532437|gb|CF678278.1,
                     gi|41534619|gb|CF680460.1,gi|41534631|gb|CF680472.1,
                     gi|41542747|gb|CF688588.1,gi|41542752|gb|CF688593.1,
                     gi|41553330|gb|CF699171.1,gi|41553336|gb|CF699177.1,
                     gi|41553652|gb|CF699493.1,gi|41556903|gb|CF702744.1"
                     /transcript_id="XM_572910.1"
                     /db_xref="GI:58271507"
                     /db_xref="GeneID:3259389"
     CDS             complement(join(717970..718379,718437..718659,
                     718711..718774,718832..718853,718903..718968,
                     719105..719210))
                     /locus_tag="CNI02680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572910.1"
                     /db_xref="GI:58271508"
                     /db_xref="GeneID:3259389"
                     /translation="MAYNHKLPKKISLKPKKHHGFQVFLWLLGLLLPPLAVAVRFGIG
                     VDFFVNVFLCICGYIPCHFHNFYIQNIRNNSNRARTPKWAIKYGLVDNSDRERRARKN
                     QWSKRFDERNNHSTLAEQELEEGEEGPNYDPSIVNPEEVERRRNEGLWTADDEEYYND
                     DQAPNQRKWHYPANFEGAVGDGRSYKRNASSGGDRWQRAARRSSGASNTYPPVAATDD
                     DVPEWGKDYGSKRRSSKKKLNKKQDHTHDWARNPEYGNEDESGARGAGGSGRPREGSR
                     GSGRENGGTANGDPNWDHEF"
     gene            <720285..>721699
                     /locus_tag="CNI02690"
                     /db_xref="GeneID:3259510"
     mRNA            join(<720285..720380,720444..720500,720549..720859,
                     720949..721035,721152..721250,721301..721351,
                     721414..>721699)
                     /locus_tag="CNI02690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573009.1"
                     /db_xref="GI:58271705"
                     /db_xref="GeneID:3259510"
     CDS             join(720285..720380,720444..720500,720549..720859,
                     720949..721035,721152..721250,721301..721351,
                     721414..721699)
                     /locus_tag="CNI02690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573009.1"
                     /db_xref="GI:58271706"
                     /db_xref="GeneID:3259510"
                     /translation="MYLAELAIGECQGRRIEDKDCSRLSRHISAVTSSRCYMFSMPCE
                     LETSYRSLFLHIWLNLMLLLYAILQIPQTKIALEDVTGSCGDFDVCFTSRDSFFFLLT
                     MAVGSAAQALAHYSTSSKASSSYLPSSLDWPSFPLGFCPGSFTFSLAGMFSDWAYQTL
                     LSLLKLLLFFAMAFCLAVGCLDCLHGFLRSILTVVALPLVIVFILLCGWALRTENKTV
                     MVCLLVIMVAGLAYFIYKLVTLWLPRTSSLYINTKITMAILSIFSIIILLVTFIFGCM
                     CMSNFGKGLVEAHQNPENRTSLWSLPANKGWSRKYNGNEGESGQMVPQMVIE"
     gene            complement(722884..725208)
                     /locus_tag="CNI02700"
                     /db_xref="GeneID:3259806"
     mRNA            complement(join(722884..723999,724048..724418,
                     724473..725208))
                     /locus_tag="CNI02700"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544461|gb|CF690302.1,gi|41544466|gb|CF690307.1,
                     gi|41547168|gb|CF693009.1,gi|41547179|gb|CF693020.1"
                     /transcript_id="XM_572909.1"
                     /db_xref="GI:58271505"
                     /db_xref="GeneID:3259806"
     CDS             complement(join(723022..723999,724048..724418,
                     724473..724872))
                     /locus_tag="CNI02700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572909.1"
                     /db_xref="GI:58271506"
                     /db_xref="GeneID:3259806"
                     /translation="MDPQQQADNDALASAVAASAHQLGLGPLHGHDHSDDGHHQPHHF
                     HHALQQPDFSQGHHHKDGEGHHDQGMDVHALDIPTVDESHHHVMEHHQSELDLGLGSI
                     GTPGEMQGFDTGEMDQTPAEVYSGRPPSIRKACDLCHAAKQKCSGDRPSCTRCAAGGW
                     PCNYAPRQRRRTVPKEQKHQQHHASHHTHHALDMHHHHAHAMQLQSGAKKRKLAREAL
                     AGFGSEAIDMKMAMGMAMDMGLTGEEEGEEMQNMSDEQMLESIAIDGYLSDLPLASFV
                     HNLPFTSTPAQEPVFNADDFPSSSDNPFPSADMDQHTTSALRDAIFSLNESGNAGQEA
                     EGGGEHGDGEGGEEGQMDPHLALLDLSNMNNEADGEGSDPTGGLNLGDFTHPHTPTQS
                     QGCNHRQLVPHILALLASHTLDPKPGSNTPLTLAVFAPLARSLRLFHSLTTCQSCMSS
                     PRETLPQLALLSRTTTILTFPFPPINSSSVGSSAQITIHGARISGTGLSEAIEQHIVG
                     VVWDSWRASVREVFAAMDKKAQEVITASGLAAAAAGNQEGGPVPQVSSLEKQRAGLVF
                     QAVSRLVTAMDEVEGN"
     gene            complement(727833..732805)
                     /locus_tag="CNI02710"
                     /db_xref="GeneID:3259768"
     mRNA            complement(join(727833..727881,727934..727953,
                     728005..728173,728228..728695,728749..728976,
                     729059..729084,729209..729307,729545..729575,
                     729636..729998,730048..730115,730172..730267,
                     730313..730914,730961..731067,731118..731222,
                     731272..731404,731459..731604,731657..731689,
                     731730..731825,731876..732072,732122..732465,
                     732527..732805))
                     /locus_tag="CNI02710"
                     /product="translation repressor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535367|gb|CF681208.1,gi|41548560|gb|CF694401.1,
                     gi|41552905|gb|CF698746.1,gi|41566813|gb|CF712654.1,
                     gi|41575437|gb|CF721278.1"
                     /transcript_id="XM_572682.1"
                     /db_xref="GI:58271051"
                     /db_xref="GeneID:3259768"
     CDS             complement(join(727873..727881,727934..727953,
                     728005..728173,728228..728695,728749..728976,
                     729059..729084,729209..729307,729545..729575,
                     729636..729998,730048..730115,730172..730267,
                     730313..730914,730961..731067,731118..731222,
                     731272..731404,731459..731604,731657..731689,
                     731730..731825,731876..732072,732122..732465,
                     732527..732744))
                     /locus_tag="CNI02710"
                     /codon_start=1
                     /product="translation repressor"
                     /protein_id="XP_572682.1"
                     /db_xref="GI:58271052"
                     /db_xref="GeneID:3259768"
                     /translation="MEQTTDIEDSVFLELLNTAANPTSVDAIPSDELATSLGIDGPLS
                     REQALELLENEVLSPVHKFQGHELGQWQVQPPISLPIPPLTLSPLHQTHTVTPSFRGI
                     NGEFTHWREALAPKPPAHPTLSSSTTRAPGSMQNFVRGKGSYAPFLPGGLEAAAKVEE
                     DEDEDEDEEVGWKTRAPGMKKGAKLDGADKFLAEMLGQQSLTAKAKRRRRDGEFASPQ
                     LTVSRLGDKDEDVDGIDLKPVQSSDKNIDDLLPIGRLPAPPSSKKQFKAVAKKEWAHV
                     VDVNQKLENFNELVPEMAKDYPFELDNFQKEAVYRLEMGDSVFVAAHTSAGKTVVAEY
                     AIALAAKHMTKTIYTSPIKALSNQKFRDFKTTFEPSTVGILTGDVQINAEGSCLIMTT
                     EILRSMLYKGADLIRDVEFVVFDEVHYVNDAERGVVWEEVIIMLPEHVNIILLSATVP
                     NTKEFADWVGRTKKKDIYVISTPMRPVPLEHFLWAGRETHKIVSSQSKFLMEGYSSAS
                     DALRRKQDKEREANGLPPVQRTGGRGGAAIRAKDLPTGKSAPFTRIGAGRNHTNRGGG
                     NGPPQAAFGGGRGGRGGGRGGFGGSSRPSHVLDQNIWTHLISYLKKNMLLPVVNFVFS
                     KKRCEEYAQTLSLDLCTAKEKSEVHITWERALTRLKGEDKTLPQILRMRELLSRGIGV
                     HHGGLLPLVKEVVEILFARGLVKVLFATETFAMGVNMPAKSVVFSGIRKHDGTSFRNL
                     LPGEYTQMAGRAGRRGLDTTGTVIILSGDELPSVEELNEMMLGVPNRLSSQFRLTYNM
                     ILNLLRVEALKVEEMIKRSFSENATQKMAPEQQRVIAQRKNLPSFPSLSNHPNLGPDG
                     QRSDVKAFRVLVLVTPGQKSGKGVVDTSSISFYDFHRLNSRESPSDVQRALDDLTKLH
                     EELSLLPELPEADWSRLRDIDIQSLLKERTNAAGRLSKLGCQLCEDFADHYATVHERK
                     QVEQRIQKLKLQLSDQNLELLPDYESRVEVLKRLSFIDENATVLLKGRVACEINSAPE
                     LILTELILENILADYTPEEVVALLSIFVFVEKTESQPIIPTKLQDGLDVIYNIAEQVE
                     REQDYCQVQHDEFATKYKPGLVEVVYEWARGMPFNEITNLTDVPEGTIVRVITRLDET
                     CREVRDAARVIGDADLFKKMEEAQGLIRRDIVFAASLYL"
     gene            <732998..734379
                     /locus_tag="CNI02720"
                     /db_xref="GeneID:3259504"
     mRNA            join(<732998..733109,733159..733210,733264..733380,
                     733440..733480,733534..733731,733785..733905,
                     733966..734379)
                     /locus_tag="CNI02720"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_572680.1"
                     /db_xref="GI:58271047"
                     /db_xref="GeneID:3259504"
     CDS             join(732998..733109,733159..733210,733264..733380,
                     733440..733480,733534..733731,733785..733905,
                     733966..734353)
                     /locus_tag="CNI02720"
                     /codon_start=1
                     /product="nuclear mRNA splicing protein"
                     /protein_id="XP_572680.1"
                     /db_xref="GI:58271048"
                     /db_xref="GeneID:3259504"
                     /translation="MSSDNTVAPKRKLKPARKQVASDEVDKSQGYQAGREYNIWYNKW
                     AGGDREDALASKVHSQTRCIISRDAGYTRADATGNKYCCLFFARGCCPYGYECQYLHR
                     LPLPSHQLPDNSRDCFGREKHADYRDDMGGVGSFNRQNRTLYIGKIQESPDKKQMTET
                     LLRHFGEWGKIVKYNILFGRGVAFVTYETDHQASFAKEAMANQSMDGDEILNVRWATE
                     DPNPGEKVAEEKRIEEIGQKAIAGMLDENLVEATQAVRALEDGDVEDFYHIETSKPEE
                     EEENRPAKKGKSEGGFFNADALDNIKFYAELAKKQAEEEKEKARKVPAKQVGMSLLGG
                     YGSGDESD"
     gene            <735864..>736883
                     /locus_tag="CNI02730"
                     /db_xref="GeneID:3259661"
     mRNA            <735864..>736883
                     /locus_tag="CNI02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_572678.1"
                     /db_xref="GI:58271043"
                     /db_xref="GeneID:3259661"
     CDS             735864..736883
                     /locus_tag="CNI02730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572678.1"
                     /db_xref="GI:58271044"
                     /db_xref="GeneID:3259661"
                     /translation="MLNLCREYGLEASWEPVKVAATWTTSFVVYQQVQEASSEGGASE
                     DPKESKIRQVIISCGSNDFGELGSSTPLTLSGTPSPIHVSQASQKPTLVDAGLKPGER
                     VQMIKGGQRHVVVVVGGLKGQRIVGWGASRKGELSAATLSSVNAAGPSNKAKGKSKAN
                     LYSPTSPPTLIDLPLQPGQHVIDIALGASHTLALLSDGSVLGWGSNLKGQITGVHELG
                     NVKAIAATWGGSYFLTSDGVYSQGSNTHSQLLRGQASSERGKINIPGGWQAKKIVAGT
                     EHLLVLARKDGQEDVLFSGGWNEHGNLAMGDERDRDALERVELKGKVLGLWGGCASTW
                     VWVEA"
     gene            <738573..742070
                     /locus_tag="CNI02740"
                     /db_xref="GeneID:3259448"
     mRNA            join(<738573..738734,738784..738897,738946..739626,
                     739693..739813,739937..740401,740563..741626,
                     741686..742070)
                     /locus_tag="CNI02740"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41560166|gb|CF706007.1,gi|41560172|gb|CF706013.1"
                     /transcript_id="XM_573010.1"
                     /db_xref="GI:58271707"
                     /db_xref="GeneID:3259448"
     CDS             join(738573..738734,738784..738897,738946..739626,
                     739693..739813,739937..740401,740563..741626,
                     741686..741937)
                     /locus_tag="CNI02740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573010.1"
                     /db_xref="GI:58271708"
                     /db_xref="GeneID:3259448"
                     /translation="MSAGSSTTLTSTEEKAKEVRALGSGGSSRNRLGRSVTDVVKAKS
                     SSSIRMESRHSVDRSLGSAGSRLERSITDGAKTRSSTSQKPLREHHYQASDHLPVPCI
                     ASHEPHPTETTINRAARLPLPPSYASTGHQSKSTAGSTVGSVRSRETTIIPQYQPSSS
                     EVIISRAAREPLPPSTIAETIKLPISAKTAASGSAALPVRVPTDATIIQAGTTPLPAS
                     TIHAHTSYTAPIQPTPSQVPLLPSMKPHTDLPYLASPLPSPGPLPDPTLTHRQQMPLP
                     RPALTPRPSNDALDVNLMDVKSNRGEGSLMTKFESANGPDNGVKTVRMPKAEIVEIKM
                     KAPSKKEAIIAPQPSITRQTSQHSVALTSHQRQPSTRDLRRQPVDSPVSTLQYLNVPG
                     SLRSCHGNGSGSGKDHSMGSANGSPHPTFIFSPQTNSQRSGTYRSNEDQVSFEVPQGS
                     RRRLRVTLKWLKDGSRRESSTNDGTSQREGNVRSEKPPAVPPKELPRQKESYKSKVSR
                     QTSHRDENKPMHENRKQYLNPTNPAFNPILNPYYAGAPLPPYNPTQVYNVRMPFAYPL
                     PQPPGMWGCRPLDHGQSSEKNPKQSSELPGKESVDPPSEKMSLMMADGGMPSIRGLGM
                     RLGTGVGAAAVGAYPQPQGQREQYSWQQRSNVFQCMFNRDPYQPNHHRNVNHEDEELP
                     SEDIHAWRHKIPSDLGQAHTAAPTNRPSANLRPAIANTFGPGTAYDFVPPGRAPNTWW
                     KRLRPRRQIDVQSTKNKPRLPDLARLSPSHNIQQNLPRTHGDIPPQNAPYVRDRFREK
                     EEKRRQRAAKRHKRQRRMTEQTKSAGLSSEALARTDARDWPKGMGNDQLRGRSRTMIK
                     DWVTKVRGSGKIQPPPKSGPATEYVPWRSRLIIKDPGVARLHRQSSQARRADGSPQQQ
                     RMQNSSNVPLNALKMGLSLGGRNQNVQNGQENGQRMRK"
     misc_feature    742137..742162
                     /note="AT_rich"
     gene            742234..743856
                     /locus_tag="CNI02750"
                     /db_xref="GeneID:3259659"
     mRNA            join(742234..742445,742501..742972,743020..743170,
                     743222..743423,743478..743650,743716..743856)
                     /locus_tag="CNI02750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572885.1"
                     /db_xref="GI:58271457"
                     /db_xref="GeneID:3259659"
     CDS             join(742339..742445,742501..742972,743020..743170,
                     743222..743423,743478..743650,743716..743792)
                     /locus_tag="CNI02750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572885.1"
                     /db_xref="GI:58271458"
                     /db_xref="GeneID:3259659"
                     /translation="MVAAAPSNKERLPDMMTSIRLDQSGRVEIIDQLLLPHSVVWMPV
                     STPEEAFDAIKTMRIRGAPAIASLAALTLRSYLSSSSSPVSSSSSSSDVISWVGQTID
                     YLQSSRPTAVNLGEAMDRIRAALKDSEAQNQTAGDIIQRVKKICGDVHDEDLERNMKM
                     GRLGAEWLWKKRGGGKKGLKVMTVCNTGSLATSGYGTAIGVITALFQEDHLDTAYYAQ
                     TTPYHQGSRLTSLELTTLQIPACMICDTMLGSLFQHEDIDGVIVGADRVVKNGDTANK
                     IGTYQAAVLAQRHNVPFMVVAPVTTIDLSLPTGAEIHIEHRPAAEATQVRGLDTETGK
                     LSVVRITPEGVGEGDKPWQRVYNPSFDVTPAELISAVVTEKGVAERKEGEKSIDVASI
                     C"
     gene            complement(743841..747599)
                     /locus_tag="CNI02760"
                     /db_xref="GeneID:3259704"
     mRNA            complement(join(743841..745909,745968..746502,
                     746556..747599))
                     /locus_tag="CNI02760"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41544016|gb|CF689857.1,gi|41560470|gb|CF706311.1,
                     gi|41573870|gb|CF719711.1"
                     /transcript_id="XM_573011.1"
                     /db_xref="GI:58271709"
                     /db_xref="GeneID:3259704"
     CDS             complement(join(743927..745909,745968..746502,
                     746556..747568))
                     /locus_tag="CNI02760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573011.1"
                     /db_xref="GI:58271710"
                     /db_xref="GeneID:3259704"
                     /translation="MSHPARLSLRAPPHLPFVQGFPGIPADLSRQRETPSVQGTLEVR
                     IGSIPVKARWVRVELRKFESLPPGFPTQATEETWELVGSIQTLWQPKDGKEWDTVQTA
                     DFKFILPLPLSLPPSIDLPKGAGVRYELVAALCYRQKGGVFKKESAPIIKVTEPIQIF
                     KHDLHSAWPIYNIPEKRTIKVANDQMELTVSRPCTAFSAGDKVRISTSLKSSRPKPFT
                     LRGFEYTLSEVITYIPLPPGPSSKSKKHKISTAPVTKARPIQTVRAPLNENIVSGGVK
                     SATIEMEVGNVLVTVKGAKTLEVEYDLEVKAIMEGVAEKVEMRGIRSVIGLFSRDHAQ
                     RAVKDIGHYEPLCPDIPGAEKPLPPRTSSIQSQPRTNGIPPSSYIRPNQQSMIQGFTP
                     RNHRRQSSLTSVTTDTTTTATTATHELGAGVGGSNSQRPFHTMPSIQRRTDVVAFPDP
                     HPARPRSTEPKWPVESLMPERHAMSEAGHGADDCSRYSSGTAATFGRWDLGLQTSIMS
                     VHNRTNSDLTQKTPPTPTNPSSSRPPARTSSSSYTYLSAEQEKRRQQELYDNARARAT
                     EVQKASGASLDRIGLGPGGGSPGMLIKSSAEGGVGDEELDDIPPPEYAPPRPPAQGEY
                     VAPIRPISAYTSRPSEHAITSISTPQSSSTAPPSSPSAFDKVYLTIGQEKEAQRRRYE
                     EATSKVVGSSSAAPSTPSKRQAVDAGPIHSPTSPPPFVTSTSSPASSTSLPAAGIASS
                     LSEKEQMKRYYEAQDRVARAAAQKQNGEGGVDGQAGSSGSGLARNEGAGNSIAAIGAI
                     DEKEQMRRYYEAQEKVAAASGSASGSGSNSNSASGGGRVPGIVSGVPSTLNEKEQMRR
                     YYEAQGRVAAAAASASGSENRPSSVPAPATRSVSTPVGVMDEKEQMRRYYEAQDRVAA
                     AATGASGSGNGASHTPSRHSTLSSVPTTAHADIVDEKEQMRRYYEAEDRVAKAAERRA
                     GSASAFASGSSEDDVPPPPFEAYTSSSINGGNGADASHLSAEEEKALMRERYELAQSA
                     VRKNMSSNPIGSTNSQCTLPSRSRSNFDPGSKPFVLPTSSSSVPPTSTPTGRPFSNVT
                     AATMSTPPDSPNLRDPLVKAGKARVTRTGNSDEGHVSGYAGGNGSGNDNGDSSGSRGE
                     SNANLPAGPPPPLPTKPPREYIHLLSPVGE"
     gene            complement(748217..751753)
                     /locus_tag="CNI02770"
                     /db_xref="GeneID:3259759"
     mRNA            complement(join(748217..749424,749482..750119,
                     750175..750501,750561..750755,750946..751753))
                     /locus_tag="CNI02770"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531786|gb|CF677627.1,gi|41531795|gb|CF677636.1,
                     gi|41533617|gb|CF679458.1,gi|41533626|gb|CF679467.1,
                     gi|41534746|gb|CF680587.1,gi|41534757|gb|CF680598.1"
                     /transcript_id="XM_572676.1"
                     /db_xref="GI:58271039"
                     /db_xref="GeneID:3259759"
     CDS             complement(join(748324..749424,749482..750119,
                     750175..750501,750561..750755,750946..751261))
                     /locus_tag="CNI02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572676.1"
                     /db_xref="GI:58271040"
                     /db_xref="GeneID:3259759"
                     /translation="MKVFKTTCLPLVLLYVVFSFPIANASSASDVVQKLCDQLGTVAA
                     CRATIKIPTARVRYGTITLFRINSCKTKKKAFGVSICIPGTEAQQVRTPVGLDIVLTS
                     VDIYTFKAVAKSKSVSESTGAILAKTTKFYACAIDAGLNVQDNKQGLTQGTGALVTNG
                     NVRVFKAAELDLDRYSAFALALAPCFTPAGCQPTTIEGFFQNYLKDSEALILDQVKAT
                     FTPWSTSLDGVANSFSSLSANTKSIADMTTSIQAASTKIVNDFCPDANVCASNTLTEF
                     KKQVESTLDISKQVGEVYDLAKGTVQDAKDLSDLISSTVSFFENLNDLQIETIVVNFI
                     TSGGKSLDELAKSLKVAQRLPNILNSLEAKLPNLQKTIASIVVKGPQFVDSLQGIFTR
                     NWLSDYQGDAATASKIGDQVFAVQKLFEQLIPQATELYSSVTFLANSLGSVEKTGQIG
                     KVDVAVASYQRWTKGSFAMPCLTTGKITFSILSFKTVVDYPKFYRCVQEYNIPFPNQH
                     IPYVRLTLPQDSTLAKLGQDTKGATTSITWSGAKPSANGQANSSVASAASSSFSSSAS
                     VVSSSAGISPSEAASSATVTSSADISPSETSASTTVTSSADTSPLEAAPSAAISSSSD
                     SSSSDATPSVVVSSSTATPEDISSSLTTASTFNSPPAIDTTRRRAARRRAIPYDRRQE
                     GAEDEDDPVPVDIDITLAAPALSGYATDSTMLSVPTTSVAYSEVVEGDTTRSVEIPVP
                     TNIQITAIETAAEPGPTSITLASETYNIYSDVTETELETVMSSWSALGTVSVDMATPT
                     EEIDSGGQSAIASSSSASAFATATASNAAGKSKGGAWGEAGVSLVVMGTIGGIAFEAI
                     WL"
     gene            <756114..>756505
                     /locus_tag="CNI02780"
                     /db_xref="GeneID:3259468"
     mRNA            join(<756114..756201,756261..>756505)
                     /locus_tag="CNI02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_572674.1"
                     /db_xref="GI:58271035"
                     /db_xref="GeneID:3259468"
     CDS             join(756114..756201,756261..756505)
                     /locus_tag="CNI02780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572674.1"
                     /db_xref="GI:58271036"
                     /db_xref="GeneID:3259468"
                     /translation="MSDVSTAITTITSSTGTDDISDDFGKKWVWLMVAAVIFIIVFGL
                     VFAICRKYHKRGRMTVWGRNSHCRNCGEKMAGEAGTAQNLEKLWCWKVKTYYCDVCVR
                     NERKNGIV"
     gene            757069..759317
                     /locus_tag="CNI02790"
                     /db_xref="GeneID:3259753"
     mRNA            join(757069..757907,757957..758179,758242..758526,
                     758579..758857,758912..759012,759079..759317)
                     /locus_tag="CNI02790"
                     /product="vacuole protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530140|gb|CF675981.1,gi|41530147|gb|CF675988.1,
                     gi|41538005|gb|CF683846.1,gi|41538013|gb|CF683854.1,
                     gi|41544176|gb|CF690017.1,gi|41544182|gb|CF690023.1,
                     gi|41544388|gb|CF690229.1,gi|41544401|gb|CF690242.1,
                     gi|41550282|gb|CF696123.1,gi|41550287|gb|CF696128.1,
                     gi|41557405|gb|CF703246.1,gi|41557417|gb|CF703258.1,
                     gi|41561959|gb|CF707800.1,gi|41561972|gb|CF707813.1,
                     gi|41562249|gb|CF708090.1,gi|41562261|gb|CF708102.1,
                     gi|41568167|gb|CF714008.1,gi|41569332|gb|CF715173.1"
                     /transcript_id="XM_572887.1"
                     /db_xref="GI:58271461"
                     /db_xref="GeneID:3259753"
     CDS             join(757110..757907,757957..758179,758242..758526,
                     758579..758857,758912..759012,759079..759168)
                     /locus_tag="CNI02790"
                     /codon_start=1
                     /product="vacuole protein"
                     /protein_id="XP_572887.1"
                     /db_xref="GI:58271462"
                     /db_xref="GeneID:3259753"
                     /translation="MSSDESKRPAKPAEIPRRALSSSRLSFRAFFPLLGLLMVLVYQN
                     YPDISSAIITRLSRNASLAERPTTEQLAIVEQDVPLPDSARCPIQPEPLNVGEDWNPL
                     EDSVYADLAVKRLSKAIQIDTVAYDDMPMDTSDPAFDKHLVFARFIEHEYPKLISNLK
                     HEVVNNHGHLFTWEGSNSNLKPIMLMAHIDTVPVPPETLGQWKYLPFEGAITQDGTPD
                     TPGTWIWGRGSSDCKNSLLGIYGAVERLISEGYKPKRTVIISNGFDEEVGGARGAATM
                     ANVLEERYGKHGIAFLVDEGVTGILEYYGASVALFGMAEKGSVNVKVKVESLGGHSSV
                     PPRHTGIGVISRILTKLEDNPFPPILTPETPFFKFLACMSEYAPLVPEFIKTKIKHPK
                     EWPMLAHGLAARDRILNSFLATTQAIDLISGGVKYNALPEYTEATINHRIAFTSSINE
                     TLQHIVDLVLPVAQFLNFTISPFDGSPKASDFHISLEAPYSLEPAPITPSDSKSFELM
                     AGTTKHVFGKGTIVSPSGMFANTDTKRMWNVTKNIYRFSPALVTESVGMHTVNERISL
                     NAHLTTTRFFYKLIRNSEGWVNDDE"
     gene            complement(759352..761523)
                     /locus_tag="CNI02800"
                     /db_xref="GeneID:3259717"
     mRNA            complement(join(759352..759761,759817..759947,
                     760004..760076,760134..760449,760505..760655,
                     760710..760884,760940..760983,761036..761133,
                     761193..761523))
                     /locus_tag="CNI02800"
                     /product="tartrate transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41549596|gb|CF695437.1,gi|41549606|gb|CF695447.1,
                     gi|41553194|gb|CF699035.1,gi|41553205|gb|CF699046.1,
                     gi|41560128|gb|CF705969.1,gi|41560137|gb|CF705978.1,
                     gi|41574062|gb|CF719903.1"
                     /transcript_id="XM_572657.1"
                     /db_xref="GI:58271001"
                     /db_xref="GeneID:3259717"
     CDS             complement(join(759410..759761,759817..759947,
                     760004..760076,760134..760449,760505..760655,
                     760710..760884,760940..760983,761036..761133,
                     761193..761445))
                     /locus_tag="CNI02800"
                     /codon_start=1
                     /product="tartrate transporter"
                     /protein_id="XP_572657.1"
                     /db_xref="GI:58271002"
                     /db_xref="GeneID:3259717"
                     /translation="MGVTKASPLVPFISLAKRLPFFTDKKMSAQGDHIKHTESVVSDV
                     QKPEDTEAAEMDVERRKTIEKSLVRKLDLRCSLFILLYIMNYLDRNNISAARLKGLQS
                     DLNMTDTEYSTCLSILYVGYILMQIPSNMIMNRISRPSWYIGGAMIIWGMISTCSGVT
                     TSFGGMVATRFMLGFVEAAFLPGALLILSKWYTRKELTLRNAILFGGNLISNAFASLV
                     AAGVLSNMEGTLGHAAWRWMFFIEGAATMFFACLCPLILPDLPTNTRGFTEEELEVAQ
                     LRLLEDVGEADQDSENDGVFAGLIMAVKDVKIYLMMITLTAYVVGLSFNAFFPTLTGT
                     LGFGYVPTLLMSAPPWVFATLVSFAVSWHADRTQEKFWHITIPILFGMVGFIISMATL
                     NTAGRYVALFLQAQAYAGFIVFYSWISSSFPRPPAKRAVAIAMVNAFSQLGNIAGSYV
                     WNLSENGYRKSYGIVLAMFGISIAGCFVFRMILVNLNKKLEAGEAAWEAKEDVTDKSQ
                     KLEHFEQEDEALKMRKGFRYLV"
     gene            765420..766577
                     /locus_tag="CNI02810"
                     /db_xref="GeneID:3259606"
     mRNA            join(765420..765468,765542..765751,765798..765890,
                     765936..765995,766037..766087,766140..766178,
                     766225..766326,766373..766427,766479..766577)
                     /locus_tag="CNI02810"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41569003|gb|CF714844.1"
                     /transcript_id="XM_573003.1"
                     /db_xref="GI:58271693"
                     /db_xref="GeneID:3259606"
     CDS             join(765438..765468,765542..765751,765798..765890,
                     765936..765995,766037..766087,766140..766178,
                     766225..766259)
                     /locus_tag="CNI02810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573003.1"
                     /db_xref="GI:58271694"
                     /db_xref="GeneID:3259606"
                     /translation="MPKDPFTAIQESLDDARPQLTALISGALNAQQTRVLLKLLDAIQ
                     KAVHNYVKSRKNKKKKDGDGDSRGAEQVKIDWLDTEGVHLWNLASQVNRATPTTPELS
                     KDELSTFSALRLTGFRLVEAATDIRGPTTFVVRLLGLTAKTMTALLDTYGKSAIPARS
                     RVRTIDHFLNYH"
     gene            768612..769939
                     /locus_tag="CNI02820"
                     /db_xref="GeneID:3259671"
     mRNA            join(768612..768713,768763..768800,768856..769035,
                     769080..769154,769204..769231,769272..769465,
                     769513..769580,769630..769720,769774..769790,
                     769846..769939)
                     /locus_tag="CNI02820"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41549297|gb|CF695138.1"
                     /transcript_id="XM_573005.1"
                     /db_xref="GI:58271697"
                     /db_xref="GeneID:3259671"
     CDS             join(768617..768713,768763..768800,768856..769035,
                     769080..769154,769204..769231,769272..769465,
                     769513..769580,769630..769720,769774..769790,
                     769846..769873)
                     /locus_tag="CNI02820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573005.1"
                     /db_xref="GI:58271698"
                     /db_xref="GeneID:3259671"
                     /translation="MSIYDVIETSGATDPDLHFIRGSAMFACLCGKIFFCRDLSNGPD
                     KVLLLDQLLDYVPHCREALSSVKSTHPRWPVVTHMRRIIDTSEIELHCESKEWTAIPP
                     VLERMKKAHANGEISETNQTLEMMANVLFQYEGCPSHITYQLLELILDTCPTVYAKDI
                     KRYSRWMRAILRILLHRNGAEEEAESLKYAEKALDVLKTSLGKNAYPLDEIQWLVATS
                     WNKGLEWFSSSRVSQAKAWCEIAMTIATGTPELNIDRQKMNEHYEHLLSKINC"
     gene            771324..774371
                     /locus_tag="CNI02830"
                     /db_xref="GeneID:3259562"
     mRNA            join(771324..771584,771636..771764,771811..771946,
                     771992..772683,772736..772855,772925..773133,
                     773204..773328,773388..773553,773619..774371)
                     /locus_tag="CNI02830"
                     /product="nuclear pore complex protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41556357|gb|CF702198.1,gi|41556369|gb|CF702210.1,
                     gi|41575936|gb|CF721777.1,gi|41575944|gb|CF721785.1"
                     /transcript_id="XM_572655.1"
                     /db_xref="GI:58270997"
                     /db_xref="GeneID:3259562"
     CDS             join(771412..771584,771636..771764,771811..771946,
                     771992..772683,772736..772855,772925..773133,
                     773204..773328,773388..773553,773619..774295)
                     /locus_tag="CNI02830"
                     /codon_start=1
                     /product="nuclear pore complex protein"
                     /protein_id="XP_572655.1"
                     /db_xref="GI:58270998"
                     /db_xref="GeneID:3259562"
                     /translation="MVAERTPYSSFASLLAAYQEQYSQAGPSTQLDSPISHEAVLDEQ
                     SGLIISLMESLEETIRSKTPTNCSSFEMDGEEQISEDEYKALLSEHRAWQLIRAVYDN
                     RIPRTDPNFVPPSAAQQIIENPYTSPEDLVQTMVIEDPELSLWATLVEHLQTRPLLTS
                     PPPLEARHGYLPSTVRRSKFHSTTDSPSLDPDFTVRDPHSSSLAGEDQTYQLPLLETL
                     YNLVRYGELESAIKVCEQGGEPWRGASLMGVRRWTMGGMSKGTEPTVMTGNRYRALWK
                     KSCRTIAKNHTLLPAERNLYAAMISDLPTLLPACESWEDYLWAHVQHRIEARLEKRWR
                     ELGGFWEGEGGVGKDDVEEVEMAKGGLEEVFASMRNLQNASISITMTEPYHVAQQMIL
                     LDRTEALFHGFADQLLELESGVSPELIAPLLRFFTHLALILRTLSQPVPVSAANAIIQ
                     AYLQILEREGNDKLVAMYAACLREGSGEESYARFLWSMDPSAGRDSRSEALLRAKKHN
                     LDVALIARETVRLCLEEVVADPPKRLLAEPDIVPISIGLTEHDVVLIRSIEWLIILPE
                     TADDALVRSCQLVRYFLSKGQANAAQSLLLSLPSLPTSSSLTNQSHLLELASYNRLFS
                     LFSSHTYFADILFRQPSLTASKLEVHAWKKDLEACVEDVWKGTVGLIKERWLDLPSLS
                     PKVEKDGKGLYEYEGEEERQKQLKLIRHIFIPDLVLRLHNTLIEQSVLFPYFLQRALE
                     LASIVADGRYRVYEGFLPLATIAGGAEMVGGGEKGVSRLEVYMDKIREVALEVLKSGN
                     GNAFKVRRLA"
     gene            complement(774421..777336)
                     /locus_tag="CNI02840"
                     /db_xref="GeneID:3259400"
     mRNA            complement(join(774421..775409,775465..775519,
                     775572..775888,775935..776017,776068..776197,
                     776253..776445,776496..776733,776785..776878,
                     776933..777003,777057..777336))
                     /locus_tag="CNI02840"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545989|gb|CF691830.1,gi|41546002|gb|CF691843.1,
                     gi|41572183|gb|CF718024.1,gi|41572186|gb|CF718027.1"
                     /transcript_id="XM_572908.1"
                     /db_xref="GI:58271503"
                     /db_xref="GeneID:3259400"
     CDS             complement(join(774545..775409,775465..775519,
                     775572..775888,775935..776017,776068..776197,
                     776253..776445,776496..776733,776785..776878,
                     776933..777003,777057..777203))
                     /locus_tag="CNI02840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572908.1"
                     /db_xref="GI:58271504"
                     /db_xref="GeneID:3259400"
                     /translation="MAAPRRSAGVTSSSGYADVAELEKYKLISNIGKGSFGVISKVQR
                     VSDGKEFALKQLDYSKMTEKDRKQILAEVAILDSLKHRNIVQLIQKIKDPKNERIYIV
                     MEYCTSGDLGTLIRRAQRNNSSLPEDKIWNIFLQIVLALHHCHWPAERPANTGGRQSV
                     VAPSTDGGVARYQVLHRDLKPENVFLSDEFVKLGDFGLSKDMGTASFTSTYVGTPLYM
                     PPEILAENRYDTKSDIWSLGCLVYEMCALHSPFSAAQTQAELITMVKSGKIPPLPARY
                     SPALRSVIKAMLTLHPAKRPSTKDLLEMPEMKLHRKLFTVQNQTSLLFAKRDELKQFE
                     DQIRARAVALDEREKELAGREASLQAREDLCDSREEEAKETQRKLNQAAESLRGQWER
                     FREEKEQWERYRELEEEAKETAFGVTDVPDEKCQPHTGAVGIARPPLEERNTAPASPS
                     VSRFTRCLDTPSKIPLATAAVSPAPLAPLEARFSTSHFQPRPATPLRRAATKSMGNLA
                     GVVRAQTAQEWAGATQSTPAKQFSFPIRQQRISIGSPSELQSVCCEDVSMISAIPSPW
                     VPRPRKSSVAPSIVVAQQECPASGESFSTGNNRLASVAPTQIPAPTFIYREAATPAKW
                     SFDDPDLPSPFIRRPNSMPTQPQAASFPPSSNMVGMRQPLGSINPQATITAPSALGSP
                     VAKKIPSRSGNLHQHVLKVNAARVSGEGVAPSVAPVGVVRGRTGNRIG"
     gene            777562..>779213
                     /locus_tag="CNI02850"
                     /db_xref="GeneID:3259789"
     mRNA            join(777562..777957,778006..778213,778262..778756,
                     778809..>779213)
                     /locus_tag="CNI02850"
                     /product="ATP-dependent RNA helicase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533732|gb|CF679573.1,gi|41533746|gb|CF679587.1,
                     gi|41545124|gb|CF690965.1,gi|41545135|gb|CF690976.1"
                     /transcript_id="XM_572889.1"
                     /db_xref="GI:58271465"
                     /db_xref="GeneID:3259789"
     CDS             join(777611..777957,778006..778213,778262..778756,
                     778809..779213)
                     /locus_tag="CNI02850"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_572889.1"
                     /db_xref="GI:58271466"
                     /db_xref="GeneID:3259789"
                     /translation="MPSPSPEASSSMSQPGPPSRSPSPASSNPDAPEASHNKTFADLG
                     ISPELCRACASMGFKKPSDIQAEAIPHALEGKDIIGLAQTGSGKTAAFSLPILQTLWE
                     NPQPFFALVLAPTRELAYQISQQVTSLGSGIGVRTAVLVGGMDMMSQSIALSKRPHII
                     VATPGRLMDHLENTKGFSLKSLKYLVMDEADRLLDLDFGPIIDKILKVIPKERNTYLF
                     SATMTTKVAKLQRASLNKPVRVEVSSKYSTVSTLLQHYLLLPLKNKDAYLLYLANELS
                     SSSMMIFTRTVADSQRLSIILRRLGFPAIPLHGQMTQSLRLASLNKFKSGGRSILVAT
                     DVASRGLDIPLVDLVINYDMPTNSKDYVHRVGRTARAGRSGKSITLVTQYDVEILQRI
                     ESHIGKKMTSFDVDKEAVALLTDTVAKANREAALEMRESGTGGGGGKRGRDKGKRKTF
                     GDGDDRDRDDDVVEAGVPRKKNKFTPGGKKKARK"
     gene            complement(779268..782382)
                     /locus_tag="CNI02860"
                     /db_xref="GeneID:3259496"
     mRNA            complement(join(779268..779631,779697..779852,
                     779907..780329,780382..781693,781741..781798,
                     781848..782076,782128..782382))
                     /locus_tag="CNI02860"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539326|gb|CF685167.1,gi|41539336|gb|CF685177.1,
                     gi|41576060|gb|CF721901.1,gi|41576069|gb|CF721910.1"
                     /transcript_id="XM_572933.1"
                     /db_xref="GI:58271553"
                     /db_xref="GeneID:3259496"
     CDS             complement(join(779371..779631,779697..779852,
                     779907..780329,780382..781693,781741..781798,
                     781848..782076,782128..782367))
                     /locus_tag="CNI02860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572933.1"
                     /db_xref="GI:58271554"
                     /db_xref="GeneID:3259496"
                     /translation="MEIASAAWKNKEKQFTQKSHQIASLWGVSSVVRPGILDSTLWTV
                     KDGLFMCTCKNKHSEEDYEVEDKIVAALEKGMMAADANLDEVGKALEKQRIPKRMATI
                     AWGMERHSDEFSWDKEGMRVRHISLDQVAECSNMGLEELSTIDTMSLKCPNKHRRFAY
                     ICRVLTKPKVEDGIVFHVEDPDGLSLPVIIKFPTSTPCYSLSIKTILEELYSVGTILA
                     IKEPAVRYGKRGGYVICVDIPTNIVEIHPKDKLASRFAKIPPAVPVQDLEWESVKDLG
                     NKALKNKNPIIAAKYYTSALADPAVKGSPSRQLLLYLNRAQALLDQKLYGTAYRDCLK
                     AEKLVAEPKAKASQPQCAKLYWRMANSAYGLRLWQSAEQLADKCSHYPESSYQLPELR
                     RKLERRRKEWEKGEYDWTSLFHEVHLSNASHLDVADYQGPIHCRIIPGRNTRGLVLSD
                     AVKAGDLLLVSKAIITTHATDVGNAILPCVDNSNEDYIPPSTYTAINRAVHRYIDDPF
                     MGQLFAGLNLGKNGVNIGTNPLPQWTCCNDSRLSELIKPVETINLRMIRQAIAMNKVF
                     GFSVPYKATDNPVKVDEIRQWPLMLFATPTLLNHSCKPTASLTYWGDVAVVRALYDLP
                     KNCELTVERFDINATYAARLDISFSENIRCSCMLCKSDAKTEYDLRCRLVEEVYPKLL
                     EDFTMDTSHPFDAKSERGFCRAKEWIRSWMQLERKVMSTYGDANKWLRTDLAPVRKGL
                     AKAWYLIDMKKGIETEMRLFEGLGCVWSSREQRLKHGRLLERICPTKDNLIIFLLTSA
                     AHYAKLQPLNRAYVSLWVRTALWAHQIIYGGNIELFKKRFAEKLPPDDMIDWEWTDEV
                     KKNGDGIGTLPRPNVALNGIGVNGKDHVRKFFNSTA"
     gene            782720..786287
                     /locus_tag="CNI02870"
                     /db_xref="GeneID:3259371"
     mRNA            join(782720..782901,783017..783111,783169..783561,
                     783618..786287)
                     /locus_tag="CNI02870"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530537|gb|CF676378.1,gi|41530550|gb|CF676391.1,
                     gi|41551196|gb|CF697037.1,gi|41551209|gb|CF697050.1,
                     gi|41554098|gb|CF699939.1,gi|41554103|gb|CF699944.1,
                     gi|41559890|gb|CF705731.1,gi|41559893|gb|CF705734.1,
                     gi|41570947|gb|CF716788.1,gi|41570959|gb|CF716800.1"
                     /transcript_id="XM_572654.1"
                     /db_xref="GI:58270995"
                     /db_xref="GeneID:3259371"
     CDS             join(782853..782901,783017..783111,783169..783561,
                     783618..786197)
                     /locus_tag="CNI02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572654.1"
                     /db_xref="GI:58270996"
                     /db_xref="GeneID:3259371"
                     /translation="MATHVPDSGPLDVYFRDELEGQKQLSETLGGELEAGTEGQTCLS
                     LRNTQVESQATPTKYRQQPSALSLSGICEQSQAPEDTFAEQFKYRICSSGLLEKDYVP
                     GLSGVSGADAEPIKPDWPGQMRKWMIKWKGRWDVLAAGACLLVGLVMRLGVVKFAGLL
                     LVLALVAGNYVWYLRTPTLSPCLPTNSTESPKDQTLSSLTTFLAQSDSLNATMMSSLE
                     ILQPNSETGDNSHELRLALHRLTDNMTDHIATATSTLLKMTDRNKLGVLGEMYDIPVV
                     GSSFYSRRRANESFSSDGEQADQTVPSPRRTPVRPLSTPSPSRIPQAGSLRRYGHSGR
                     SQHMSIMSMPDPNDRFTQIPERTPRLSKRASQERATSRKSWNPENIHHERRIMEADEK
                     ADNSFVSAQSSEEGDKTLVQALRGSLSPDPNTSPELSMSTPTTPVTPITKRRPISTSF
                     KHIPSPLSRRLSQVSETGLIPLRTAPLAYRSRTNSSSLLPSPFETDFPSSPIRPTEFS
                     ARVLGSSDDDPGRKRRSLQNMPYYPSSENDHLSGADLTRTRSMPISDLQTLRSAQSTG
                     SRPRRSSVNRDLTSAGLGLGLPNIFLPDKRSSFASVSSPLSRTAIKRINSVSPLTTPA
                     LTASSLGIHLKRRRMACCLLGLRFEESNNMYWEEISSTLKELSRKIKEEREVVEDVLR
                     KVRKNMAIKEALDDLVGGHSGFSDMGISTVEATFPFPTILNDQQRDFAPKTSDQQLLV
                     EHIDKMTSSMVKAWGELANLRSTLGREGEGETSERWAKVRKSLGEVIREWERGREVSS
                     RMDERGQEEALGNDEVEEESDEVQEPKMPDFLRAWEDTSTSRSTSLETDRQSFINKVH
                     LAEHLSTSPHHDDSSVVLDQLPPPGKDTVFESVSAPLPRAKAILNGMTREERIKLMRE
                     VREKGVNIEDLLGVAEMRKDEDARKRGGELVSELERVIDVIRKMKEPEFEGEYKKTVK
                     TDAQTEQPSLASSSLISSILAPMTPSPTPSSGPHLSNTHLQFDLGELKRSFRFPAAGE
                     GGNDHVLG"
     gene            complement(786372..790994)
                     /locus_tag="CNI02880"
                     /db_xref="GeneID:3259498"
     mRNA            complement(join(786372..786722,786778..786881,
                     786939..787099,787156..787284,787344..787423,
                     787500..787711,787780..787994,788051..789853,
                     789900..790033,790095..790163,790213..790555,
                     790612..790821,790875..790994))
                     /locus_tag="CNI02880"
                     /product="oxysterol-binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531231|gb|CF677072.1,gi|41543426|gb|CF689267.1,
                     gi|41547265|gb|CF693106.1,gi|41547269|gb|CF693110.1,
                     gi|41549935|gb|CF695776.1,gi|41549945|gb|CF695786.1,
                     gi|41552994|gb|CF698835.1,gi|41557458|gb|CF703299.1,
                     gi|41559538|gb|CF705379.1,gi|41559550|gb|CF705391.1"
                     /transcript_id="XM_572653.1"
                     /db_xref="GI:58270993"
                     /db_xref="GeneID:3259498"
     CDS             complement(join(786488..786722,786778..786881,
                     786939..787099,787156..787284,787344..787423,
                     787500..787711,787780..787994,788051..789853,
                     789900..790033,790095..790163,790213..790555,
                     790612..790821,790875..790929))
                     /locus_tag="CNI02880"
                     /codon_start=1
                     /product="oxysterol-binding protein"
                     /protein_id="XP_572653.1"
                     /db_xref="GI:58270994"
                     /db_xref="GeneID:3259498"
                     /translation="MSAPMPITPRRASPEKTSKLSTSTSSNSNLSLSAPPSALYNFRL
                     LSALRSEDASEVQQFLNQLKAAGGTEEQMEKAGQMLGMAVRVASIPVITLILNSPNVS
                     SPNLPTGTGTPSTPLHVASELGRVDIVQLLLSDPRIDDTIKDDRGRTPLECAASPEVA
                     SVIEESRAQLQSKYMALLSQYVSSPLNSPGESASLAKFLDLPRMGVVNLNALDGRTGT
                     SLLHEAARRRDLRLVELAVKKGADVFVRDKRNKRVLDGEKNADDRIKMFLRQFNNQDS
                     LVEAKSDGRPPDHRGFLSKWVNYRSGWRTRWFVLENGVLSYYRDREDEAVACRGSIAM
                     AVATLHSSSDGTRFELSSKVSSAVPKFIVKSVHRAEIARWIQTIKLNIEYYQNGPGAE
                     GQGTGPPLPRRSASLKVHDNAATAVNSLPPSDQFLSPTLQRTATSLSGASIGSVKPPS
                     ESSNTRITGTHPESLAFEKDDSDHSEDDDQPSTEVIPYENAYELGVLNIKEQIDLTLQ
                     LVDSIVVPPSAPPSSGRDTSTSARQAAVKDALRQSLSTMSSLVLKQNAMSHDRERYFT
                     SRIQREIQARQLWEENMLTIAKQQAEFEQQLNDAAKVNEKKKKALRQAKGVLAGLSGV
                     SVPTSPAELGEPRASIDQGILGPASTTGTGETLSPFSKTTFTSAGPPISSTTPTAPSG
                     ALSPPSIPNIKEAHDAIVAAESGDEDDDTDEFFDAIEQNQLPNLKLYDSIAHPERELP
                     GTPVTPGTPGIDRGVGIVADAGGEAEEGAVQDSKLVRQQSVPAKGTIEEYLARQSLEP
                     YLHVRHKLPIDDDKRPSVSCELFYYTDKYRKGVGLRGAHVIVWSILKSSVGKDLTKIS
                     FPVSFNECTSMLQRMAEDMEYDACLTVAASEKDSLRRIAFVGAFAMSNYSSTIGRIAK
                     PFNPLLSQSFEYAIPNRYRYISEQVSHHPPISACYSEAPKWKYYGEVDAQNKFQGRSF
                     EIRPTGVAHAELIIPQEWINPSLKYPDAGSEYGPGLVKEHYSWKKVTTNVSNFIMGSP
                     IIDHYGDLVVTNHRTGETCTLTFKPRGWRGRDAFEIKGNVKDADENVKWDIAGRWDTQ
                     LIAREASAETLPLESDMNVNQAQKEYILLWRNSEKPKAPFNLTPFAITLNDIPKGLGE
                     YLCPTDCRLRTDQRAFENAEYDRAQGLKTLNEEKQRNTRKLRAEGKLPPHEPRWFNAT
                     VDDDTRERLWEPKRAENGEVAFWSVREKKNWDAAGIEHIFASDEA"
     STS             788831..789656
                     /standard_name="Hind19"
                     /db_xref="UniSTS:470711"
     repeat_region   790062..790087
                     /rpt_type=tandem
                     /rpt_unit_seq="ta"
                     /satellite="microsatellite"
     gene            791307..793178
                     /locus_tag="CNI02890"
                     /db_xref="GeneID:3259770"
     mRNA            join(791307..791535,791594..791931,791985..792106,
                     792165..792270,792325..792415,792478..792744,
                     792834..792888,792964..793178)
                     /locus_tag="CNI02890"
                     /product="structural constituent of ribosome, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530938|gb|CF676779.1,gi|41530949|gb|CF676790.1"
                     /transcript_id="XM_572652.1"
                     /db_xref="GI:58270991"
                     /db_xref="GeneID:3259770"
     CDS             join(791390..791535,791594..791931,791985..792106,
                     792165..792270,792325..792415,792478..792744,
                     792834..792888,792964..793107)
                     /locus_tag="CNI02890"
                     /codon_start=1
                     /product="structural constituent of ribosome"
                     /protein_id="XP_572652.1"
                     /db_xref="GI:58270992"
                     /db_xref="GeneID:3259770"
                     /translation="MSDMFRKSVLNKLPHLPPTRAPWADESEPIEEIDEEDEQLDGIG
                     EFKPATMGPSKHDTQDYSPLSASTFFAQAAEVQPPSTPCTFRVYLTPPNLSIASANAG
                     TPPGPSGLRTQQQTNRHGTYLVCHHGGGASGLGFAPLAREVKAKGNGEMGVLAFDCRG
                     HGKTSTSDPNLELDLSHDTLLSDFMAIIEMMFPDPKESPSLILLGHSMGAAPVVSAAP
                     ELQKKGYTIPGVVVLDVVEGTAVESLPLMKSVLSKRPESFRSVIDAIYWHVTSNSIRN
                     VESARVSVPHIIVPAPSSSSSDPSANPGGKQVWRTNLVGTEPYWEGWYKGLSQRFLRT
                     KCARLLVLAGQERLDRELMVGQMQGKFQLEVMSDVGHYLHEDNPAGLAATLITFWHRN
                     TRVLVLPPKIGAPGPGARGGPVEVKQVGQQ"
     gene            complement(793145..794168)
                     /locus_tag="CNI02900"
                     /db_xref="GeneID:3259532"
     mRNA            complement(join(793145..793498,793590..793926,
                     793997..794168))
                     /locus_tag="CNI02900"
                     /product="expressed protein"
                     /transcript_id="XM_572907.1"
                     /db_xref="GI:58271501"
                     /db_xref="GeneID:3259532"
     CDS             complement(join(793226..793498,793590..793926,
                     793997..794157))
                     /locus_tag="CNI02900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572907.1"
                     /db_xref="GI:58271502"
                     /db_xref="GeneID:3259532"
                     /translation="MPHASTSRHTESTQLYNLREPPPCRNDAVTPALFIPVHAVHEGL
                     KRRKVRLIGQILHFNNRKSILIITSHPSARKPTATAAQSPTLLADISIPLLANSPSVR
                     DVTDVLGTAVFSRLSKSFLPPESEEDKRMVRMKGLVGREMVSIRRGEWVNLVGWLEDG
                     KDAVRKIQTFGPYAPPPPLILEVIHISNSRPLPTPIPKLRGEIDGWNGQLTAISPDTP
                     KAAMKGMAKQTAEGCEEKKDESWDEVTPKPKRMRQISS"
     repeat_region   793557..793576
                     /rpt_type=tandem
                     /rpt_unit_seq="taaaaa"
                     /satellite="microsatellite"
     gene            <794795..795522
                     /locus_tag="CNI02910"
                     /db_xref="GeneID:3259429"
     mRNA            join(<794795..794968,795039..795160,795221..795287,
                     795342..795522)
                     /locus_tag="CNI02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_572891.1"
                     /db_xref="GI:58271469"
                     /db_xref="GeneID:3259429"
     CDS             join(794795..794968,795039..795160,795221..795287,
                     795342..795410)
                     /locus_tag="CNI02910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572891.1"
                     /db_xref="GI:58271470"
                     /db_xref="GeneID:3259429"
                     /translation="MPSSSSAKDKEEKLKAKRKEYLKKSDPATVEELVDGKTLVKDYF
                     KEGEWKPSWAHLEFNGDACLDNILKKSNEGFYVPAGTILPLGASMQPMTVVRYGGYFP
                     EGTSFPGGVLVPMYARMVNLLPKETTKPASKLSEESLCTIQ"
     gene            complement(795841..796520)
                     /locus_tag="CNI02920"
                     /db_xref="GeneID:3259727"
     mRNA            complement(join(795841..795968,796041..796140,
                     796204..796266,796329..796361,796416..796520))
                     /locus_tag="CNI02920"
                     /product="small nuclear ribonucleoprotein E, putative"
                     /transcript_id="XM_572906.1"
                     /db_xref="GI:58271499"
                     /db_xref="GeneID:3259727"
     CDS             complement(join(795913..795968,796041..796140,
                     796204..796266,796329..796361,796416..796442))
                     /locus_tag="CNI02920"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein E"
                     /protein_id="XP_572906.1"
                     /db_xref="GI:58271500"
                     /db_xref="GeneID:3259727"
                     /translation="MSGRKVMVQPINIIFSHLQKHNRVAIWLYDNNDFRIEAYIIGFD
                     EFMNVVLDDAEEVYDCGAKPGKEVPPRRELGRILLKGDNITLIQPVTA"
     gene            796741..797997
                     /locus_tag="CNI02930"
                     /db_xref="GeneID:3259413"
     mRNA            join(796741..797478,797529..797648,797705..797997)
                     /locus_tag="CNI02930"
                     /product="homoserine kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537125|gb|CF682966.1,gi|41537131|gb|CF682972.1"
                     /transcript_id="XM_572893.1"
                     /db_xref="GI:58271473"
                     /db_xref="GeneID:3259413"
     CDS             join(796759..797478,797529..797648,797705..797938)
                     /locus_tag="CNI02930"
                     /codon_start=1
                     /product="homoserine kinase"
                     /protein_id="XP_572893.1"
                     /db_xref="GI:58271474"
                     /db_xref="GeneID:3259413"
                     /translation="MAARKHKIHVPCTSANIGPGFDVCGIALSLSLSLVVTIPSASSG
                     AESLPKIIYTGLDSDNVPLSPYKNLLTRVALYVLRANGITTFPPGVTIEAHNEIPFGR
                     GLGSSGAAVIAGVLLGDLLGNLNLPKSRLLDFALMVERHPDNVTAALMGGFVGSYLRE
                     LSPEDMSAASIPLAEVLPEYPPDAGPDWGKSPPQPPHGIGHFVRFGWAKEIKAIAVSP
                     RFELATAKARGVLPESYSRKDMIFNLQRLAVLTTALARSPPDPDLIYDAMGDRVHQPY
                     RMTLIPGLPKILSTLTPTSHPGLLGICLSGAGPTILALATHNFEAIADEIERIFGDEQ
                     VLVDHKVLDIDEKGSWVEDITEA"
     gene            complement(<798511..>799281)
                     /locus_tag="CNI02940"
                     /db_xref="GeneID:3259415"
     mRNA            complement(join(<798511..798827,798882..799002,
                     799058..799168,799219..>799281))
                     /locus_tag="CNI02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_572651.1"
                     /db_xref="GI:58270989"
                     /db_xref="GeneID:3259415"
     CDS             complement(join(798511..798827,798882..799002,
                     799058..799168,799219..799281))
                     /locus_tag="CNI02940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572651.1"
                     /db_xref="GI:58270990"
                     /db_xref="GeneID:3259415"
                     /translation="MFTSWLLRNPFEFSPDLEVVLPWQKGLDFSRGEYVATQLGGQDG
                     LQMKLDKLRTEVEQARLVSQRLEIAEKKLDRRIEVLKQRQAQVGFVKEIIDSAGLNPL
                     PTRAAQLQTTLTSLQSALIPLDIIPIPTSTGLPPSSGEHTKAWELGRAAYLNWALGKM
                     LPPGVVGESGDAERLERIEQEIEETGPREGMEVLTGSLRDMSQ"
     STS             799939..800100
                     /standard_name="AGC4"
                     /db_xref="UniSTS:470709"
     repeat_region   800013..800036
                     /rpt_type=tandem
                     /rpt_unit_seq="ctg"
                     /satellite="microsatellite"
     gene            800098..803626
                     /locus_tag="CNI02950"
                     /db_xref="GeneID:3259556"
     mRNA            join(800098..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803279,
                     803330..803497,803546..803582)
                     /locus_tag="CNI02950"
                     /product="transcription corepressor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532907|gb|CF678748.1,gi|41554892|gb|CF700733.1,
                     gi|41554906|gb|CF700747.1,gi|41573101|gb|CF718942.1,
                     gi|41573112|gb|CF718953.1"
                     /transcript_id="XM_572650.1"
                     /db_xref="GI:58270987"
                     /db_xref="GeneID:3259556"
     mRNA            join(800099..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803497,
                     803546..803626)
                     /locus_tag="CNI02950"
                     /product="transcription corepressor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532897|gb|CF678738.1,gi|41532907|gb|CF678748.1,
                     gi|41554906|gb|CF700747.1"
                     /transcript_id="XM_572649.1"
                     /db_xref="GI:58270985"
                     /db_xref="GeneID:3259556"
     CDS             join(800183..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803279,
                     803330..803495)
                     /locus_tag="CNI02950"
                     /codon_start=1
                     /product="transcription corepressor"
                     /protein_id="XP_572650.1"
                     /db_xref="GI:58270988"
                     /db_xref="GeneID:3259556"
                     /translation="MKVTKPNWVEHTVGEKKAKTAIYSISVHPDGTRLATGGLDHKVK
                     IWSTLPILDVEAEKEEENPKLLCTMSSHTGSVLSVRWAHHGRFLATGSDDQVIMIWGL
                     DPDGGGRLWGSDEINVENWKALTRLVGHVADVVDLAWSRDDTMLASVGLDSTVWIWDG
                     LTFERLRKLDLHQGFVKGVCWDPVGNYLATQSDDKTVKIWNTEDWSLAETISKPFETS
                     PQSTFFRRLSWSPDGAFIAASNAMNGPVFVAAVIDREGWASDISFVGHENTIQVAAFN
                     PRLFFPEGEPKGRATASSMLALGANDFSISIWRNTLYKPLVVLKDIFGADLMDLCWSN
                     DGYVLYGSSVDGSVCAIQFEPSEFTDLADFSATELVLREYDYKPKRAHQPLAVHSSAA
                     SITNGFGPSTTTSTHVNVLQPKKGKAKRRVDLSNGNINAGPSAGPSRQALRPPPPVDP
                     FSGPIQGFASPSTAQASTARMFEDAHRAFGPGSGSISGTSPRAGDKRKASGSYEDPTR
                     GVRGRGMPVQQPIQQFEVQIIRAPMVAPSPSDAGPSKAYLPYPQVQSILRAQAIGNES
                     RSIYLEARNTSDPKGENVLCYFADGEQRWMDYLPKAALAVTVTKNFCAAACEDGSLRV
                     YSPAGRLILNMKLSGLVYDLQGEDKMLLIITMDCQVRVINVRNGKAFSPPSSIHHLLF
                     PGSSSFHSFDIISCTVRPNGVPVIITSEPQAFAYDASLHEWSTIASPPIAGIQPLPSG
                     PSGPLSVVDQIVAKSAPVTTTEKSNAPWIEESYVMSQFEMKLRGTVLLDSKEEHKHWL
                     LGYMKYLGDENFAERAGEVMKDLIGPVYHQSKPTGWEPKLLGVDKREIAAEVLDVLSK
                     TLQGKNVASVWYDVLDKMKADEGSW"
     CDS             join(800183..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803283)
                     /locus_tag="CNI02950"
                     /codon_start=1
                     /product="transcription corepressor"
                     /protein_id="XP_572649.1"
                     /db_xref="GI:58270986"
                     /db_xref="GeneID:3259556"
                     /translation="MKVTKPNWVEHTVGEKKAKTAIYSISVHPDGTRLATGGLDHKVK
                     IWSTLPILDVEAEKEEENPKLLCTMSSHTGSVLSVRWAHHGRFLATGSDDQVIMIWGL
                     DPDGGGRLWGSDEINVENWKALTRLVGHVADVVDLAWSRDDTMLASVGLDSTVWIWDG
                     LTFERLRKLDLHQGFVKGVCWDPVGNYLATQSDDKTVKIWNTEDWSLAETISKPFETS
                     PQSTFFRRLSWSPDGAFIAASNAMNGPVFVAAVIDREGWASDISFVGHENTIQVAAFN
                     PRLFFPEGEPKGRATASSMLALGANDFSISIWRNTLYKPLVVLKDIFGADLMDLCWSN
                     DGYVLYGSSVDGSVCAIQFEPSEFTDLADFSATELVLREYDYKPKRAHQPLAVHSSAA
                     SITNGFGPSTTTSTHVNVLQPKKGKAKRRVDLSNGNINAGPSAGPSRQALRPPPPVDP
                     FSGPIQGFASPSTAQASTARMFEDAHRAFGPGSGSISGTSPRAGDKRKASGSYEDPTR
                     GVRGRGMPVQQPIQQFEVQIIRAPMVAPSPSDAGPSKAYLPYPQVQSILRAQAIGNES
                     RSIYLEARNTSDPKGENVLCYFADGEQRWMDYLPKAALAVTVTKNFCAAACEDGSLRV
                     YSPAGRLILNMKLSGLVYDLQGEDKMLLIITMDCQVRVINVRNGKAFSPPSSIHHLLF
                     PGSSSFHSFDIISCTVRPNGVPVIITSEPQAFAYDASLHEWSTIASPPIAGIQPLPSG
                     PSGPLSVVDQIVAKSAPVTTTEKSNAPWIEESYVMSQFEMKLRGTVLLDSKEEHKHWL
                     LGYMKYLGDENFAERAGEVMKDLIGPVYQ"
     STS             803850..804646
                     /standard_name="Hind18"
                     /db_xref="UniSTS:470710"
     gene            804064..806468
                     /locus_tag="CNI02960"
                     /db_xref="GeneID:3259630"
     mRNA            join(804064..804485,804535..804585,804625..805459,
                     805509..805677,805730..805926,805980..806187,
                     806251..806468)
                     /locus_tag="CNI02960"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543401|gb|CF689242.1,gi|41546327|gb|CF692168.1,
                     gi|41546336|gb|CF692177.1,gi|41548828|gb|CF694669.1,
                     gi|41548833|gb|CF694674.1"
                     /transcript_id="XM_572912.1"
                     /db_xref="GI:58271511"
                     /db_xref="GeneID:3259630"
     CDS             join(804407..804485,804535..804585,804625..805459,
                     805509..805677,805730..805926,805980..806187,
                     806251..806280)
                     /locus_tag="CNI02960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572912.1"
                     /db_xref="GI:58271512"
                     /db_xref="GeneID:3259630"
                     /translation="MSSDGENEDLAYEDDYDVFDADDVMDDSASEPDDFDVLSPTIET
                     VPSKKPYDVNYTVYDLKEIIGMQKKMIDEVAALLVIPASTAAALLRHFNWNTEKLQEV
                     FWTEPDATLLAAGLSPPSSPSTSTQPLPGSQSGSFECPICFTDYEGKSAQQDTFAMGC
                     GHRFCKTCWGEYLTGKIKEEGESGRIQCMESGCKRVVKGEMVKELAGDKISDRYYNLL
                     NAAFVSDSPNLRWCPHPDCPYIIGCTQAPQRMLNQLVPTVECECGKDLCFGCGYAASH
                     RPVICKIVRLWEKKCADDSETANWLQANTKECTKCQSTIEKNGGCNHMTCKKCKWEFC
                     WVCMGPWSEHGTNWYQCNRFDEKSGIDARDVQAKSRASLERYLHYFNRWANHEHSAKL
                     DTEFYAKTEKKMEQMQDAGNLSWIEVQFAKQAVDAVIRARITLKWTYCMAFYLKRNNQ
                     TELFEDNQRDLERAVENLSYLLEQNIGEPESIAKLRHDVTNQAAYVQKRHEIMMDDTL
                     RGHLEHRWEFTVDV"
     gene            complement(808709..811170)
                     /locus_tag="CNI02970"
                     /db_xref="GeneID:3259699"
     mRNA            complement(join(808709..808905,808954..809193,
                     809254..809633,809683..809775,809833..810062,
                     810112..810608,810659..810886,810939..811170))
                     /locus_tag="CNI02970"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535265|gb|CF681106.1,gi|41535276|gb|CF681117.1,
                     gi|41540792|gb|CF686633.1,gi|41541334|gb|CF687175.1,
                     gi|41574648|gb|CF720489.1,gi|41574658|gb|CF720499.1"
                     /transcript_id="XM_572937.1"
                     /db_xref="GI:58271561"
                     /db_xref="GeneID:3259699"
     CDS             complement(join(808728..808905,808954..809193,
                     809254..809633,809683..809775,809833..810062,
                     810112..810608,810659..810886,810939..811087))
                     /locus_tag="CNI02970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572937.1"
                     /db_xref="GI:58271562"
                     /db_xref="GeneID:3259699"
                     /translation="MNGISEQRSSPKTVFEDLRLSIDPTTIRLALGEKPVKSIDPDGT
                     IAYDETKTPDAKLTEQLERIWNEYPNGLLELTERKLERLPPDEDAVKPQGEGVDEEKK
                     RDPFSMMTYEEMEKLRSEIFLQLNDARNELWFVLELAKTLSSSSSFTTQPPPPPAALH
                     QKKGKAKPAPPAPTTLPSIPGEPPILPPGTFSTTPSDFPIKPPHAQIYELERLLQAKR
                     IALNECQGLIDGAVGELRLMAHAGDRFWKDIRNLKEGEGGRGQWAVVPKPDFGRVGGE
                     GEKAKDVVIPYAIDEAPSGTRARCLAGFDLDPTKKDGLTFGDRHHLRLRATLRDDSGA
                     VISSTPVKVEDQSDVRAMMEAAQMEAFDEDLFNEIRFAAARIPKNETEPQRVSFPVAD
                     KILSFELYDTRSLPSSPTSSICDIIVSSTRLSLLNIHRQRKINLVAPSQNFASPIPSI
                     LLPIIDTLRFRQLCSLVSSTLNGFDRTLRDAGLDSRMEKRMLKDGQDEIKEMRAVLLG
                     KRGAEVLTGEYSLGIDDSYIITINISAPYNTIVYLSSISFPLANPDELSQVVSDDLSV
                     QLLRLASRHLHGKLADEHKKGLYFDSLEEVIRIGETGLLRLSIPASFHTIYGSVESDW
                     ISVQAYDSRQSDITVFAWLDTVTHAIESSLSSNGSTTQVR"
     gene            complement(811392..813942)
                     /locus_tag="CNI02980"
                     /db_xref="GeneID:3259497"
     mRNA            complement(join(811392..811707,811766..812923,
                     812981..813942))
                     /locus_tag="CNI02980"
                     /product="protein serine/threonine kinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538478|gb|CF684319.1,gi|41561137|gb|CF706978.1"
                     /transcript_id="XM_572865.1"
                     /db_xref="GI:58271417"
                     /db_xref="GeneID:3259497"
     CDS             complement(join(811523..811707,811766..812923,
                     812981..813341))
                     /locus_tag="CNI02980"
                     /codon_start=1
                     /product="protein serine/threonine kinase"
                     /protein_id="XP_572865.1"
                     /db_xref="GI:58271418"
                     /db_xref="GeneID:3259497"
                     /translation="MDPPRASSTRSSSSSMPTSSSASASANKLKKFKLDPMSMLLPHE
                     RPGYRGSPAAGRSMPPLHPQFQLQSQPGSPAYFAMLQSQQVQQDSGTQRIGIQTRTTA
                     SVGEQGGKRGEGSGSQIPTQVPVGSQHPAQGVPLSPPASMASTPPSGSWEDSASQWSS
                     MEGVVEGTPAPGQRSQPSRHYAPRMTQNTMRLEDWEIVETLGTGTFGRVLLVRQRPSY
                     RPTPYHPIFPHLYRSRHPFSPSPSTTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSE
                     RIILERVRHPFIVELHATYQDQINVYMLLSYIPGGELFSHLRRAGRFSADVTRFYLAS
                     IVLAIEYLHSQNIIYRDLKPENLLLDRHGYLRIADFGFAKVVQDRTFTLCGTPEYLAP
                     EIVLSQGHGKAVDWWALGILGFEMLAGYPPFFDDHPLGIYEKILRGDIAFPSHVDPYA
                     KDLIRGFLTADRSKRLGNLRGGAKDVMGHPWFAGVDWRSLERKEIGAPIVPRVASMGD
                     SQNFQRYPPPRPQDLPGVFGQTYNTSNDPCGELFSDFSFPGGGSERGSASESTEVLSR
                     D"
     gene            815786..819361
                     /locus_tag="CNI02990"
                     /db_xref="GeneID:3259741"
     mRNA            join(815786..816678,816742..816993,817048..817191,
                     817242..817370,817432..817614,817671..817799,
                     817934..819361)
                     /locus_tag="CNI02990"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41550257|gb|CF696098.1,gi|41563881|gb|CF709722.1,
                     gi|41563887|gb|CF709728.1"
                     /transcript_id="XM_573012.1"
                     /db_xref="GI:58271711"
                     /db_xref="GeneID:3259741"
     CDS             join(815787..816678,816742..816993,817048..817191,
                     817242..817370,817432..817614,817671..817799,
                     817934..819189)
                     /locus_tag="CNI02990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573012.1"
                     /db_xref="GI:58271712"
                     /db_xref="GeneID:3259741"
                     /translation="MTHPGASNLPTTISSSVTGATAVTGGFVQADDSSAPQSNSVVEP
                     GGGLASSPNVPQPGTSINSQTGKPHTAGLTRAQLEAQKAGEVAFQGGQGFAGPGLGSS
                     PNVPKPGTTINPETGKPHTAGLTRAELSAKRAEEGAEQATTESEPPSTTIPTSVKPIN
                     TEAGEPNTGSLPLGDLEGKKAQAIAAATLYAPVIPVASKPAAEVDPADTTQAGALSAK
                     EVEAFKDKGADLLDSAPQTEQVRRGSVNSVAEENKVRRPSDVNGREQAARQLAGLVPD
                     TIETASAGSSTPGQELPGGWGAIKPTPLPGSGPNAPTSLYEDVTEGLGKMGQAAFSVI
                     PSPIKDAFHGPGSPKGRRSSATGLIDQAKAQASKVAEGLQGTIQNTQRRASANFGPDG
                     TIRKQVMNFVDEAFQSTKDASAAEFGFIHSGPHGRVAIVPRVSHPTDEFVGAQPGEHS
                     DGVGALPGTANETGVAVLPEEKKVDAAKAASSETNQGVRPGEAVGVGALADVPVGAVA
                     ASQAGPSNTLPQAKHTTTHADHVAGVAPRTSLPSDEFTGALPGEHSSGVGALPGTVNE
                     AGVAVLPDEKKPSTSGAVAPASITGALANSSSNRDPSSTTVTGTSTSADNSYSLAPPL
                     PATTLGLGAAHGATKLDPDGTPTAPGSTTTTTLSSATTSISPGEKHFASETTHAHERT
                     SSAASMTAIAHGREGKPLDRELAAKESKIAPSPLAESTVAEDRSVVNGKETAAGVTTI
                     GQKSTAPATSHITSLTPGKEDDGVGHPSTHNIPGTSREPGTYPTPDNATNTKAPATIG
                     VAGSKIGQHNVKGPNEPVDGTGTAGEADALISHDDSAKHSNALKPVKDKITDPHDKTY
                     PSDREVADVPDIKTTGEDNTKATKSPAAPGIESAAEKLKTERPTTPTKGTETGPTIPV
                     KGHTEAVDKKSTATAAGTGAAAVGGAGAAGAGTSSTIAPTHKSQSSTDNPVSPTTSTG
                     SGTTPKKKTGFMKKLKNKLAQI"
     repeat_region   818987..819034
                     /rpt_type=tandem
                     /rpt_unit_seq="ctg"
                     /satellite="microsatellite"
     gene            complement(819529..819632)
                     /locus_tag="CNI03000"
                     /db_xref="GeneID:3259723"
     tRNA            complement(819529..819632)
                     /locus_tag="CNI03000"
                     /product="tRNA-Gln"
                     /codon_recognized="CAA"
                     /db_xref="GeneID:3259723"
     gene            819766..821951
                     /locus_tag="CNI03010"
                     /db_xref="GeneID:3259527"
     mRNA            join(819766..820076,820140..820405,820463..821951)
                     /locus_tag="CNI03010"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41539474|gb|CF685315.1,gi|41572311|gb|CF718152.1,
                     gi|41572317|gb|CF718158.1"
                     /transcript_id="XM_572913.1"
                     /db_xref="GI:58271513"
                     /db_xref="GeneID:3259527"
     CDS             join(819825..820076,820140..820405,820463..821918)
                     /locus_tag="CNI03010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572913.1"
                     /db_xref="GI:58271514"
                     /db_xref="GeneID:3259527"
                     /translation="MPDFTPNLHAAHDQIQSLLSHIHSFPTERLMYHAPVLDRIYLPS
                     LDLRSDDKKTGQPRIWRQEDVMGLKKFIEGIEHHEQHIQSMIDSNIPPQEDPLPSVQG
                     LETFWKVVISCKPPVVGVRMPMGRDKGGSWSGAESKGRKVPGNGGHKARKAKEIWVDV
                     LADGGKEWIRIYSKKISHLLAEFREQDSYVNSDFNSDSQTGYHDDNGRQQYNSLLATA
                     RDLRRAASRTPRIPGAPVPKLSLWLTRIPPTPEQLPPEYLDPESTIPEWPDNRIPQTL
                     ATLKEWGVTVHHLSPPPLSQLSGHLVPKTPPPSMKINFDITALLGLCSDVLHYPLPKD
                     SEEAAKRSLRPKNHLIGKGSAVRGRDGTGKGKGKGRREMDAEDEEDEILKGQSQNSRE
                     LYRCILEEMERPWVEEFNAVMTEAWEEHKKLYGMTGDEPQVEFWATKEAAQYTFEALT
                     SGPAHGLGEEQRRMKRMLGYEKGDVFEGSRYEGKEGVLKGFKVKIFDAEALDSGKVER
                     TGFHVSLEAISKAFLDEYYTSLQPPDLAKKSQDKFKSSILPNFLQPKKISAPPVAKIT
                     LPFPVVSLHSLCRGAKEGMTTVMMGTATFKEVWGQSRWKVRGWERAGYNLAPGADREK
                     GSAAVMIFPYRVFGEGKRVRFEKGDYSYPNPSA"
     gene            complement(<822556..>823061)
                     /locus_tag="CNI03020"
                     /db_xref="GeneID:3259763"
     mRNA            complement(join(<822556..822616,822682..>823061))
                     /locus_tag="CNI03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_572647.1"
                     /db_xref="GI:58270981"
                     /db_xref="GeneID:3259763"
     CDS             complement(join(822556..822616,822682..823061))
                     /locus_tag="CNI03020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572647.1"
                     /db_xref="GI:58270982"
                     /db_xref="GeneID:3259763"
                     /translation="MSRSTISSLESQLSTATHELELATFLNKGILQTNTEYKLRIAEL
                     ESENNILRKAETRLAGTEDALEDAEKRIKMLEEERDVWEEELETAKENMESAERDKDA
                     AVRERDHERNQRELWEERFWELRGSKIEERSSTVTERLDAGSEG"
     gene            <823317..824515
                     /locus_tag="CNI03030"
                     /db_xref="GeneID:3259594"
     mRNA            join(<823317..823467,823510..823612,823715..823842,
                     823896..823948,824017..824126,824186..824280,
                     824341..824515)
                     /locus_tag="CNI03030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572645.1"
                     /db_xref="GI:58270977"
                     /db_xref="GeneID:3259594"
     CDS             join(823317..823467,823510..823612,823715..823842,
                     823896..823948,824017..824126,824186..824280,
                     824341..824402)
                     /locus_tag="CNI03030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572645.1"
                     /db_xref="GI:58270978"
                     /db_xref="GeneID:3259594"
                     /translation="MTPAPHDVTATAQATIAVVLLTDQIQAGHPDREMVDGGTGIGSG
                     NRKKMEGARVGGTGRDPMVKRRGKVRELRIGRDMTMMSGESSGLLAKETNTVKGVVVK
                     YNEPAEARKPTKNWRLYVFKGTEQIDLIHIYRQSCYLIGRDEVVTDIPVAHPSCSKQH
                     AAIQYRQMTERNEYGDVATTIKPFIIDLDSTNGTFVNDIEIPKSRYYELRPSDVIKFG
                     TSSREYVLLHEDVSS"
     gene            complement(824498..826346)
                     /locus_tag="CNI03040"
                     /db_xref="GeneID:3259541"
     mRNA            complement(join(824498..825057,825137..825472,
                     825542..825990,826062..826096,826173..826346))
                     /locus_tag="CNI03040"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41567415|gb|CF713256.1,gi|41567420|gb|CF713261.1"
                     /transcript_id="XM_573014.1"
                     /db_xref="GI:58271715"
                     /db_xref="GeneID:3259541"
     CDS             complement(join(824527..825057,825137..825472,
                     825542..825990,826062..826096,826173..826237))
                     /locus_tag="CNI03040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573014.1"
                     /db_xref="GI:58271716"
                     /db_xref="GeneID:3259541"
                     /translation="MAIPLVWLSQQLIPPLLLTYFFISWKVATFELAPSLSLDVLAWS
                     QPDSGNISTFTNGIKRIIAYNILFSLHILPTLLIGFISALYLRLYFLPRSQSVPPYDP
                     PFEVLDKQVMFACLFPRSASRSRSHLELESEFGDVLLITEQEPIVERCYKGRCGGRWK
                     PARTRHCTQCGVCRAGFDHHCPFFANCLTAPYIPTFLAVLLYTPPTVLILSFPLLSPL
                     LHRFIAAYSQACDSSEIIAYWWNWKWSWVVAGGPVGRFAGGIILGWRELDRQDGGGLY
                     RLAVGLLVAFGFILSGITASLAYSTIRILRDGDFTIDRERSSAHRRILSTIKGLPREQ
                     PIPDKLRQNLARFSDRPAFYLPPRDIDRICPGQGQDRKWDCHGRKNPKGYVVQLNDKA
                     RPYDHGPRMNTQLVLGTPWGEGWSWLLPWRAIRPGIEYDGGERCLFNWPVAEGVRQEI
                     EGAIGSGILNRLSEGDHLNCR"
     gene            827591..829444
                     /locus_tag="CNI03050"
                     /db_xref="GeneID:3259735"
     mRNA            join(827591..827618,827746..827886,828562..828623,
                     828676..828814,828873..829134,829197..829444)
                     /locus_tag="CNI03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_572643.1"
                     /db_xref="GI:58270973"
                     /db_xref="GeneID:3259735"
     CDS             join(827812..827886,828562..828623,828676..828814,
                     828873..829134,829197..829243)
                     /locus_tag="CNI03050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572643.1"
                     /db_xref="GI:58270974"
                     /db_xref="GeneID:3259735"
                     /translation="MAPTKKTTTAPKKAASHPPFLTMIQEAISSHPTDSKKGVSRVSI
                     KKYLEDKYKLDMSAAGNTSNLNGAIKRAVEKNELALPGGPSGRVKLVAAAKPKAAEKK
                     PAAKKPAAAKPAEKKTTTKAAPKKAASATTKKATTAKPTAAKAKAAAPAKKTAASSTA
                     AKKTAEKKAAAPKKTKAPAAKKAAAPKKAASKKA"
     gene            complement(<829483..830067)
                     /locus_tag="CNI03060"
                     /db_xref="GeneID:3259491"
     mRNA            complement(join(<829483..829732,829790..830067))
                     /locus_tag="CNI03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_572863.1"
                     /db_xref="GI:58271413"
                     /db_xref="GeneID:3259491"
     CDS             complement(join(829483..829732,829790..830049))
                     /locus_tag="CNI03060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572863.1"
                     /db_xref="GI:58271414"
                     /db_xref="GeneID:3259491"
                     /translation="MLSGLGIDILSLSRFRDFVIRRGADKVAKRICTPGELKRFEKLA
                     RDSVARRIGPESAHSSNTQLEATSSVLGTEDILDRQVRFLSSRWCIKEAAYKSLSPLL
                     PRPPSFKTFELVHSLTGQPTLDIISEAKDKYTLLSSLSHDAGVVVGVVIAIDRTFNLL
                     RKDDVDFSH"
     gene            830266..832520
                     /locus_tag="CNI03070"
                     /db_xref="GeneID:3259611"
     mRNA            join(830266..830341,830413..830782,830848..831101,
                     831159..831330,831392..831656,831733..832327,
                     832391..832520)
                     /locus_tag="CNI03070"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542318|gb|CF688159.1,gi|41542329|gb|CF688170.1,
                     gi|41545964|gb|CF691805.1,gi|41545971|gb|CF691812.1,
                     gi|41557585|gb|CF703426.1,gi|41557594|gb|CF703435.1,
                     gi|41567868|gb|CF713709.1,gi|41567877|gb|CF713718.1,
                     gi|41567934|gb|CF713775.1,gi|41567941|gb|CF713782.1"
                     /transcript_id="XM_572914.1"
                     /db_xref="GI:58271515"
                     /db_xref="GeneID:3259611"
     CDS             join(830322..830341,830413..830782,830848..831101,
                     831159..831330,831392..831656,831733..832327,
                     832391..832502)
                     /locus_tag="CNI03070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572914.1"
                     /db_xref="GI:58271516"
                     /db_xref="GeneID:3259611"
                     /translation="MDEETAYELERQKTIAENRALLDSLGLDPAGASSPFGSSPAPTS
                     NKTKPKPKPAPKKRKAAAVIAVDEGPRRRSGRIAGLEADGDAFKAKVEEEEKEREILR
                     VVSRKEREKVMDVGKMVEDTPEDEIKDMEKYLQSIAELSNPRTYPAGTVSAREAYADS
                     DTVPSEVQRLKDAFKDMSLKGNTKVTNERVFSMCVHPEKTKTLVLVGDKYGQLGIWDA
                     LGPPMEKPENEDDTSGLLRAEGEDEYQEGRVWRVQAHAKNSISCMKVDPVNGSGLFST
                     AYDCSLRHLSFSTLQSTELFSFQDEDLLINHFDLLPSAQEAWMVDKNGGISHWDTRES
                     KRESGRRRWVVQEEGRGAKLGGVSVNPLMPHLICTAGNDQHVRIWDTRHLFSISSNLV
                     PSAAAIEEEEEGTSTLSGQSSSLPHDTHPTRESDYSTVTSYLASPRGKGLMRAKWQHG
                     KSCSSAYWDPWGRRILTTSYDDHLRVFNIDPGSSLVDDRAVGSLLQPNGFKPTKVVRH
                     NCQTGRWLTILRAQWSLNMEYMPHFTVGNMKRTLDVVSATGEKIVGLWTDDVTAVPTV
                     TASHPNIVDRVVGGNTSGRIQLWSSGDHI"
     misc_feature    831672..831697
                     /locus_tag="CNI03070"
                     /note="AT_rich"
     repeat_region   833794..833883
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     gene            834393..835609
                     /locus_tag="CNI03080"
                     /db_xref="GeneID:3259655"
     mRNA            join(834393..834542,834592..834656,834706..835609)
                     /locus_tag="CNI03080"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41553859|gb|CF699700.1,gi|41553868|gb|CF699709.1"
                     /transcript_id="XM_572917.1"
                     /db_xref="GI:58271521"
                     /db_xref="GeneID:3259655"
     CDS             join(834396..834542,834592..834656,834706..835252)
                     /locus_tag="CNI03080"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_572917.1"
                     /db_xref="GI:58271522"
                     /db_xref="GeneID:3259655"
                     /translation="MLSSLLAVPLAILALRPSLVAAQGDLSGANNVTDLEGTWSSNSA
                     VSTGGDICIPAEMKFNYPNNSGISYSFTNDGFFEEVQYQYNANASNPACIQAYIYWQH
                     GTYSLNDNGSMTLFPFTSDGRIQVQDPCAATTNIITYYSNQVLFTDWGIVVDSSSGRY
                     TLNLNKYDGSKMARMFLVAKPPNMLPTQILTGVNASGQTSTRKRSFTQSLDFLKRSSA
                     EPRWSGLLFAQGYPTSFTMLGLAGLAVVGVLALV"
     gene            complement(835592..838856)
                     /locus_tag="CNI03090"
                     /db_xref="GeneID:3259507"
     mRNA            complement(join(835592..836005,836077..836184,
                     836281..836426,836496..836684,836769..836825,
                     836881..836982,837053..837206,837323..837546,
                     837620..837721,837780..837904,837967..838856))
                     /locus_tag="CNI03090"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41554578|gb|CF700419.1"
                     /transcript_id="XM_572935.1"
                     /db_xref="GI:58271557"
                     /db_xref="GeneID:3259507"
     CDS             complement(join(835649..836005,836077..836184,
                     836281..836426,836496..836684,836769..836825,
                     836881..836982,837053..837206,837323..837546,
                     837620..837721,837780..837904,837967..838847))
                     /locus_tag="CNI03090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572935.1"
                     /db_xref="GI:58271558"
                     /db_xref="GeneID:3259507"
                     /translation="MVSLRQRKPQRQYSDIAPGLHDLSDEENSGQGSSSRPPKDDDDI
                     SISSGESSEFKPGSPEKQAAKGAAIDDDEEMEDDEPLRSIHDTHTSPAKRPIKKARSQ
                     SKGKGKAIAPSSVSVTPTVRSSPVPKPSEGNPLSHIPLEYLRLLGQSAKSIVKPPEPA
                     PDAQRQAFETWLKKKKGNSREESILDSPLPFFTRLLKDPQNGSVRPKVEWSPKVESSL
                     TAKQEKKEKRNQLNNIALGVPWDLWRGEGWWPEMYIGPEGGGDGKRTEWLMREDVRLG
                     LENIGRFKKSELVFLAQGDAKPYLPKPPGKNGEPFITCLFGPYEKETPTKLSIFDSKS
                     LSETNPIVPRPGFTFYAGGPIWGLDWCPIPRSKSAEFENTQYLAVSTLSHLSDQPKMF
                     DKCPPETKGSIQIWSLLPPRQSAQEDKDQDQDQDEEDVAMGGEKGGGMACELFDVCKM
                     RDEEIEIPKLGIIAAVQLDGSVSFYPVPHPKFLVSEQSIAGQPVYLHLQKPLVRLTIP
                     DANCTTFDWLSGSRLAVGLDTGHVVVWDIYNSLLHPSSEPPLPVIYTPVAMSCIRSLS
                     VLRLPPTPHHLGSDAVYVVTGAYDGSTKILDVRDPLVPIPLDRQRLPIMSTAWSTYFP
                     GPIVGDNQYTAQVVRVADRKGRSRGFVISGHRGVIWDIGTSDYHTMVVTAGADGALIM
                     VNHADGVLRSTGARTITLDRLYEIDYNTLTDTYRLSDDFLPESQPLDIVQYGKPARGA
                     GEGEAGEDANKAYSKIGAWSPEVGIHRCVWNNAGGLGQAGWVASGGASGVGRVEWVEG
                     VWRDVVGGRAKSEKES"
     repeat_region   835677..835756
                     /rpt_type=tandem
                     /rpt_unit_seq="ccca"
                     /satellite="microsatellite"
     misc_feature    837589..837610
                     /note="AT_rich"
     gene            839027..840754
                     /locus_tag="CNI03100"
                     /db_xref="GeneID:3259426"
     mRNA            join(839027..839225,839274..839519,839576..839814,
                     839882..840042,840119..840452,840509..840754)
                     /locus_tag="CNI03100"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41533926|gb|CF679767.1,gi|41533937|gb|CF679778.1,
                     gi|41550749|gb|CF696590.1,gi|41550753|gb|CF696594.1,
                     gi|41556380|gb|CF702221.1,gi|41557172|gb|CF703013.1,
                     gi|41566103|gb|CF711944.1,gi|41566115|gb|CF711956.1"
                     /transcript_id="XM_572641.1"
                     /db_xref="GI:58270969"
                     /db_xref="GeneID:3259426"
     CDS             join(839045..839225,839274..839519,839576..839814,
                     839882..840042,840119..840452,840509..840730)
                     /locus_tag="CNI03100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572641.1"
                     /db_xref="GI:58270970"
                     /db_xref="GeneID:3259426"
                     /translation="MPPRLTRITPRPRMLVLSRPLARPLSSDTRSPSNKITTAPFRLA
                     PADALNKMYINALLASASIPNIVYAFLLRLFGPSVTPLATEFGLGSKLELRGTMKAAL
                     YPAWRVDSILEGKASVDSAGGVAKRLEPKVWISTSEAYVPGNPFAPLSYLSFAVPPLP
                     NDLPIYNPSKHLRQLEDDGLEIVPVPFTVSPLGLGKLIRSRIGQLTRWENLKIDESKF
                     KETMVACYPLLLPIYLAEFEYDQGEDGKRQFTIVMDAHDDNPKNCRVSWPPPPHLVES
                     GRFDKNYYVNPAPFLPNANLTIYPSPGPQPIPGTMRNKLIEAYQTWMSPAPDLENVEH
                     INPSPMVAVQDEEGGVVDWEDERIMSWSGVEREENGEYLEMALRTQKGLETLETMKLV
                     SRRTPDKDLKGLVINTNGPRPHFERKSLADMETQLQRDIEKMKEELEDLKPGWLKSFE
                     AKQQTEKTSE"
     gene            complement(840784..844821)
                     /locus_tag="CNI03110"
                     /db_xref="GeneID:3259613"
     mRNA            complement(join(840784..841779,841836..842583,
                     842628..842815,842868..843238,843405..843508,
                     843695..844456,844509..844821))
                     /locus_tag="CNI03110"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41571102|gb|CF716943.1,gi|41571105|gb|CF716946.1"
                     /transcript_id="XM_572640.1"
                     /db_xref="GI:58270967"
                     /db_xref="GeneID:3259613"
     CDS             complement(join(840851..841779,841836..842583,
                     842628..842815,842868..843238,843405..843508,
                     843695..844456,844509..844781))
                     /locus_tag="CNI03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572640.1"
                     /db_xref="GI:58270968"
                     /db_xref="GeneID:3259613"
                     /translation="MLMELPPLWAQVEPLLVAQSPSSPFAHQTARANSILWNRLRTTR
                     RWETEGGDNNRVCVAIKWPEDGRLRRGKGKMKGKSTVVWVEEGEEDKRLESIILVHPS
                     LIPSFYPTPLPISLLVHQPINLSLAVLQPAFDNPDDRSSSNTSEDIDFSDIWRDSNYP
                     IIRQGAIISCKSGITTNQYKVLMLEPVYQGILTAETNIIISNTFFFADSYPLIQTPLG
                     DGMSEGSFSKTHLSLANFDADAFLSSSLSLSLKDDLPDGEALEDEELMALSSTTSGSL
                     TPRPPGAGVRPISPVAPVEEVLQHEELEDRGVRFNPVVAEGKAVDGGGDDVCWMGVGG
                     LGRAGIFEGDWTCEYHPSLTVPVPLSYSLLIIIKLTSIDCCSNTVCMVRRGDILGIPV
                     WLDKTVTDDERQKSIAAESEDDTDSGSESDSPSPFFSKIPSTPTSIVYFAVTSISYNP
                     LVPIEEDFRSSTTAKARAGELGCWIGDGTELVYEGLEKARIEQKGWDKRWCGIRSNPP
                     PFSRSAYTKLSDILNSAFFQTSTAFRPQLSIIVKGSRGAGKRSLIECIADDIGFNIVT
                     VKVDCYDITGDTPEVTSGTLLARLSKSISCSPSLLVLHHVEALSSKSNSPFGRPPSVV
                     KILEEVIDGARQTSDSSSGSSSSWPVIVVGTTADADAVPSEVLACFKQEIELKAPNED
                     ERLAIMEYKLEDYEVAPDVDTRALARQTAALNAGDINSLVHLAWIAAVKRSTSSCVSF
                     PQAQQAGISITSEDFRHALSKARAAYSDSIGAPKIPNVSWDDVGGLVSVKQDILDTIQ
                     LPLERPEMFGEGLKKRSGILLYGPPGTGKTLLAKAVATSFSLNFFSVKGPELLNMYIG
                     ESEANVRRIFQRARDAAPCVIFMDELDSIAPKRGNQGDSGGVMDRIVSQLLAELDGMS
                     SSRGGVFVMGATNRPDLLDPALLRPGRFDKMLYLSIPTTHTAQASILTALTRKFNLHP
                     DLDIGKIAEQCPFNYTGADLYALCADAMLGAMTRQAEAVDRTIAKLNASASMGEDPSL
                     KTWPGELTSQYYLAKMATKEETEVIVKQKDFEEALIKLVPSVSKEELKHYERVQKEFQ
                     GYAIGKKDSANEVKDKGKGKGKEKGKSVVVNGEAGG"
     gene            <845160..>846628
                     /locus_tag="CNI03120"
                     /db_xref="GeneID:3259719"
     mRNA            join(<845160..845413,845467..846339,846406..>846628)
                     /locus_tag="CNI03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_572919.1"
                     /db_xref="GI:58271525"
                     /db_xref="GeneID:3259719"
     CDS             join(845160..845413,845467..846339,846406..846628)
                     /locus_tag="CNI03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572919.1"
                     /db_xref="GI:58271526"
                     /db_xref="GeneID:3259719"
                     /translation="MAKKKSVNAPISIRPASGKRITFDEDNDASFEFGNEGESSGSST
                     KNVKQDHEDENGEDSDDEAPEAVGINVAHEAERAAAQREATEREAKSKAARARAQAIA
                     NVKQGKRMAQDQAQVKNNGKGKAVVSKPEKKGKQQAESEDESEDEDEDEETRRLRKRM
                     EAAMAQASDEESDLDDDDNDEEQDDNSDISSGSEEELGDQQSFHTDSDAVHFSDEGGL
                     EGYQDDGDESDDSEKLEDLPMDSKSKTMWAQMQAMMEATEKRAGVTSDGVDSGKTEKR
                     AKTQEEKSEERKRKAKEQSENEDKEKSDEEEENDDEAQWDLAPGVKPLPKSVLQAAVK
                     AEEEKKAREAEKKASQKVEQGAEQSRRKKRKIAKVETSRKVSDKTTLHLLPQTLSSAG
                     PAALPPIIDARSRPGGTAPAGKATVNKFYKRAMKNSGVVPGRSPLDGRRRAVSHALR"
     misc_feature    846650..846682
                     /note="AT_rich"
     gene            complement(846868..>848997)
                     /locus_tag="CNI03130"
                     /db_xref="GeneID:3259781"
     mRNA            complement(join(846868..847640,847693..847839,
                     847929..848595,848748..848820,848903..>848997))
                     /locus_tag="CNI03130"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41547032|gb|CF692873.1"
                     /transcript_id="XM_572639.1"
                     /db_xref="GI:58270965"
                     /db_xref="GeneID:3259781"
     CDS             complement(join(847138..847640,847693..847839,
                     847929..848595,848748..848820,848903..848997))
                     /locus_tag="CNI03130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572639.1"
                     /db_xref="GI:58270966"
                     /db_xref="GeneID:3259781"
                     /translation="MLEDEDIAKTGLIYWSANGTTFTCPNPTEFSKVVLPRYFKHNNW
                     QSFVRQLNMYSYVNDIYSTSTDPQAWEFRHSLFRRGEAHLLPSIKRKSSRPSAPDGSN
                     TVTSPTDELPPSTSNPIKPVAGWMRDAVPVPYRMPSPPHIHGQPQRSATYPYSDGFAT
                     RKDDGRSPTRGMAWDPLPAVQRMPPPPDNQIPIRYHPDPNRPVLTTQRFYHPGYPESP
                     LYGPAHSPSAETLLNQMSVLEDKVQKLTDVLNNDRIEHVRNNLDFTSYLLQMIGWAAG
                     DQHTLSRQNADMRHKYEAFMASDALAIMASGGGRERSDSRDSTRERNARLGFEIPPFP
                     GHPHPSITDLRLPQTAQSSSSAILSQRAAPRTSPRNSTSSDLLLTRPSTSESIREREI
                     YPTYFPPQTSHGIGPASSIPSRGPETITPSLYGGGPSVPPPLYRPAPIVEKHREIEKG
                     EEHKDMNGPSTVELGREERDNEDSRMTMAGEEAESKTGLRNLLN"
     gene            complement(<857034..>858207)
                     /locus_tag="CNI03140"
                     /db_xref="GeneID:3259720"
     mRNA            complement(join(<857034..857403,857459..857661,
                     857723..857811,857865..857938,858000..858052,
                     858109..>858207))
                     /locus_tag="CNI03140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572638.1"
                     /db_xref="GI:58270963"
                     /db_xref="GeneID:3259720"
     CDS             complement(join(857034..857403,857459..857661,
                     857723..857811,857865..857938,858000..858052,
                     858109..858207))
                     /locus_tag="CNI03140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572638.1"
                     /db_xref="GI:58270964"
                     /db_xref="GeneID:3259720"
                     /translation="MADQAASLEPFLILARSTKGAAAAKIILDVTAAPGVYVFSELLE
                     MPNIQEVSDASFGGHFQLLQLFAYGTLQDYEENKAIFPLLKEAHINKLRQLTLISLAS
                     QHRSLRYQDITQTLQLKTLRQVEDIVIDTIYAGLLNGKLHHDKKVFHIDWVAGRDVRE
                     EDLAVIQKSLENWCQTAQTLLGALDTEITHLRQEAVNEASKLARYRLHRDEVYETVAN
                     ELRNDKAEKSAKRGTEPGAEFDAQQWSAHGRGYEEQVGSATGAGATFGGKAGQNILQT
                     LAHVGSLGGAFSGRKWVRL"
     gene            858499..860661
                     /locus_tag="CNI03150"
                     /db_xref="GeneID:3259555"
     mRNA            join(858499..859169,859217..859480,859539..859678,
                     859739..860661)
                     /locus_tag="CNI03150"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537216|gb|CF683057.1,gi|41537225|gb|CF683066.1,
                     gi|41550373|gb|CF696214.1,gi|41550378|gb|CF696219.1,
                     gi|41550385|gb|CF696226.1,gi|41550393|gb|CF696234.1,
                     gi|41568955|gb|CF714796.1,gi|41568968|gb|CF714809.1"
                     /transcript_id="XM_572637.1"
                     /db_xref="GI:58270961"
                     /db_xref="GeneID:3259555"
     CDS             join(858530..859169,859217..859480,859539..859678,
                     859739..860602)
                     /locus_tag="CNI03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572637.1"
                     /db_xref="GI:58270962"
                     /db_xref="GeneID:3259555"
                     /translation="MDNHQPLHLAAAVNDIPFIHPALDDPQSFFGSPELDQGPSEDTG
                     RNPEEPTQEEIDAVIEQSLLKAEAQSKSEEEHAEAGIGETQDVQSSDGSTPQLSSHGF
                     HTQAAEFIDQIDQVAGPSSVDHLDVGGPGISEQDPIHNPPVCPAPFIRPDRHDGVTPS
                     PIYYVFTDRTTFNAWLEGESSWCHFVQRRSTTPDKRSAERLQTRIAKHNKKLEAMTPE
                     ERALALPLKTRRRNRVSPVAEKVTYTCHHAGHYSSQHSVELPKEKLRMNTKKSVKCAC
                     PSRIVLSEMQTGECRVCYHWKHEGHDPYNETDKDGGRMNKAIDEWMVSQIAAGRTPDE
                     IRRALDIDEEEKKAYLDKVAADPCQLDPNLPPPIALVRASKFKYSEIYNRYRKLKGPI
                     KESRPPKSDSSRSRGESSKKGKRKPSEAEGEEIDGDQDGKKKRRGRPRKATEGQEEGI
                     ENAEQMHVQEQGSVQRHLSDTDIFIDPELQRSMADPSNTADTSVHLVDSSTGHQMEML
                     PDHRDQSIHTDSFHHQPHGQPPPTSNPDNPLPPQTHSEHEHGTSHTMDLSGLSGLPGS
                     AEEGDDHVDTDFASLAATHESLARALLTLPGGSGLRDEEIAGMSLEEAMRRLAGEVQN
                     AHGDGDLNMAL"
     gene            complement(860674..862891)
                     /locus_tag="CNI03160"
                     /db_xref="GeneID:3259530"
     mRNA            complement(join(860674..860931,860986..861305,
                     861354..862268,862316..862483,862534..862663,
                     862716..862891))
                     /locus_tag="CNI03160"
                     /product="lysine-tRNA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532422|gb|CF678263.1,gi|41532430|gb|CF678271.1,
                     gi|41539858|gb|CF685699.1,gi|41539873|gb|CF685714.1,
                     gi|41540556|gb|CF686397.1,gi|41540813|gb|CF686654.1,
                     gi|41540828|gb|CF686669.1,gi|41543233|gb|CF689074.1,
                     gi|41543248|gb|CF689089.1,gi|41545956|gb|CF691797.1,
                     gi|41545962|gb|CF691803.1,gi|41546999|gb|CF692840.1,
                     gi|41547009|gb|CF692850.1,gi|41555043|gb|CF700884.1,
                     gi|41555049|gb|CF700890.1,gi|41558528|gb|CF704369.1,
                     gi|41560899|gb|CF706740.1,gi|41560901|gb|CF706742.1,
                     gi|41563736|gb|CF709577.1,gi|41565594|gb|CF711435.1,
                     gi|41565603|gb|CF711444.1,gi|41571573|gb|CF717414.1,
                     gi|41571584|gb|CF717425.1"
                     /transcript_id="XM_572931.1"
                     /db_xref="GI:58271549"
                     /db_xref="GeneID:3259530"
     CDS             complement(join(860739..860931,860986..861305,
                     861354..862268,862316..862483,862534..862663,
                     862716..862882))
                     /locus_tag="CNI03160"
                     /codon_start=1
                     /product="lysine-tRNA ligase"
                     /protein_id="XP_572931.1"
                     /db_xref="GI:58271550"
                     /db_xref="GeneID:3259530"
                     /translation="MLRAVIRTATSTRQATTYAPKFKPQIPLRRTFIMSAPAAEANLH
                     KDEVTGEMISKSELKRRQKERQRAAQKAEKAAAAPAAAQPKKQSKADAEAEMDATAFH
                     EMRYKEIAKLRETKQPNPYPHKFNVTHAVPKFVEEWGKEGKLEKGETAQLNEPISLAG
                     RVYTIRESSSKLRFYDLKADGVKVQIMAQAQNAASLEEYLDTHDRIRRGDIIGVTGIP
                     SRTKMGELSLSISSIQLLSPCLHLLPGREGVVDLETRYRKRYLDLIMNPSTRDIFVTR
                     SKVINYIRKYLDAQGFLEVETPMMSMIAGGATAKPFVTHHNDLKLDLFMRIAPELYLK
                     ELVVGGLDRVFEIGRVFRNEQIDMTHNPEFSICEFYMAYADMYDIMDMTEELIEGMVK
                     SLTGGTKLTFHPQGKGEGKKVYEVDFARPWKRFDMIGELEKQLNVKFPPGETLHDDNT
                     NKFLRELCEKHNVDCAEPKTNSRLLDKLVGEYIENQCVNPSFIVGHPQVMSPLAKYDR
                     SRPGLCERFEAFLCTKEICNAYTELNDPFDQRERFMEQVRQKEQGDEEAQGVDETFLD
                     ALEYGLPPTGGWGLGIDRLVMFLTDCSNIKEVLLFPAMRPIVANSVEAVAPSVTATEA
                     AKEAKA"
     gene            <863082..864059
                     /locus_tag="CNI03170"
                     /db_xref="GeneID:3259693"
     mRNA            join(<863082..863219,863276..863436,863489..863850,
                     863911..864059)
                     /locus_tag="CNI03170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572636.1"
                     /db_xref="GI:58270959"
                     /db_xref="GeneID:3259693"
     CDS             join(863082..863219,863276..863436,863489..863850,
                     863911..864014)
                     /locus_tag="CNI03170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572636.1"
                     /db_xref="GI:58270960"
                     /db_xref="GeneID:3259693"
                     /translation="MLGNPLKTLLNNTARFLNPASASSSRAISTAVHLGDLTPAKGST
                     KTDTRYGRGPGSQKGGTSGRGHKGQKARNGKGVRLGFEGGQTPLYRKIPKRGFINFTS
                     KTYAPLSIATLQSWIAQSRISPDEPITIGTIVRSNAVHGLSNLSGIKLLGDADPTLPL
                     PPLKLELSRYSKSAAQTIINAGGEVKAVYHNNLSLRKEWYPEKFMDKEIKSAKPTRKN
                     DILYYTNPAKYGYLAEEVKTPARKMTPQEWSEVKSA"
     gene            complement(864043..>865498)
                     /locus_tag="CNI03180"
                     /db_xref="GeneID:3259646"
     mRNA            complement(join(864043..864754,864822..864927,
                     865005..865155,865213..865285,865344..865423,
                     865494..>865498))
                     /locus_tag="CNI03180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572929.1"
                     /db_xref="GI:58271545"
                     /db_xref="GeneID:3259646"
     CDS             complement(join(864048..864754,864822..864927,
                     865005..865155,865213..865285,865344..865423,
                     865494..865498))
                     /locus_tag="CNI03180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572929.1"
                     /db_xref="GI:58271546"
                     /db_xref="GeneID:3259646"
                     /translation="MNTIREINRINERELELGVKGSWHDEYKDSAYIYVGGLPFELTE
                     GDLITIFSQWGEIMDVNLVRDKETGKSRGFGFLMYEDQRSTVLAVDNMNGTQVIGRTL
                     KVDHTRNYRQQGKRNENGEYEEPEEPIYNAMPPILSGSESSSSEGEQDDLDEEDPMAA
                     FIRAEKKKGAKNIKGNDDDGKKRKHEGETKEERRARKEAKRAKKAVKEEKKRIKKDVR
                     EGNGSERPKSVKSERDERNGRSKDREDSFWSRGKNAAGRDDWRQGKWELEREEEYREK
                     RDERPRERDGDVVKDLMGNDLDRTRGNGDGGSGRERELEGKPRNRGYRREDDRRWHDD
                     RRKDDRDRDRAYNQRDDRDRDHDRGDYGRRNDRERDMRY"
     gene            complement(<866364..>867074)
                     /locus_tag="CNI03190"
                     /db_xref="GeneID:3259579"
     mRNA            complement(join(<866364..866529,866614..>867074))
                     /locus_tag="CNI03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_572635.1"
                     /db_xref="GI:58270957"
                     /db_xref="GeneID:3259579"
     CDS             complement(join(866364..866529,866614..867074))
                     /locus_tag="CNI03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572635.1"
                     /db_xref="GI:58270958"
                     /db_xref="GeneID:3259579"
                     /translation="MSFASSSRIVLARSNIPSIGSTRGVLHRARPPRMPVLPSPHNPK
                     QPLPTSGTSHPVPPNLGTPSVLTTVTALPDSGLTFHHSPPPSAPSYTNGAVPDLFRWT
                     AGESVRLSGEEAAMALGERRWYGGKVDWSGELVQKMRDLRGQGLSRREIGESLQIAPE
                     QQRLISRVAPQSREQASAKVEEFAEHKAKWGYRKRLAREVRQKRKEFW"
     gene            867439..871143
                     /locus_tag="CNI03200"
                     /db_xref="GeneID:3259790"
     mRNA            join(867439..868496,868548..871143)
                     /locus_tag="CNI03200"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536677|gb|CF682518.1,gi|41536683|gb|CF682524.1,
                     gi|41537655|gb|CF683496.1,gi|41537665|gb|CF683506.1,
                     gi|41538627|gb|CF684468.1,gi|41538632|gb|CF684473.1,
                     gi|41541534|gb|CF687375.1,gi|41541550|gb|CF687391.1,
                     gi|41544685|gb|CF690526.1,gi|41544951|gb|CF690792.1,
                     gi|41544955|gb|CF690796.1,gi|41545869|gb|CF691710.1,
                     gi|41545879|gb|CF691720.1,gi|41549312|gb|CF695153.1,
                     gi|41549325|gb|CF695166.1,gi|41551512|gb|CF697353.1,
                     gi|41551515|gb|CF697356.1,gi|41553930|gb|CF699771.1,
                     gi|41553931|gb|CF699772.1,gi|41556143|gb|CF701984.1,
                     gi|41556299|gb|CF702140.1,gi|41556311|gb|CF702152.1,
                     gi|41559607|gb|CF705448.1,gi|41559610|gb|CF705451.1,
                     gi|41561099|gb|CF706940.1,gi|41561110|gb|CF706951.1,
                     gi|41566848|gb|CF712689.1,gi|41572026|gb|CF717867.1,
                     gi|41572035|gb|CF717876.1,gi|41572581|gb|CF718422.1,
                     gi|41572588|gb|CF718429.1,gi|41574059|gb|CF719900.1,
                     gi|41575441|gb|CF721282.1"
                     /transcript_id="XM_572921.1"
                     /db_xref="GI:58271529"
                     /db_xref="GeneID:3259790"
     CDS             join(867768..868496,868548..871022)
                     /locus_tag="CNI03200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572921.1"
                     /db_xref="GI:58271530"
                     /db_xref="GeneID:3259790"
                     /translation="MKIQSKAASLLLLPLLVTSSLAAPNVRRHKPLFRKIYGKRDNGT
                     ETAEVINNSTANVTETVTVSATESSSVTPVASSNSTASSNAAFTGSYSSSFASSSTYS
                     SSIPAPSNSTDTSSIPVNTTDNSTNTASGFDTQQANPANLSSNAISSLLQSTVAFATY
                     TYSVYKPETVTQTEYHTQHSTEVVVSTSTSVSGAQPTSSGNDDESEAESYWDQIQAAA
                     KSYAEHMTGSSLPTMTLEVVLEPTQDADGSWEYIIHIGADGTATASPTWVSSTAAATL
                     SPSGSSSGGSADDRYSSTPITTSADLSGASAATSSYSNPYLQSATNIRAPAATSTSSS
                     SESTSTSSSSDESSSSSADASSSDSSSSDSSDSSSSSSSSEDSGSVSSGTTSSSADES
                     VDTSTDGSSTASSSAGAASASATSDPYAVPGHGSSHFGSNSNSDDRGSSSSSGSGSSN
                     NDDPLSSDQSSSSSSAAESTSTSNPYSVPGHSSSSYGGSSSSGSEGSGDSSASSGSES
                     SEGTTSSPDAQATSTDYNGDAGLDEETQATSTSSNVEGQTTASATSVPFPPWYGGVGS
                     DPDDPSTSSNVTLPGNSTIPENSTYPINSTYPDNSTIIANGSLPTNSSNSSIPLPWTN
                     DTNSSVPGNYSNVTVPAEGANATATSLTGWMNATATSLSTNAAETASATLTLVNGSVA
                     MPTATTTESVSAVANANVSAIQSEIAIPSSSAIVSVEEPTSASASATATASETWSVSP
                     DESVSSTQSEAETETMPVTSSFTAFSSSVTTREAEGTISSYESVLPTSTDSSSSSNFA
                     SVASSTETNSSTPTITSAHSSSTPAPTITSASSVAENEDGMETDYVTSWTTVDYTMTR
                     SPNSTAIATATAAASSDANATASQSTDPVIVSSESLASSSSKGAETETASEVEGSTPV
                     SASVSVSATESASVTESAVGNFAHPVVISSSASSTMSVAESQFESSSSTESASSFATS
                     SVISASSEIVATPTSYSSSYESISEPSSASSAESFTATSTASAEGASETSGADEDGEG
                     DDCDEDGEGSDLTERDDEYEEVWVDEDEIEEGWEILV"
     repeat_region   870400..870451
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     gene            complement(871322..874555)
                     /locus_tag="CNI03210"
                     /db_xref="GeneID:3259533"
     mRNA            complement(join(871322..872612,872660..873236,
                     873291..873448,873500..874555))
                     /locus_tag="CNI03210"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548458|gb|CF694299.1,gi|41548472|gb|CF694313.1,
                     gi|41566253|gb|CF712094.1,gi|41566259|gb|CF712100.1,
                     gi|41570224|gb|CF716065.1,gi|41570240|gb|CF716081.1"
                     /transcript_id="XM_572927.1"
                     /db_xref="GI:58271541"
                     /db_xref="GeneID:3259533"
     CDS             complement(join(871398..872612,872660..873236,
                     873291..873448,873500..874525))
                     /locus_tag="CNI03210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572927.1"
                     /db_xref="GI:58271542"
                     /db_xref="GeneID:3259533"
                     /translation="MSVPYEAHNSPPPPPPKHASSSSSGKKAKQKRPSSSNGTPDQSS
                     ATAVRAFSACRNCRNKKVKCLPGPPLPSSSITLPASPTSLENPGANLGPCQQCLQSGA
                     ECIYPPTRDRAAYSRQYVANLETRVQSLEMVQARLMPLLETFEASTHSGKPMPMPLPP
                     VPARRTETPAQEMNEDVEEGEDEIPEDSAMQPASDSEDAGQITQDDRGNYRWIGSSNT
                     LSLLDSFSGRQLASGRPLPSRTQSSTTQMDAAISRDRTPSNIASTPTRESNPYFGPVA
                     GSGVVKALPPVDEVQYPSAEKSLEMVDAFFQEVHPCLPVLLEHEFRRDFRALMEARAR
                     GNLSWGGGFISVVFAIFALGERVIVTSRAWRREMAKAEGDDDDHETVLPGEAEAGVIW
                     YERAQILHYTTLKDVNIHQVQCLTLLAAFQASVNAMPMSWLLAGQAIRVAQDLGLHRS
                     TARLPLSFAEKQLRSRCWWAIYGLERMMSISLGRPLGVDDLDVDVAYPLEVDDAVLEK
                     MAMENLQALPPEFEKEPEASTMSGFIALTKLCKIAGRVVHLLYRPSNGRSVSDPSWAV
                     QQQNAINKLDKLLRDWLANDVPSKYKDPSETHSVSLLSAILSNSYFTVLVTLHRNFLP
                     SSPDYPRPKPPPSSQSLAHCVDAARSVIHIASQSRTLVPPSHHLAMYCQYLWSSAVIL
                     LLCEIQARDEVVIEAVGSQVEACRKCLQALEPVWPGSKKLKELLNDVASRAKEVMVSK
                     SSDKKRKSSAHKDKDRERQMLHPSQNHQSRPSTDSPIPQHAENQWPSHSVSPPEKRQR
                     VFELSDTRTASNEDEPAQNPQAYYSVYPMTTPITSQASLQFTEPMPTYDMVFDLGGVT
                     FDGLELLQGFSGGASNFWNNFNFGMDGAGNGSASGGSAPVARTGQQFLPSGQLTPNSN
                     GDGSRPSSSSWQGQLSRMVSQNGQQYVQGQGQDGYNGAGSGSGGVGTPNAHRGATFWE
                     QVTGSTFDWQADPNVPFNI"
     gene            complement(875459..>876416)
                     /locus_tag="CNI03220"
                     /db_xref="GeneID:3259540"
     mRNA            complement(join(875459..876076,876131..>876416))
                     /locus_tag="CNI03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_573013.1"
                     /db_xref="GI:58271713"
                     /db_xref="GeneID:3259540"
     CDS             complement(join(875592..876076,876131..876416))
                     /locus_tag="CNI03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573013.1"
                     /db_xref="GI:58271714"
                     /db_xref="GeneID:3259540"
                     /translation="MPIPSRPIPNPRHRQRPTRPGTAVPRKSLSATPQNTADWRAEMA
                     LLPEVGPKSVPMKLSGSMGREAKELSRSVEGKRDVGLERLIMDGRDRRGKRATTATTL
                     GFDFVTNPQVIALSEGEIPNAPDDLVPKPISLLTTTKSASTHPDSTSRALSNTPTTPA
                     LLATRSDSDGEDEDDHGDDDWEHISALSRAEQVEERDENMCSDGEEDVIVLGEMEMEE
                     DMAHLELGPKNKDDKNTKKTVVTKEEKHKSYAAVALGV"
     repeat_region   876391..876413
                     /rpt_type=tandem
                     /rpt_unit_seq="ggatg"
                     /satellite="microsatellite"
     gene            complement(877062..>877970)
                     /locus_tag="CNI03230"
                     /db_xref="GeneID:3259553"
     mRNA            complement(join(877062..877281,877310..877509,
                     877573..877702,877785..>877970))
                     /locus_tag="CNI03230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572634.1"
                     /db_xref="GI:58270955"
                     /db_xref="GeneID:3259553"
     CDS             complement(join(877162..877281,877310..877509,
                     877573..877702,877785..877970))
                     /locus_tag="CNI03230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572634.1"
                     /db_xref="GI:58270956"
                     /db_xref="GeneID:3259553"
                     /translation="MPTATINPALPPEPEQAWIKPTLSNTFGGKTYQPTHPDLFRVEF
                     TASKGLEEDYASRLVAVRDFAPNELITPLTNISLAPEKAYSSVQFGPGPRDHLELNSD
                     LLFMNHSCSPTTEVHLPPLRPNEWAVYATSKGIKKGDSLEFFYPSTEWDMAQGFDCAC
                     GSDVNSFRWKMKICLGKINGAKYASLKELQARGYINEHILALKKAQSKHEE"
     gene            <878115..>878355
                     /locus_tag="CNI03240"
                     /db_xref="GeneID:3259381"
     mRNA            join(<878115..878244,878300..>878355)
                     /locus_tag="CNI03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_572633.1"
                     /db_xref="GI:58270953"
                     /db_xref="GeneID:3259381"
     CDS             join(878115..878244,878300..878355)
                     /locus_tag="CNI03240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572633.1"
                     /db_xref="GI:58270954"
                     /db_xref="GeneID:3259381"
                     /translation="MSIAISLSAAGHPEERSVLIAGTAAGKDEVDDEIWRIRGHRRRD
                     EVEVSRRRPIRARVFIN"
     gene            878435..880564
                     /locus_tag="CNI03250"
                     /db_xref="GeneID:3259742"
     mRNA            join(878435..878647,878709..879401,879457..880149,
                     880207..880564)
                     /locus_tag="CNI03250"
                     /product="GPI anchor biosynthesis-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546803|gb|CF692644.1,gi|41548648|gb|CF694489.1,
                     gi|41548656|gb|CF694497.1,gi|41553410|gb|CF699251.1,
                     gi|41553420|gb|CF699261.1,gi|41558780|gb|CF704621.1,
                     gi|41558788|gb|CF704629.1,gi|41562859|gb|CF708700.1,
                     gi|41575294|gb|CF721135.1,gi|41575731|gb|CF721572.1,
                     gi|41575745|gb|CF721586.1"
                     /transcript_id="XM_572632.1"
                     /db_xref="GI:58270951"
                     /db_xref="GeneID:3259742"
     CDS             join(878555..878647,878709..879401,879457..880149,
                     880207..880524)
                     /locus_tag="CNI03250"
                     /codon_start=1
                     /product="GPI anchor biosynthesis-related protein"
                     /protein_id="XP_572632.1"
                     /db_xref="GI:58270952"
                     /db_xref="GeneID:3259742"
                     /translation="MGDYKLAKEAFVSGNPGASIWSINAVSLVALATYALWIALSPYI
                     RHGLLNNYLICVLPLLLGVTIFSTSPLVFASFLSIISLFFIAKSQKRFNFPRSPEKPK
                     GQWLDESDSDEEPAEPASAAGSAAVSPAKLLPSQVAFASGSLLSTDPTISPMSPSSSS
                     SSGHEDPLGIMGVNRRRSPLEGVSLDVPSHIDSKVRISPVPSLRLKKSRATKVQGVEE
                     KGRLPFLTVYRAHMMLMTVICILAVDFEVFPRWQGKCEDFGTSLMDVGVGSFVFSLGL
                     VSTKSLSPPPPPPTPTSPALNSHIIPLTPSPLSFILISLRKSVPVLVLGFIRLIMVKG
                     SDYPEHVTEYGVHWNFFFTLALVPVLAVGVRPLTQWLRWSVLGVIISLLHQLCLTYYL
                     QPIIFSFGRSGIFLANKEGFSSLPGYLSIFLIGLSIGDHVLRLSLPPRRERVVSETIE
                     EHEQSHFERKKLDLIMELIGYSLGWWALLGGWIWAGGEVSRRLANAPYVFWVAAYNTT
                     FLLGYLLLTHIIPSSISSQTSPSILVPRLLDAMNKNGLAVFLAANLLTGLVNVSMETM
                     YAPAWLSMGVLMLYSLAVSCVGWVLKGRSIKI"
     gene            <882635..>883479
                     /locus_tag="CNI03260"
                     /db_xref="GeneID:3259797"
     mRNA            join(<882635..882892,882945..883203,883268..>883479)
                     /locus_tag="CNI03260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572923.1"
                     /db_xref="GI:58271533"
                     /db_xref="GeneID:3259797"
     CDS             join(882635..882892,882945..883203,883268..883479)
                     /locus_tag="CNI03260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572923.1"
                     /db_xref="GI:58271534"
                     /db_xref="GeneID:3259797"
                     /translation="MFSTTAARTDQPDPNANPIIAPPHIHALLDRLHELSTVQEEAAT
                     AQVIDAEDFDNFMRDKFIALDQDKCWYMYQHCLASGARNVVEKRQAGTSFGVSTIYLA
                     LAVAHNAALTGKPGQVIATENEPSKALQARKNWKEAGDAVLQVIDLREGDLLETLKVD
                     IPKEGIDLLLLDIWAPMAFPTLKLVEPHLRPGATILIDNLKGAASRYEELIEYLHDPQ
                     NGYTNMVLPFSRGLGMSIYTGRKV"
     gene            complement(884071..887075)
                     /locus_tag="CNI03270"
                     /db_xref="GeneID:3259761"
     mRNA            complement(join(884071..884449,884509..884634,
                     884690..884788,884844..885200,885251..885548,
                     885600..886071,886124..886338,886613..886653,
                     886726..886784,886927..887075))
                     /locus_tag="CNI03270"
                     /product="succinate dehydrogenase flavoprotein subunit
                     precursor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534393|gb|CF680234.1,gi|41534546|gb|CF680387.1,
                     gi|41534554|gb|CF680395.1,gi|41535070|gb|CF680911.1,
                     gi|41537805|gb|CF683646.1,gi|41537818|gb|CF683659.1,
                     gi|41544085|gb|CF689926.1,gi|41544098|gb|CF689939.1,
                     gi|41545945|gb|CF691786.1,gi|41545952|gb|CF691793.1,
                     gi|41546115|gb|CF691956.1,gi|41546132|gb|CF691973.1,
                     gi|41550090|gb|CF695931.1,gi|41550733|gb|CF696574.1,
                     gi|41550742|gb|CF696583.1,gi|41551168|gb|CF697009.1,
                     gi|41551179|gb|CF697020.1,gi|41552465|gb|CF698306.1,
                     gi|41552478|gb|CF698319.1,gi|41553715|gb|CF699556.1,
                     gi|41553725|gb|CF699566.1,gi|41553804|gb|CF699645.1,
                     gi|41557723|gb|CF703564.1,gi|41557731|gb|CF703572.1,
                     gi|41558390|gb|CF704231.1,gi|41558395|gb|CF704236.1,
                     gi|41559378|gb|CF705219.1,gi|41559394|gb|CF705235.1,
                     gi|41559728|gb|CF705569.1,gi|41559737|gb|CF705578.1,
                     gi|41560790|gb|CF706631.1,gi|41560794|gb|CF706635.1,
                     gi|41563334|gb|CF709175.1,gi|41565414|gb|CF711255.1,
                     gi|41565423|gb|CF711264.1,gi|41566031|gb|CF711872.1,
                     gi|41566035|gb|CF711876.1,gi|41566660|gb|CF712501.1,
                     gi|415"
                     /transcript_id="XM_572631.1"
                     /db_xref="GI:58270949"
                     /db_xref="GeneID:3259761"
     CDS             complement(join(884308..884449,884509..884634,
                     884690..884788,884844..885200,885251..885548,
                     885600..886071,886124..886338,886613..886653,
                     886726..886784,886927..887031))
                     /locus_tag="CNI03270"
                     /codon_start=1
                     /product="succinate dehydrogenase flavoprotein subunit
                     precursor"
                     /protein_id="XP_572631.1"
                     /db_xref="GI:58270950"
                     /db_xref="GeneID:3259761"
                     /translation="MLALSRTRALARPLRNNFARNYVVASQTARATEAPNFGQKKGYP
                     IIDHEFDAVVVGAGGAGLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNM
                     TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQRA
                     FGGQSLKYGKGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQDGE
                     CVGVLAINMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQ
                     DLEFVQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMERYAPTAKDLASRDVVSRS
                     MTLEIREGRGVGPEKDHIFLQLSHLPAEVLHERLPGISETAAIFAGVDVTKEPIPVLP
                     TVHYNMGGIPTKYTGEVLTIDEQGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIV
                     VFGRACANHIKETLAPNTPHKPMNPELGKESIEDLDKIRNASGPLPTSQIRLNMQKTM
                     QTDAAVFRTQQSLDEGVAKMREVYKSYDQVGIKDRSMIWNSDLIETLELRNIMQNAMQ
                     TVVSAAARKESRGAHAREDYPERNDEEWMKHTLSFQHDPNSPDVELKYRGVIANTLDE
                     AECKPVPPFKRTY"
     gene            887885..891399
                     /locus_tag="CNI03280"
                     /db_xref="GeneID:3259804"
     mRNA            join(887885..888201,888437..888523,888590..888990,
                     889040..889188,889240..889495,889548..889692,
                     889752..889982,890035..890373,890427..890991,
                     891043..891399)
                     /locus_tag="CNI03280"
                     /product="topoisomerase I"
                     /note="supported by cDNAs and ESTs:
                     gi|41534228|gb|CF680069.1,gi|41534233|gb|CF680074.1,
                     gi|41539352|gb|CF685193.1,gi|41539356|gb|CF685197.1,
                     gi|41546812|gb|CF692653.1,gi|41550837|gb|CF696678.1,
                     gi|41550846|gb|CF696687.1,gi|41563230|gb|CF709071.1,
                     gi|41564048|gb|CF709889.1"
                     /transcript_id="XM_572925.1"
                     /db_xref="GI:58271537"
                     /db_xref="GeneID:3259804"
     CDS             join(887983..888201,888437..888523,888590..888990,
                     889040..889188,889240..889495,889548..889692,
                     889752..889982,890035..890373,890427..890991,
                     891043..891296)
                     /locus_tag="CNI03280"
                     /codon_start=1
                     /product="topoisomerase I"
                     /protein_id="XP_572925.1"
                     /db_xref="GI:58271538"
                     /db_xref="GeneID:3259804"
                     /translation="MSFPPVQPADNGMAVVAPNLESNPTTVASHAPQIAVKDENDSMS
                     EDEQPLAKSKANGARKRVENSSDEEEKPLSKKPRANGVNKKRVVASSDEESDVSPPAK
                     RPVSKQSKPATPDSESDDDQPLAKKANGLAASKRQAKKAEELSEESSEEEKPLAKVAK
                     RVSAKKMKSETEDSEEDRPLAKKKAPVKRAPAKKSAKKEPSESEEDEKPLAKNARGKA
                     KAATVKEEKGKKTKKEKEEEEEEERYKWWEQDALGDGSSKWTVLEHNAVLFPPPYVPL
                     PKNVKMKYDGVSLTLPPESEEVAGFFGALLETDYAQDAKFRENFFRDFKAIVEKYPPK
                     EDVKVKKLEKCDFRPMFEYFEKEKEKKKALTKEEKKAIKAEKDKLEAPYLYANVDGRK
                     EKVGNFRAEPPGLFKGRGEHPKKGTVKNRLRPEDIIINIGKEAPIPVPNIPGQWKGIQ
                     HDNTVTWLAHWKENVNGNAKYVFLSAGSAWKGQSDRAKFEKARELIKHVDKIRKDYTA
                     DLKSKVMADRQRATALYFIDRLALRAGNEKGEDEADTVGCCSLRYEHVTLSPPNTIIF
                     DFLGKDSMRFHQEVEVDPQVFKNIKLFKADPKKKGDDIFDRLTTTLLNKHLNSMMPGL
                     TAKVFRTYNASWTFQEQLKNTPKNGTVAEKIAAYNTANRDVAILCNHQKSVSKGFEGS
                     FAKAEDKIRALKYQRLKLRLQLFSLNPKIKKKHPELAEDESDVDDEFMERHEAELLEK
                     ALENAKKKWDTDNVKLEGDGKKKKTKGELDERLSEIKAEFKELKKERKAKKIDAKRGA
                     TEEKLLAQVARIDERIATAKVQLQDRDKLKDVALGTSKINYIDPRLTVAWAKKFDVPL
                     EKLFSKTLREKFPWAEAEAGPDWVF"
     repeat_region   889446..889470
                     /rpt_type=tandem
                     /rpt_unit_seq="ggagaa"
                     /satellite="microsatellite"
     STS             890178..890966
                     /locus_tag="CNI03280"
                     /standard_name="Hind6"
                     /db_xref="UniSTS:470708"
     gene            complement(891983..895523)
                     /locus_tag="CNI03290"
                     /db_xref="GeneID:3259401"
     mRNA            complement(join(891983..892123,892174..892634,
                     892701..893250,893311..893383,893441..893742,
                     893797..893871,893920..894532,894579..894808,
                     894864..895038,895086..895225,895278..895523))
                     /locus_tag="CNI03290"
                     /product="cytoplasm protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41529871|gb|CF675712.1,gi|41550782|gb|CF696623.1,
                     gi|41558614|gb|CF704455.1,gi|41558620|gb|CF704461.1,
                     gi|41572172|gb|CF718013.1"
                     /transcript_id="XM_572630.1"
                     /db_xref="GI:58270947"
                     /db_xref="GeneID:3259401"
     CDS             complement(join(892082..892123,892174..892634,
                     892701..893250,893311..893383,893441..893742,
                     893797..893871,893920..894532,894579..894808,
                     894864..895038,895086..895225,895278..895412))
                     /locus_tag="CNI03290"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_572630.1"
                     /db_xref="GI:58270948"
                     /db_xref="GeneID:3259401"
                     /translation="MNYLKSITTSVLQSTGVTFPFSVGERIPGLDSHSSIWEIREGVK
                     RDDGTPLTLFIYDSTLPLFQPGSKDRKVLFQLAKNALKKLRTIRHPDIIKYIDSVETE
                     THIYIATERVRPLEGVLRDWETGGALASGSGRAKGKENWIGWGVRSLSSALAFLNSPP
                     LSQHHSYLLPTSIFVTPSLEWRLAGFELLTGKDDAGILWGLGGVAPGDIGERCAPEVR
                     KDGWSALRETDPAQHDTYLLAILLFTFYNPHSPLPPLSSQPTPSSSGALPKVLFPLWK
                     RMLNPNPRTRLTTISFIDEAEKAGFWASNPLVSLVNGLDNFELQSESDKLSLLRIIKE
                     ANQAGTLPGPFTTYKILPSLLHSLSLPTAPSSAMLPLVLELGKLVPSSDYPKMVLDPV
                     VRLYTSPDRGTRMALLEGLNEYVDKLDNKTVTEKIWPNLITGFADTVPVIREATVRAV
                     YPLASKLSDRILNNDLLRVLAKMQMDTEPSIRTNTCILLGRLAPILGHNTKKKVLVPA
                     FARSLKDPFVHARVAGLMALMASVECFDREDLAGKVVPNMSFTLVDKEKLVRDQAFKA
                     MNMFVSKLTDMVKDMPESALPPDQTSSQGPVTTTSASISSSQGGAVNSAAGAAGALAG
                     WAISSLGKQLKTSEAHSSMNSSGMPGGFGASAPTIKFSTDSSNPAAPASSRVSEEIFR
                     PASASSSLKSASPRSSAVNTFGRTTTSSSLSGTNGRMKLGGAKKAPGKSLADQLAGEW
                     EEEDGGNAWGTDDLIDVNADDDDWSAFESAPVPEVVVPPPQPYYVSAPKPKPTSTNIT
                     TSAAFRSKPTLSTAISTTSSIPTHAPEPVKLASSISTPLIPSSPALSSLSSAKSPVLI
                     SQANTTDAERGQIDSTPVSERSSPQLSVKAGNGTGTPQPSLANMSKEEKEKEMARRRE
                     ERKARIAAMKEQKKSKV"
     gene            <895880..900424
                     /locus_tag="CNI03300"
                     /db_xref="GeneID:3259499"
     mRNA            join(<895880..899965,900030..900103,900159..900233,
                     900282..900424)
                     /locus_tag="CNI03300"
                     /product="phosphoribosylformylglycinamidine synthase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536326|gb|CF682167.1,gi|41555536|gb|CF701377.1,
                     gi|41558119|gb|CF703960.1,gi|41564741|gb|CF710582.1,
                     gi|41564751|gb|CF710592.1"
                     /transcript_id="XM_572867.1"
                     /db_xref="GI:58271421"
                     /db_xref="GeneID:3259499"
     CDS             895880..899947
                     /locus_tag="CNI03300"
                     /codon_start=1
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="XP_572867.1"
                     /db_xref="GI:58271422"
                     /db_xref="GeneID:3259499"
                     /translation="MLVLPGSSAITSSRRATLLKLFQSVIPSITSVDAVHLHFVNPTS
                     DEAESLLADTQSAERDILNALLAYGDNEQLNSTKAFVDAGMKGDVFALYVLPRVGTIS
                     PWSSKATDIAKLCRLAGHVSRLERGALYLFTSSESISLLEMRHHLHFIHDRMTQLIHT
                     ALPPSAAVFPPTPPNPSALISVPILGAENPHAVLGEANARLGLALSETEIPYLVESFL
                     AAGRNPTDAELFMFAQVNSEHCRHKIFNAKWTIDGHDQENSLFGMIRNTEKAVHSKGT
                     LSAYEDNAAVMEGYEAPRFAVGGKGDGCYTSQIEKNPILIKVETHNHPTAVSPYPGAA
                     TGSGGEIRDEGATGRGSHPKAGLAGYTTSDLLIPDFIQPWESDIGRPAHIASALDIMI
                     EAPLGAASFNNEFGRPALGGYWRTWLMAVKDAEGKEEWRGYHKPIMIAGGLGNVRPQF
                     ARKDKITPGSKVIVLGGPGMLIGLGGGAASSMASGASSADLDFASVQRENPEMERRCQ
                     QVIDACISRGDGAGNPIESIHDVGAGGLSNALPELVHDSGLGAVFEIRDVLVDDPSMS
                     PMEIWCNESQERYVLAVATENLAAFEEIARRERCPFSVVGTATEEERLVVTDRLLGDN
                     VIDISMSILFGKPPRMHREAQTIHPKRDAFDSSLFTYLPAYAGAPKTSLMAESINRVL
                     RLPSVGSKSFLITIGDRTITGLVTRDQMVGPWQVPVADVAVTRSSYGFDVVVGEAMSM
                     GERTPLALLNAGASARMAIAESLTNLAASSVADISQIKLSANWMSAANHSGEGSKLYE
                     AVQAIGMDLCPKLGVGIPVGKDSMSMSMKWPGEKGEQKQVTAPLSLIVTAFAPVDNVE
                     KTWTPVLRTDKGETVLVFIDLARGKQRLGGSAIAQVFKQLGADAPDVEEAADIRAFFH
                     AVQALKKAETVLAYHDRSDGGLLTTLVEMAFAGRSGIEVTVDAISSSGDAVAALFNEE
                     LGAVMQVKVDELSAFSDAFVKAGFPTQHIHVIGKVLGRENQSVSIIHKSDAIYTGTRG
                     QLQQLWAETSYKIQAMRDEPTGAKEEFDAILDDEDQGLIYNVPFKYLPDVTDANRLAS
                     PPKVAILREQGVNGHIEMAWSFHAAGFEAIDVHMSDIISSKVSLSSFAGIAACGGFSY
                     GDVLGAGNGWAKSVLLNPTARKEFEQFFQREDTFALGVCNGCQFFAQLKEIIPGAEHW
                     PIFKANRSERFEGRVVNVKVSPEAAKSNIFFSDMADAIVPIAVAHGEGRPSFVTGSLA
                     GLNENNLIPLRYVDGNGTIATTYPKNPNGGPEGIAAVSTLNGRVLAVMPHPERVVTRE
                     SFSWFPEEMGKTWEGKGPWFRLFQNAYKFATEGKQ"
     gene            complement(<900541..>901167)
                     /locus_tag="CNI03310"
                     /db_xref="GeneID:3259574"
     mRNA            complement(join(<900541..900802,900875..>901167))
                     /locus_tag="CNI03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_572629.1"
                     /db_xref="GI:58270945"
                     /db_xref="GeneID:3259574"
     CDS             complement(join(900541..900802,900875..901167))
                     /locus_tag="CNI03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572629.1"
                     /db_xref="GI:58270946"
                     /db_xref="GeneID:3259574"
                     /translation="MSSNSYQPIPSQSPPVSRSNSPSTSQTTFPPRPNHPFGDEDEEY
                     QERLRGYQAEFNRPPPAWWKRMFLILAIIAMGWLSIYLGKRGMSKKPQVIYASRYSEE
                     FKYRPAASPVITETLSDGRIRIRGASVGGVGVREEDIPLTPAMKAKRDQERREEAREK
                     AREKMGLKTKSKKRGKKGAKKATA"
     gene            <901603..902907
                     /locus_tag="CNI03320"
                     /db_xref="GeneID:3259673"
     mRNA            join(<901603..901680,901738..901856,901911..902098,
                     902137..902226,902277..902587,902644..902907)
                     /locus_tag="CNI03320"
                     /product="vesicle budding-related protein, putative"
                     /transcript_id="XM_572627.1"
                     /db_xref="GI:58270941"
                     /db_xref="GeneID:3259673"
     CDS             join(901603..901680,901738..901856,901911..902098,
                     902137..902226,902277..902587,902644..902877)
                     /locus_tag="CNI03320"
                     /codon_start=1
                     /product="vesicle budding-related protein"
                     /protein_id="XP_572627.1"
                     /db_xref="GI:58270942"
                     /db_xref="GeneID:3259673"
                     /translation="MCLWPLIQSAQASKPVPVETQHEDMIHDAQLDYYGKRLATCSSD
                     RTIRIFNVIKGEAKGEPVILKGHTAAVWQVSWAHPSFGSILASCSYDGRVFIWKEVGQ
                     GQGKGSGGELQDGWERIKEHTLHTASVNSIAWAPYDLGPILACASSDGKVSVLSFQND
                     GSIEVNIFPAHGTGANAISWAPSVLSTVSGVSRSQQPSNSLAPQKRFVTAGSDNLIRI
                     WGFDEEQKKWTEEETIKGHEDWVRDVAWAPNIGLPGMYIASASQDRTVLIHSRPSPSS
                     SWTSAPLLPSLPQSQDPHFPDAVWRVSWSLAGNVLAVSCGDGKVSLWKEGVGKGWECV
                     SDFSS"
     gene            903779..905156
                     /locus_tag="CNI03330"
                     /db_xref="GeneID:3259451"
     mRNA            join(903779..904177,904238..904760,904818..904949,
                     905023..905156)
                     /locus_tag="CNI03330"
                     /product="O-methyltransferase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41566435|gb|CF712276.1,gi|41566443|gb|CF712284.1"
                     /transcript_id="XM_572625.1"
                     /db_xref="GI:58270937"
                     /db_xref="GeneID:3259451"
     CDS             join(903961..904177,904238..904760,904818..904949,
                     905023..905053)
                     /locus_tag="CNI03330"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /product="O-methyltransferase"
                     /protein_id="XP_572625.1"
                     /db_xref="GI:58270938"
                     /db_xref="GeneID:3259451"
                     /translation="MIPRRFPALPQKVYRPFESFDHYIPLFSRIHSSTGRQFQRASAQ
                     QTDETPTSWPANKQKLDMPSDSKKGEINPGPSAGDVDKYLNSKILSPSFGGDPIFKRI
                     SARAQQAGLPNIAVSAQQGQLLTILALSIRAERILEVGTLAGYSTACLVKALPNHGQI
                     DTLEVKPEHAKVAQENFIDADLYPFPKIHVGPAIETLKRMETPDEGPYDLVFIDADKS
                     TTLEYFLESMRLLRKGGLIIVDNAVRSGRIASPEEDSNPDVAGMRKLYDWVHGDDGRS
                     VLMNVTQTVGDKFWDGFAIAIKLN"
     gene            906034..907713
                     /locus_tag="CNI03340"
                     /db_xref="GeneID:3259418"
     mRNA            join(906034..906113,906273..906315,906371..906724,
                     906779..907065,907117..907219,907268..907443,
                     907494..907713)
                     /locus_tag="CNI03340"
                     /product="actin binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551860|gb|CF697701.1,gi|41551870|gb|CF697711.1,
                     gi|41551891|gb|CF697732.1,gi|41551900|gb|CF697741.1,
                     gi|41555101|gb|CF700942.1,gi|41555114|gb|CF700955.1,
                     gi|41567843|gb|CF713684.1,gi|41567853|gb|CF713694.1,
                     gi|41575138|gb|CF720979.1"
                     /transcript_id="XM_572870.1"
                     /db_xref="GI:58271427"
                     /db_xref="GeneID:3259418"
     mRNA            join(906062..906113,906273..906319,906371..906724,
                     906779..907065,907117..907219,907268..907443,
                     907494..907713)
                     /locus_tag="CNI03340"
                     /product="actin binding protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41551860|gb|CF697701.1,gi|41551891|gb|CF697732.1,
                     gi|41555101|gb|CF700942.1,gi|41567843|gb|CF713684.1,
                     gi|41575138|gb|CF720979.1,gi|41575142|gb|CF720983.1"
                     /transcript_id="XM_572871.1"
                     /db_xref="GI:58271429"
                     /db_xref="GeneID:3259418"
     CDS             join(906072..906113,906273..906315,906371..906724,
                     906779..907065,907117..907219,907268..907443,
                     907494..907661)
                     /locus_tag="CNI03340"
                     /codon_start=1
                     /product="actin binding protein"
                     /protein_id="XP_572870.1"
                     /db_xref="GI:58271428"
                     /db_xref="GeneID:3259418"
                     /translation="MDPSLPLVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEER
                     LGTSQLKDIMIGDEAAENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGK
                     KILLTEPPMNPKANRQKMCEVMFEEYGFGGVYVAIQAVLTLYAQGLQTGVVVDSGDGV
                     THIVPVYDGFALPHLTRRLDVAGRDVTRYLIKLLLMRGYAFERTADFETVRGIKEALC
                     FTSYDLEMDKKLAEETTVMVENYTLPDGRVIKVGSERYEAPECMFQPHLVDVEQPGVA
                     ELLFNTIQQAAVDTRTELYKHIVLSGGSSMYPGFPSRLEKEMKQLYLTRVLGNDTSRL
                     KHFKIRIEDPPRRKHMVFLGGAVLADIMKDKDAFWVTKEEWEEQGIRALDKLGRGD"
     mRNA            join(906096..906315,906371..906724,906779..907065,
                     907117..907219,907268..907443,907494..907713)
                     /locus_tag="CNI03340"
                     /product="actin binding protein, putative"
                     /transcript_id="XM_572869.1"
                     /db_xref="GI:58271425"
                     /db_xref="GeneID:3259418"
     CDS             join(906313..906319,906371..906724,906779..907065,
                     907117..907219,907268..907443,907494..907661)
                     /locus_tag="CNI03340"
                     /codon_start=1
                     /product="actin binding protein"
                     /protein_id="XP_572871.1"
                     /db_xref="GI:58271430"
                     /db_xref="GeneID:3259418"
                     /translation="MAIFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYLQVTH
                     PMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKMCEVMFEEY
                     GFGGVYVAIQAVLTLYAQGLQTGVVVDSGDGVTHIVPVYDGFALPHLTRRLDVAGRDV
                     TRYLIKLLLMRGYAFERTADFETVRGIKEALCFTSYDLEMDKKLAEETTVMVENYTLP
                     DGRVIKVGSERYEAPECMFQPHLVDVEQPGVAELLFNTIQQAAVDTRTELYKHIVLSG
                     GSSMYPGFPSRLEKEMKQLYLTRVLGNDTSRLKHFKIRIEDPPRRKHMVFLGGAVLAD
                     IMKDKDAFWVTKEEWEEQGIRALDKLGRGD"
     CDS             join(906445..906724,906779..907065,907117..907219,
                     907268..907443,907494..907661)
                     /locus_tag="CNI03340"
                     /codon_start=1
                     /product="actin binding protein"
                     /protein_id="XP_572869.1"
                     /db_xref="GI:58271426"
                     /db_xref="GeneID:3259418"
                     /translation="MIGDEAAENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHM
                     DPRGKKILLTEPPMNPKANRQKMCEVMFEEYGFGGVYVAIQAVLTLYAQGLQTGVVVD
                     SGDGVTHIVPVYDGFALPHLTRRLDVAGRDVTRYLIKLLLMRGYAFERTADFETVRGI
                     KEALCFTSYDLEMDKKLAEETTVMVENYTLPDGRVIKVGSERYEAPECMFQPHLVDVE
                     QPGVAELLFNTIQQAAVDTRTELYKHIVLSGGSSMYPGFPSRLEKEMKQLYLTRVLGN
                     DTSRLKHFKIRIEDPPRRKHMVFLGGAVLADIMKDKDAFWVTKEEWEEQGIRALDKLG
                     RGD"
     gene            <909105..912410
                     /locus_tag="CNI03350"
                     /db_xref="GeneID:3259622"
     mRNA            join(<909105..909296,909337..909690,909739..909998,
                     910044..910286,910342..910577,910636..910769,
                     910828..912410)
                     /locus_tag="CNI03350"
                     /product="yeast yak1, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534191|gb|CF680032.1,gi|41534200|gb|CF680041.1"
                     /transcript_id="XM_572873.1"
                     /db_xref="GI:58271433"
                     /db_xref="GeneID:3259622"
     CDS             join(909105..909296,909337..909690,909739..909998,
                     910044..910286,910342..910577,910636..910769,
                     910828..912126)
                     /locus_tag="CNI03350"
                     /codon_start=1
                     /product="yeast yak1"
                     /protein_id="XP_572873.1"
                     /db_xref="GI:58271434"
                     /db_xref="GeneID:3259622"
                     /translation="MPPPQTIPSRSGAGSAVDRRSSSAVSKREEEFRDIRGLADLRAV
                     VNALPNGRRADPDAPGKYLSPLKCLTSSLPETYTLCNPSFRYVTSDNPRRVLTKPSKP
                     VHNDGADNEDWDYILYVNDVLGGEDGRDRYLILDVLGQGTFGQVVKCQNMRTHDLVAV
                     KVVKNKPAYLQQSKMEVAILELLNTQHDPQDRHHILRMHDSFTHKHHLCLVFECLSSN
                     LYELIKQNQFKGLSTQLVKVFTQQLLDCLSVLKDARLIHCDLKPENILLKSLQSPQIK
                     VIDFGSACHEMQTVYTYIQSRFYRSPEVLLGLPYSTSIDMWSLGCIVVELFLGLPLFP
                     GTSEYNQISRIVDMLGNPPSHLLEVGKQTHEFFNITPDAYGRNTYKLKPMQQYSMEHR
                     TDEQPSKQYFKQTKLKDVIMEYPYAKKSAKQSDIDKEMATRRSFVDFAEGLLNMDPIK
                     RWSPQQALKHPFITGEKWTGPWQPDATTTAKKLPVSSAESSPSTSTPSKKYGGLVQSP
                     PSSRSQRIYSDAAAYNQQLAQHQSYTAQVQAQQNAQRAGPFSSGYDIAQAQAPAHTHA
                     AGGGGGGSGYGHQRVVSQQMPSTASHHHHAQQRQPSGQWGQQVAPPSSAGYQQRGPSV
                     NNSGSHASLRQPPSNVPVISNPPPNSYYPASRHRANTINQMDAIPPALARLVHFGAQD
                     PNGSRNSLTPVLNRDDAIREWERRQQGGHSKQSSLHNASYPQLEYLQEQAELAAMQGQ
                     NWMMPGPYPPHHGRGHVHRSSLGEQSHGHGHRTNPSGQYQMQPHIGISPSNDYRPRPT
                     SEYDPPSSTSSARGYGLPTYPPLAATTSHPPGGSVSGAVGTGQGVFDAFDGRDGGMGM
                     LYTPLQPNQAYGYQGHAGQHGQGHATRASYSGPYSSSNPFANQPNSPRY"
     misc_feature    912283..912316
                     /locus_tag="CNI03350"
                     /note="T-rich"
     gene            912580..912677
                     /locus_tag="CNI03360"
                     /db_xref="GeneID:3259722"
     tRNA            912580..912677
                     /locus_tag="CNI03360"
                     /product="tRNA-Asn"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:3259722"
     gene            complement(913572..>916994)
                     /locus_tag="CNI03370"
                     /db_xref="GeneID:3259483"
     mRNA            complement(join(913572..915646,915701..915843,
                     915900..>916994))
                     /locus_tag="CNI03370"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530964|gb|CF676805.1,gi|41530973|gb|CF676814.1"
                     /transcript_id="XM_572945.1"
                     /db_xref="GI:58271577"
                     /db_xref="GeneID:3259483"
     CDS             complement(join(913657..915646,915701..915843,
                     915900..916994))
                     /locus_tag="CNI03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572945.1"
                     /db_xref="GI:58271578"
                     /db_xref="GeneID:3259483"
                     /translation="MEDPWATPTWSTPAKPSAKPETTILPSNPWGAPPTPAGPRTATF
                     EDKDKTKSPTGGKALGLSDVVENAWGAESEAATLSLPTLPTSPIRSKVEADPDPGAVW
                     GGDPAPASPVPLPGSPKASSKSAVDLAASNPLPEIPELSASTAAITYTLPRPSLPGEE
                     TAISSRVGPEGDHGAIWGNDPAALLSTPSSEEIAGNLAVNEPTSIISTESSIGPPVSP
                     QASGLQTPISYSPLSKSLGGLGSSSVEELPTPTLPKSPSFGEEFGGFSDFAAPAASSS
                     DPWGSNIKESDNDVWGNDDWDTSLTRSASGVHSIEEVPEERESKVDDEEVAWGAPAVG
                     LGLGTSSATKPKGDDDWEEAQRRIKIQEERAPREKMEELKGLWTKVAESVMAGGVGLE
                     KMTGAEELQYEQTINKVFEDAVESFRSLSTIPPEINTYPPVLSSLVTHERFDYSLQRP
                     NLDPSSSLLSAAARSVRRPKRVDPLSLSLTSNGDASWSSRSRLGEPENQGDGRSEGKE
                     EGNKSRWSLWGRRPASERQLTTSGGGILEVKPMTRTATGDTTQSGPSSDAKPPSIPAS
                     HAASVSVPSRSTSPASSIHQNPITEAQPLPPAKHATAPPPSAVSRFFGRLSRRPSQQP
                     STSTSTPDVDAKDFELSASDFSFLSDIPGVPEQPQGKGVADLLSLEPGANEPIASLEN
                     LLSSKVTDLPKPLAPPPKVSQEPTASTLSGAGRSTSGRFIARMKAPSAPQPNDMDLLG
                     GLDFGSPGGSGSGTPNMLSPTSTGSGLAVRGESDSGLAWDDFAGLMSSGASSGQMGQS
                     ASTNNSPITPSIHSTPAISFSSPPSAAMNVAMSSVPLKFQPQSPAVPKPSTEHISLND
                     DFGDFGDFGSTSNRGVASSAKDNSYDFGDFSSPVSSLAPTSSTKSQSPIQPRLPLGQP
                     SSSSSHSRPPSMSFDHSHTLNLLSGASASKGKRWPAPPSPVPPQLEPPPRASSANGSK
                     GFPFLIPPPPGGSAKRGGDLLGGVEPSTPSLGSSKTTTVAEMGTMGGLNALSPSPTPP
                     LPFTSAPVFSLMGGATLKPSQTPGQGTGSGQGGLSAQDLSFFDSL"
     gene            917138..918278
                     /locus_tag="CNI03380"
                     /db_xref="GeneID:3259632"
     mRNA            join(917138..917783,917837..918057,918148..918278)
                     /locus_tag="CNI03380"
                     /product="expressed protein"
                     /transcript_id="XM_572876.1"
                     /db_xref="GI:58271439"
                     /db_xref="GeneID:3259632"
     CDS             917148..917726
                     /locus_tag="CNI03380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572876.1"
                     /db_xref="GI:58271440"
                     /db_xref="GeneID:3259632"
                     /translation="MPFPSPHLERTRSHSSSLSIARSPNVLASAPFLPPISPISPHDL
                     DQPNPIESHHPFAQNWRSNILGRSVSASGNGRLEAIPSVEDLSAPTTADALLDTEDKT
                     GNYAEDDYDGSASTPLLKPHVHSSDAGGSVFERLSMDLNGIERLEGPSFEYTGPFQPP
                     DSKELLGIILSFVGVLVLAVAAGLATIFDWVL"
     gene            complement(918102..922878)
                     /locus_tag="CNI03390"
                     /db_xref="GeneID:3259809"
     mRNA            complement(join(918102..918326,918397..919478,
                     919537..919821,919953..920084,920154..920480,
                     920528..920809,920871..921102,921167..921802,
                     921861..921966,922027..922878))
                     /locus_tag="CNI03390"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41535487|gb|CF681328.1,gi|41535502|gb|CF681343.1,
                     gi|41543327|gb|CF689168.1,gi|41543338|gb|CF689179.1,
                     gi|41552102|gb|CF697943.1,gi|41552900|gb|CF698741.1,
                     gi|41552907|gb|CF698748.1,gi|41573485|gb|CF719326.1,
                     gi|41574243|gb|CF720084.1,gi|41574251|gb|CF720092.1,
                     gi|41574384|gb|CF720225.1,gi|41574585|gb|CF720426.1,
                     gi|41574595|gb|CF720436.1"
                     /transcript_id="XM_572623.1"
                     /db_xref="GI:58270933"
                     /db_xref="GeneID:3259809"
     CDS             complement(join(918153..918326,918397..919478,
                     919537..919821,919953..920084,920154..920480,
                     920528..920809,920871..921102,921167..921802,
                     921861..921966,922027..922808))
                     /locus_tag="CNI03390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572623.1"
                     /db_xref="GI:58270934"
                     /db_xref="GeneID:3259809"
                     /translation="MSQPPRLPPRKPSPLPQAITITPASALTTPPPLPPRPTTAGSVS
                     RESPPPPILIGESVATASEGTPQLSEEVPRVQVAITPASPDEEPNASNVLEQASQRLS
                     NASNGDLTVNGAGNRDAGPKAAAGNDLLNNDPINEGQASSTNASLFSPNKGMPPAAAP
                     SSRNSSHIPLALSLLKKALSSGLKDLPAMSGTERAIFTTILVLLAHCGLPLTWLMVAA
                     FGGYRLLSQLDGSLPPPTHDASIQEQKEKIMQTGDGVEAVSWVNHALYALFPLISTDV
                     LTPFVDLLEDALVEEVPPIVTSVRLTSPALGSQPLVLTSLRPMSDKEWFASLSSSVTK
                     SDQKTGDKTHSSSAEKAPASPGAEPLKRARHSRQTPSTSSSNLINNGKPPPTQSTPEY
                     SGSDPQVQDEVQKRQKRDRLLHKITHRTPSNLSTDHSKTGQSPETNTTQQHQPQTRSG
                     DCLEDKADKFDGPRIHGGWDEEIDEEDPDSGQYVNYQVGFEYKRGAEATRKGRGLHCL
                     AYIGIGVKGLGKAEIPVYIDVLYVKGVVNLRLLLSPTPPFITTGTFTLPSMPEYDISA
                     NPLKKGAFNAMDLPLMKPYVKASFKSVLSSFLHPQSYTMDIDRLLLGAESSNRTEHIG
                     VLHIIFHGARDLPKADTVGSCDPYLEVGFEKAKKPVFSTRTIGRSMNPVWEEECFICT
                     LADDGMNEVMVAADAIEVGESFRICANDSDRFSADDTLGVVLLDLAELIDSCRQGMTH
                     RVDHFAADRAAKNTSGTLEWSVEFCPVWQMSPEETKERLAQMQREREKYEWESERIKR
                     RTEAKAWLGGKKDREVWEAEVGASEERLSGILQVNLEVESTAGTYATQPRRPAGGPPA
                     LGHVTDRNPNENSDPPSAYCEVHLNDKLVYKTRTKEVTPMPYYNAVSERFVRDWTKGK
                     VVFVVRDARDREHDPILGLVEINLYDILKNTSQITRWFPLTAGLGWGRIRLSLLWKSL
                     EMYIPRGISGYEVGTVQIKSLVFTPMDDRHDDLRVVIRTDSDTRKVRLVSGESGNSSA
                     APAASPSSSRFPTPPSSTEQYTFPPSTHPALAIMYRHSCAIHMSVQSSKSKRRVLGKM
                     KLLGVGVVRLNDVPDGEGSRRVAVWEGVKGEASDWDLDFDGAADTPLDEDSGELLNTS
                     DLTDVDQSPRLNSHPNSLALARVKTSTSKRSSRSIASSSRSSSGQHRLIGYIDVSWVL
                     APGISAIHRKLAKHDLRFAKVFEAWESARDEHYIVHELGDEGNESDSENGEGENTGEH
                     EFADLQDDIVEDMSPRKAHSHALHKRHKGLFQLKIARTGKFVKDKLSATMHNATNHGS
                     SSVHEGYGRRRGADLEVEKEGLSKL"
     repeat_region   923055..923079
                     /rpt_type=tandem
                     /rpt_unit_seq="catg"
                     /satellite="microsatellite"
     gene            <923910..926998
                     /locus_tag="CNI03400"
                     /db_xref="GeneID:3259674"
     mRNA            join(<923910..924724,924776..924863,924891..925363,
                     925417..926998)
                     /locus_tag="CNI03400"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537507|gb|CF683348.1,gi|41537517|gb|CF683358.1"
                     /transcript_id="XM_573015.1"
                     /db_xref="GI:58271717"
                     /db_xref="GeneID:3259674"
     CDS             join(923910..924724,924776..924863,924891..925363,
                     925417..926896)
                     /locus_tag="CNI03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573015.1"
                     /db_xref="GI:58271718"
                     /db_xref="GeneID:3259674"
                     /translation="MNTPASSRQTHSFFHPAMIKPQSRKSWFSFARQNPETIKAEKAS
                     AVSPAELLPPAAASDGVPNSSSNRLSVYNSDPQGYLRPIQFEPNRIATLYVSPSEVNL
                     YLAAMSQLDQSPPPLPLWTDPAPELPRLNPTDPLDVPRLPSTYTITRPTFGLDFWTDS
                     LYNPKPLPGGVYDPPSSTGLLVRDEFRSYSVPKSANHAIIALTPPGEIRFTNFPPSAL
                     LALDNVIRDQWPHGIVKRSLGVVELKERDEKDKIVWTVNLEGKVWKRKGNEELHTIRL
                     VLGILKVLGIHGWTLVESIQAGGSKLNFTSSQKDTHDLLFSYSLKTIRGPPAFFALSI
                     PRKSNPSLFSSAKTDSLAVPDRLSLINPPFKSTPALISALRTSIISASPLKLKQSSNG
                     IIDPNSTDAELLKAAEQGKKKGKVNWQGYDPRGVKLEGWVHDGVYRFWVDGMRRWVGG
                     GLRRKTVENIHPMLVINIVNNLTANHFELAGSVPLLPFTKGRDVLVFQSLPSSGLTAQ
                     DSYDTKQYKYNEAAHPGGPTTAGTQGEKARTSTRPPRPPAATAMTRLRRLSDLTLRRH
                     SSNGESPNRCVRAAPSSGAGINTQEGTPKAKNVLLKKNSTRRKNVLNMPASTADNHVG
                     NGQSKRASAPSFVPSRGHVQGSDDAAGFAQGDAHLRVMNSTSQDRNNWSFVEHPTVLN
                     QEGRAPPIGISRIFPTESLWNAPLALCHNTNRDPIQFGTTQLFVPRGTGHAPDPNLSQ
                     DSGDSMYIDPPVAGEKDRCPSLDNVRIPQANVYSSTTTGIGGFHDFVSSDITQPFRLG
                     HPMGTPSPSIQSRPKISHTIVPAPQFTSLPVNNPNGAATMKDRGSPKRNRPAVVVPDM
                     TGIGRVDSMHGSVGWNGSALSRGSGDHQPHHSSLNNEQSGPGRESQQGSVVMLVNAQG
                     YGGSLQFPGSPTSPTTQAEKVGSARTKVNVGPRHWET"
     gene            complement(927039..929375)
                     /locus_tag="CNI03410"
                     /db_xref="GeneID:3259452"
     mRNA            complement(join(927039..928294,928348..928866,
                     928919..929058,929113..929205,929257..929375))
                     /locus_tag="CNI03410"
                     /product="iron hydrogenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533381|gb|CF679222.1,gi|41533393|gb|CF679234.1,
                     gi|41540866|gb|CF686707.1,gi|41540881|gb|CF686722.1,
                     gi|41549984|gb|CF695825.1,gi|41549993|gb|CF695834.1"
                     /transcript_id="XM_572892.1"
                     /db_xref="GI:58271471"
                     /db_xref="GeneID:3259452"
     CDS             complement(join(927115..928294,928348..928866,
                     928919..929058,929113..929205,929257..929277))
                     /locus_tag="CNI03410"
                     /codon_start=1
                     /product="iron hydrogenase"
                     /protein_id="XP_572892.1"
                     /db_xref="GI:58271472"
                     /db_xref="GeneID:3259452"
                     /translation="MAFSGALTITDLDDFLTPSQACIIPVRNNKKPAEDEGPTEIHID
                     SNNNYYEVSTYPSVGHDDDIGNSKKALEKAEINLNDCLACSGCITSTESLLITMQSQN
                     EILEFIKTNPTVVDPESPCHKPRLPILSISPQTLASLSAAYATASSRPPIPLLVLLRR
                     IRAFLSQPEKGSWRVWDTTFARHMSLRESVVEFHERKDKKEKGKAAEMPMLASACPGW
                     VCYAEKAQGDMLPLLSAARSSQGIIGALAKSWYGHKLQHKPDEIYHVTAMPCYDKKLE
                     ASRSDFYSSLYSTRDVDCVLTTGELDLLLQELGFDPHVPIANESTPSYSATEDSPFPE
                     LLTHEGSSSGSYLQTIIHDVQRSHPNPTRIITREIRGSTDNIEYLIQDTITGQIVFKG
                     AKVYGFRNLQNLVRKVAKETGIGRSGRGAGAGKLSAAVAARRRKAKTAAPAATSATTS
                     AEGTDVESIASLSLVSGEDKKLDFVEVMACPGGCVNGGGQMKPTVPTPSAPEAMEVDE
                     EGYQRPLPDDGVAVAVNGGSNNVGTGTVAGMEEGMRWSTKEWVAKVEDIYWTGLPTPP
                     ASPPLTASNVNGFAPQVKTNGTTNGQVNNGVDRNLQSDQLAEEIIHEVCGDDASKRWD
                     FMRTRFRKVESDVLSSGGVTHEAVKW"
     gene            929605..930964
                     /locus_tag="CNI03420"
                     /db_xref="GeneID:3259489"
     mRNA            join(929605..930130,930198..930375,930488..930964)
                     /locus_tag="CNI03420"
                     /product="expressed protein"
                     /transcript_id="XM_572878.1"
                     /db_xref="GI:58271443"
                     /db_xref="GeneID:3259489"
     CDS             join(929712..930130,930198..930375,930488..930730)
                     /locus_tag="CNI03420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572878.1"
                     /db_xref="GI:58271444"
                     /db_xref="GeneID:3259489"
                     /translation="MNDHLAALNAPPPRYLLESDSSDEEGQGAYPGSSTPKPKVSVET
                     PPVEVLFTRGTGNEEVKDFVLALGQAGKYLKKHLGASGSAIGQEEVGKIVVGGRQAGQ
                     GWKVGEGMVFSVNEADLPHEALWEIADKLFANVKAQSWTIITTYVPAMYISSKTDGSR
                     VRSDPPIRYLSQGEVKVEGAETYETPNYLTGLAGAITSLSAHPSFTIQPTTLILPLPL
                     SALPLAYLSTALAHISPSISDALNRKRSKWTEEDDEPYSAPGMGKVRGLARGVGEAVG
                     MYT"
     gene            complement(930931..>931498)
                     /locus_tag="CNI03430"
                     /db_xref="GeneID:3259485"
     mRNA            complement(join(930931..931117,931203..931311,
                     931385..>931498))
                     /locus_tag="CNI03430"
                     /product="transcription initiation protein spt4, putative"
                     /transcript_id="XM_572890.1"
                     /db_xref="GI:58271467"
                     /db_xref="GeneID:3259485"
     CDS             complement(join(930999..931117,931203..931311,
                     931385..931498))
                     /locus_tag="CNI03430"
                     /codon_start=1
                     /product="transcription initiation protein spt4"
                     /protein_id="XP_572890.1"
                     /db_xref="GI:58271468"
                     /db_xref="GeneID:3259485"
                     /translation="MPPKSGRAELRACLVCSILQSTNDFLTQGCPNCEDILEMRGSAE
                     RVAECTSLLYDGMIAMIEPSESWVARWQRIDKRMRGIYAVRVTGRAPQDVIDAIEARG
                     GVYRPRDAVED"
     gene            931727..934225
                     /locus_tag="CNI03440"
                     /db_xref="GeneID:3259739"
     mRNA            join(931727..931984,932064..932092,932145..933398,
                     933640..933904,933972..934225)
                     /locus_tag="CNI03440"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41530290|gb|CF676131.1,gi|41530299|gb|CF676140.1"
                     /transcript_id="XM_572621.1"
                     /db_xref="GI:58270929"
                     /db_xref="GeneID:3259739"
     CDS             join(931755..931984,932064..932092,932145..933398,
                     933640..933904,933972..934098)
                     /locus_tag="CNI03440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572621.1"
                     /db_xref="GI:58270930"
                     /db_xref="GeneID:3259739"
                     /translation="MSSQTPLSDPLTTQEKLLLSQAVYKLGAFSWAEVSSLLLDHPCI
                     KDATPHARPAKLFTPERCEGIYKELMGAIGINVPAPDGIKPHAKSHLRLAQNYYIARL
                     TELQNEISSYETRFTSLMSEITALKKGELDEQLREEIKAGLERKYGKKAVEEWMPGKA
                     EIQKAVEDGPVKEGEVDPELAKKEKEEKQKDVEEPRKGVEIVGASTLEENPAVSVLGK
                     QEGPSKSLKPEFLESKVKNPIEQMKTPDASRATLSPQPSPLSPAPSDHSPSRSVKTAA
                     DEEKEEEDAEKEEEKGEGEQDEEVVPEKKTNKRKAVSQPKGAPPTKRNSRRGAVTEEP
                     EEFEAGEAAEEEEEEGGGAEEKEEEPPTTRGRRSKRSSLTKPSASPSLPPKDTSPAIS
                     RRAPSVSSTTSAATPGGEGERRSSRRAAAPAAGRRGMRDDVVSKSVRGQTADAADADD
                     GPPTPTAAEEHEPEIRKSTRASRRKSGLPEQQQQAAATPTPVERERRGTRATTRNSPT
                     APTPNNSIKEKGKKSSKPFLFSLLEAMASHRFGTIFESPVRKSDAPDYYSVIKRPMDL
                     KTIKGKIKDGRIERIDELERDVLLMFSNAMMYNAPDSQVYEMAKEMMKDCEGHFAHFR
                     NMEMELDNEG"
     misc_feature    932714..932783
                     /locus_tag="CNI03440"
                     /note="GA-rich"
     misc_feature    932914..932962
                     /locus_tag="CNI03440"
                     /note="GA-rich"
     gene            complement(934274..935044)
                     /locus_tag="CNI03450"
                     /db_xref="GeneID:3259657"
     mRNA            complement(join(934274..934393,934459..935044))
                     /locus_tag="CNI03450"
                     /product="expressed protein"
                     /transcript_id="XM_572619.1"
                     /db_xref="GI:58270925"
                     /db_xref="GeneID:3259657"
     CDS             complement(934642..934956)
                     /locus_tag="CNI03450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572619.1"
                     /db_xref="GI:58270926"
                     /db_xref="GeneID:3259657"
                     /translation="MGSVNMMGNTKTLNIIRGKDKIKCAPSHVMTVVSDQKEINHLIR
                     VYVAALDFDENDKPTKMGTSKRSFCTECSSMLWNYHDEWPDVRPSSFHIVIGTGSELA
                     NA"
     gene            936173..938707
                     /locus_tag="CNI03460"
                     /db_xref="GeneID:3259680"
     mRNA            join(936173..936303,936382..936492,936545..936885,
                     936934..937132,937183..937277,937331..937975,
                     938025..938528,938582..938707)
                     /locus_tag="CNI03460"
                     /product="Golgi vesicle transport-related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41537219|gb|CF683060.1,gi|41537222|gb|CF683063.1,
                     gi|41547042|gb|CF692883.1,gi|41547048|gb|CF692889.1,
                     gi|41551080|gb|CF696921.1,gi|41551086|gb|CF696927.1,
                     gi|41554071|gb|CF699912.1,gi|41554087|gb|CF699928.1,
                     gi|41554513|gb|CF700354.1,gi|41554526|gb|CF700367.1,
                     gi|41568230|gb|CF714071.1,gi|41568238|gb|CF714079.1"
                     /transcript_id="XM_572617.1"
                     /db_xref="GI:58270921"
                     /db_xref="GeneID:3259680"
     CDS             join(936261..936303,936382..936492,936545..936885,
                     936934..937132,937183..937277,937331..937975,
                     938025..938528,938582..938665)
                     /locus_tag="CNI03460"
                     /codon_start=1
                     /product="Golgi vesicle transport-related protein"
                     /protein_id="XP_572617.1"
                     /db_xref="GI:58270922"
                     /db_xref="GeneID:3259680"
                     /translation="MAEQNFSAALATWKEINLSELQKNLDTTAVELVDNQKENLIGRK
                     KLAEQTREFKKLPDDAEKFAAIKVLLKAYQGEIDALTRRSKMSETSFLNVYKLLADAP
                     DPYPLLDAAVDQTIKVAEARMLESELARLREENGELKKSLGEAANVEEKRKKAESKVE
                     QLEEKMDDLIQERVTQKENELNAEYDERMRNYEEREKDLQRQVEMVKKQLRDLHMSNE
                     SAEAKLLNANQRQEQDVAARLAELDMVAADLARANERVASVERRNEILRSEIESVRSG
                     SQQAEKVKAFEAQISELEAEASRILAALDAAKDAKAEADRQFKKQAEESAKEIAARTA
                     EVDGLKAKMKGMADYDEIKRELEIMKYVEFSGADFEDNDGEEPRLPDPNASVANKQRG
                     QSLEKLLTSKNRRLLEDLTKLRVSWEDLSSEHAKAEEMIEGLQVDLALQRELVEKLES
                     DLMVLNNREDRVGTPGQGLAGLDIGSKPDGRASPANSGSQDTSILPIVTSQRDRFRQR
                     NAELEDELRKQFETISDLRTEVKSLQTDNLKLYEKVRYMGSYRDSSFAKAGPSGGAYS
                     SGGGTGGLLTGVLGRRDEEIGKYKDKYDESLNPFEAFKGREAQRAIQALNPVERGVFS
                     LTRAIVGNKRARNLFILYAGSLHILILFILWNTMAASDSTSHPPVTIHP"
     gene            complement(938737..940699)
                     /locus_tag="CNI03470"
                     /db_xref="GeneID:3259734"
     mRNA            complement(join(938737..938902,938956..939992,
                     940046..940222,940272..940331,940402..940417,
                     940472..940510,940571..940699))
                     /locus_tag="CNI03470"
                     /product="Machado-Joseph disease protein 1 (Ataxin-3),
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41541149|gb|CF686990.1,gi|41541153|gb|CF686994.1,
                     gi|41552962|gb|CF698803.1,gi|41563512|gb|CF709353.1,
                     gi|41563663|gb|CF709504.1,gi|41568820|gb|CF714661.1"
                     /transcript_id="XM_572615.1"
                     /db_xref="GI:58270917"
                     /db_xref="GeneID:3259734"
     CDS             complement(join(938865..938902,938956..939992,
                     940046..940222,940272..940331,940402..940417,
                     940472..940510,940571..940586))
                     /locus_tag="CNI03470"
                     /codon_start=1
                     /product="Machado-Joseph disease protein 1 (Ataxin-3)"
                     /protein_id="XP_572615.1"
                     /db_xref="GI:58270918"
                     /db_xref="GeneID:3259734"
                     /translation="MDLVPYMYYEKQEAGSQLCAQHCLNNLLQQYTYSEFDLADIAKR
                     LDQAENATLDVNHQLRKSYNYDDTGYFSISVLERALEVWDLTMVRWRGEAMKPYQDHP
                     EDQAAFILNLASHWFTLRRFAPNPPHAAASKRWYNLNSFLADGPEWISPTYLHMVLTQ
                     AEQEGYSVFVIRKATPGTKEGEEAGEAEGWGDGGIGQLPESLGDVMAVELGEPVGRSG
                     GLLSGTIGPTKESKTTQMSIPADPNTTTVDAEPSSPSRPPRRRRQPDLSSDPTEIVDD
                     PYARPAPSRSRQSSSRSNPAQHQVIGDDEGDIFDQTHGIPSHYDETPDDDNADDDFEM
                     SRSRAYAGTMDFQFQSRSYDDEDEALQAALKASMADLPEGWEMPDILKPESERQAFTT
                     TTSIMTTTTTTPPVAPEAQREESPVATSVAEEKDIVESNEVEDDSDDVQPAEEPSPEE
                     IRRRRLARFG"
     repeat_region   939092..939131
                     /rpt_type=tandem
                     /rpt_unit_seq="tag"
                     /satellite="microsatellite"
     gene            940944..943041
                     /locus_tag="CNI03480"
                     /db_xref="GeneID:3259654"
     mRNA            join(940944..941112,941177..941203,941257..941291,
                     941348..941426,941479..941505,941569..941610,
                     941666..941804,941853..941874,941921..941979,
                     942039..942222,942276..942528,942591..942605,
                     942685..942792,942850..943041)
                     /locus_tag="CNI03480"
                     /product="Voltage-gated potassium channel beta-2 subunit,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41535025|gb|CF680866.1,gi|41535033|gb|CF680874.1,
                     gi|41535106|gb|CF680947.1,gi|41535114|gb|CF680955.1,
                     gi|41535642|gb|CF681483.1,gi|41535656|gb|CF681497.1,
                     gi|41539716|gb|CF685557.1,gi|41547359|gb|CF693200.1,
                     gi|41547365|gb|CF693206.1,gi|41548786|gb|CF694627.1,
                     gi|41549573|gb|CF695414.1,gi|41549576|gb|CF695417.1,
                     gi|41553363|gb|CF699204.1,gi|41553374|gb|CF699215.1,
                     gi|41556150|gb|CF701991.1,gi|41571562|gb|CF717403.1,
                     gi|41571565|gb|CF717406.1"
                     /transcript_id="XM_572880.1"
                     /db_xref="GI:58271447"
                     /db_xref="GeneID:3259654"
     CDS             join(941077..941112,941177..941203,941257..941291,
                     941348..941426,941479..941505,941569..941610,
                     941666..941804,941853..941874,941921..941979,
                     942039..942222,942276..942528,942591..942605,
                     942685..942792,942850..942891)
                     /locus_tag="CNI03480"
                     /codon_start=1
                     /product="Voltage-gated potassium channel beta-2 subunit,
                     putative"
                     /protein_id="XP_572880.1"
                     /db_xref="GI:58271448"
                     /db_xref="GeneID:3259654"
                     /translation="MSGQRFEPKNMLYRNLGNSGLRVPVFSYGGWLTVGYNQKGDLVK
                     ELMQTAFDCGINMFDNAEAYAAGESESQMGRVIKELGWDRSDIIVTTKVFFGTGDKER
                     HNTRGLSRKHIIEGVNKSLKRLGLDYVDIVFAHRPDVTTPLEETVRAFNYLIDKGLTF
                     YWGTSEWSAMQIQQATEIARRLNMVGPVAEQPHYSMLHRERFEAEYEPLWRYENFGST
                     IWSPLDSGMLTGKYNDGIPQDSRYHHNLGGAMDERIKELESPEGKAKIEKVKKLTKIA
                     ERLGGSMTNLALAWTLKHKGVSTCILGATKPEQIKENVKALDIYPKLTSEVMEEIEKI
                     LDNKPDPPPSYGRLTTDGQLM"
     gene            943951..946552
                     /locus_tag="CNI03490"
                     /db_xref="GeneID:3259762"
     mRNA            join(943951..944308,944385..944510,944558..944683,
                     944737..944947,945003..945120,945169..945477,
                     945525..945808,945863..946109,946177..946552)
                     /locus_tag="CNI03490"
                     /product="sugar transporter, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41532332|gb|CF678173.1,gi|41532336|gb|CF678177.1,
                     gi|41532792|gb|CF678633.1,gi|41532802|gb|CF678643.1,
                     gi|41535440|gb|CF681281.1,gi|41536162|gb|CF682003.1,
                     gi|41537726|gb|CF683567.1,gi|41537732|gb|CF683573.1,
                     gi|41538032|gb|CF683873.1,gi|41538035|gb|CF683876.1,
                     gi|41538648|gb|CF684489.1,gi|41538657|gb|CF684498.1,
                     gi|41539087|gb|CF684928.1,gi|41539101|gb|CF684942.1,
                     gi|41539555|gb|CF685396.1,gi|41539562|gb|CF685403.1,
                     gi|41541368|gb|CF687209.1,gi|41542233|gb|CF688074.1,
                     gi|41542238|gb|CF688079.1,gi|41542870|gb|CF688711.1,
                     gi|41542880|gb|CF688721.1,gi|41543094|gb|CF688935.1,
                     gi|41543099|gb|CF688940.1,gi|41543102|gb|CF688943.1,
                     gi|41546051|gb|CF691892.1,gi|41546059|gb|CF691900.1,
                     gi|41547330|gb|CF693171.1,gi|41547338|gb|CF693179.1,
                     gi|41548090|gb|CF693931.1,gi|41548092|gb|CF693933.1,
                     gi|41551417|gb|CF697258.1,gi|41551424|gb|CF697265.1,
                     gi|41551660|gb|CF697501.1,gi|41551666|gb|CF697507.1,
                     gi|41553785|gb|CF699626.1,gi|41553799|gb|CF699640.1,
                     gi|41556083|gb|CF701924.1,gi|41556091|gb|CF701932.1,
                     gi|415"
                     /transcript_id="XM_572882.1"
                     /db_xref="GI:58271451"
                     /db_xref="GeneID:3259762"
     CDS             join(944164..944308,944385..944510,944558..944683,
                     944737..944947,945003..945120,945169..945477,
                     945525..945808,945863..946109,946177..946308)
                     /locus_tag="CNI03490"
                     /codon_start=1
                     /product="sugar transporter"
                     /protein_id="XP_572882.1"
                     /db_xref="GI:58271452"
                     /db_xref="GeneID:3259762"
                     /translation="MAGEDLAITSTSVENVPNSPSRKVSEDGLLLQEDKEMAAMYANA
                     AAATEKEQNMTLLEGLRLYPKAIAWSILISSCCAMEGYDISLLGNFYAFDPFNRKFGV
                     ELDDGTWQVPARWQTGLSNGAQCGQIIGLIVNGIFTERYGYRKVLIASLLWLAAVITI
                     FFCAPNIQVLLAGEILAGIPWGVFQSIAISYASDVCPIALRGYLTCYANFCWGWGQLI
                     GVGVIRAMFSRDDQWAYRIPYAVQWVWPPLILAGVIFAPESPWWLIRHGRLEEAKKSL
                     MRLASPKRNVSYDVDETADMIRHTTELEKDITSGASFLDCFRGVDLRRTEIVCAIWSM
                     QNLSGNTFSNYSTYFFEQAGLTGTVPYDFAMGQYAINMVGVFGAWSLMALGFGRRQLI
                     LIGLSGLFVALLIMGFMGLIPDSKQREAGLATGSLMLVWAIFYQCTVGTVAYSLVGEI
                     ASRRLSIKTVALGRAAYNVIAIICNVLTPYMINPTAWNWGNYAGFFWAGSCFLCLIYA
                     YFRVPEPSGRTYAELDLLFERKISARKFASTHVNAFDVALHHQVGEDKGVSDHVEKA"
     gene            946754..946836
                     /locus_tag="CNI03500"
                     /db_xref="GeneID:3259587"
     tRNA            946754..946836
                     /locus_tag="CNI03500"
                     /product="tRNA-Met"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:3259587"
     gene            947924..950673
                     /locus_tag="CNI03510"
                     /db_xref="GeneID:3259721"
     mRNA            join(947924..948169,948226..948345,948407..948419,
                     948467..948536,948591..948644,948699..948726,
                     948778..949294,949354..949406,949476..949620,
                     949683..949759,949816..949917,950028..950094,
                     950160..950347,950426..950673)
                     /locus_tag="CNI03510"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41542562|gb|CF688403.1,gi|41542572|gb|CF688413.1,
                     gi|41546588|gb|CF692429.1,gi|41552913|gb|CF698754.1,
                     gi|41552917|gb|CF698758.1,gi|41572680|gb|CF718521.1,
                     gi|41572693|gb|CF718534.1"
                     /transcript_id="XM_572944.1"
                     /db_xref="GI:58271575"
                     /db_xref="GeneID:3259721"
     CDS             join(948027..948169,948226..948345,948407..948419,
                     948467..948536,948591..948644,948699..948726,
                     948778..949294,949354..949406,949476..949620,
                     949683..949759,949816..949917,950028..950094,
                     950160..950347,950426..950438)
                     /locus_tag="CNI03510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572944.1"
                     /db_xref="GI:58271576"
                     /db_xref="GeneID:3259721"
                     /translation="MSDEIKKQSLTHHHLTNFHLDDYPDEKQIVADNGNLVTVEEVKI
                     AEDALLMADEYTEEQYKKLKRKVDWILLPLMWWCYGIQQTDKTGLGTMNLYGVQADTG
                     MHGNQYSLLTVVFYTAYGICEFPSNIILQRFNMGKCLTIYMFCWGIVVLAQGFLKSFA
                     PFLVLRLLQGAFECTISPGFNLIIANWYTTQEHNSRSLVFQSANAGWGIVVDLTMYGI
                     AKAANRNPGGFEAWRGIAVFLGGQTLLAAGVAFFLLGTPNEVSWLKPEEKRIACARVM
                     KNNAGTDLTGRKTWKWDQVCETFLDPVLYFQFINAFMSSCNGALTTFGTVINKSFGFT
                     ESEVILYGIPRSVASVLWFAFIGILTGKFKGIRMYFMMISTVFPFIGLLFLALLPEDD
                     TYRWVKWGMYFMTVTFVVPLFSAWALISSNTAGRTKRSVMSSMTFIAYCTGNIAGSQV
                     MKAKDAPHYIPGTIAIACCMGVEFATIVIWRIWLEYCNRKKTRAIAEMGLSEEEIEKR
                     GQELGAEDTTDMKNPFFIYST"
     repeat_region   949925..949971
                     /rpt_type=tandem
                     /rpt_unit_seq="ttttc"
                     /satellite="microsatellite"
     misc_feature    950353..950379
                     /locus_tag="CNI03510"
                     /note="AT_rich"
     repeat_region   950887..950933
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccg"
                     /satellite="microsatellite"
     gene            complement(<950942..>953352)
                     /locus_tag="CNI03520"
                     /db_xref="GeneID:3259666"
     mRNA            complement(join(<950942..951365,951453..952474,
                     953125..>953352))
                     /locus_tag="CNI03520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572613.1"
                     /db_xref="GI:58270913"
                     /db_xref="GeneID:3259666"
     CDS             complement(join(950942..951365,951453..952474,
                     953125..953352))
                     /locus_tag="CNI03520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572613.1"
                     /db_xref="GI:58270914"
                     /db_xref="GeneID:3259666"
                     /translation="MAAYHALAAMANNPPASSISIRGAAAAPARVVANALRGAGISAR
                     SQGMDVDGGGARGGDRPRGIERRKRSSGPLDQTDKITIHTLSLANNNFSHLKQLEKLP
                     IWLPDIRALDLSGNPINHISELDNILASGEKKGKANAGMGSLKSLVELKLNDCLFREK
                     TLARPDGEAVYKQYVFSLPNMKDAMLTPNSEILRRFPGLRILDGVSLERVIFPIERKP
                     KVKHTEEEKAALIARPFSFPVEVRPDFFSEEAARNFAMAFCAKFFPCFDNNRTECLPA
                     YAPNALISIAANTLTSRSAQQQVVLKSRLDRPNPVPFEPWINLPSRNFFRNATSIHQR
                     METLKTAADPAQLAEWWEKAVPRTEHPLTEASKWCFECWVLDSERGHVRLCLMIQGQF
                     RELPSGTYRSFSRTFILVEAPEGSPILSDTMIVHSFFGTGAFDTTRPLGMNGVTIQPP
                     SIPFTPSAVPAQAASGLGSGVNPSLSSISPGAGAGVGPGASPNGSSSSAAAAPDPTTQ
                     QSLISQISSRTGMNAQYAGMCLVQNGWDPEAAIKNFEEIKSSIPAEAFQ"
     repeat_region   953530..953554
                     /rpt_type=tandem
                     /rpt_unit_seq="ccccct"
                     /satellite="microsatellite"
     gene            <953565..954246
                     /locus_tag="CNI03530"
                     /db_xref="GeneID:3259589"
     mRNA            join(<953565..953636,953679..953992,954043..954118,
                     954159..954246)
                     /locus_tag="CNI03530"
                     /product="expressed protein"
                     /transcript_id="XM_572611.1"
                     /db_xref="GI:58270909"
                     /db_xref="GeneID:3259589"
     CDS             join(953565..953636,953679..953992,954043..954118,
                     954159..954182)
                     /locus_tag="CNI03530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572611.1"
                     /db_xref="GI:58270910"
                     /db_xref="GeneID:3259589"
                     /translation="MGAAQSSQPADQLIHPQEPNTSVQFSPALISRLSTPHEPTPTST
                     TDDVVRRRLAAESAHLRAQEADILSAISAALEKENLDREKPGMSAHVLASDIDHIREK
                     IERMKDKRNKEGDGVKLARQGVETCYRANGDRPLDCWKQVEAFKAEVAKLEQAFVKSL
                     Q"
     misc_feature    953641..953791
                     /locus_tag="CNI03530"
                     /note="C-rich"
     gene            complement(954345..>956980)
                     /locus_tag="CNI03540"
                     /db_xref="GeneID:3259730"
     mRNA            complement(join(954345..954624,954684..954851,
                     954907..955230,955281..955379,955435..956428,
                     956486..>956980))
                     /locus_tag="CNI03540"
                     /product="signal transducer, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536418|gb|CF682259.1,gi|41536424|gb|CF682265.1"
                     /transcript_id="XM_572888.1"
                     /db_xref="GI:58271463"
                     /db_xref="GeneID:3259730"
     CDS             complement(join(954506..954624,954684..954851,
                     954907..955230,955281..955379,955435..956428,
                     956486..956980))
                     /locus_tag="CNI03540"
                     /codon_start=1
                     /product="signal transducer"
                     /protein_id="XP_572888.1"
                     /db_xref="GI:58271464"
                     /db_xref="GeneID:3259730"
                     /translation="MSFSLSDPDFAVILSNMDQSPQKIKTGEKVRPEVEIPSGESAPS
                     SPPVSSPSLARSPTLDMLSTIESDPQSRSQPVALGRSRLLPNDPSPHMLNRRQASGDS
                     CFSVKSRHGDGSFEKLVELLAGAKFREEESVNVDVAVLSGIVKEVEDLREAMVGLKNR
                     YTGAKRSSQQYSEGLSVAGEEYDKERSKRTELEAEVSRLRAQLHSQTARLSVISGDEK
                     RAEHMKRRSRDLASNLTGLERDISRLRAERDMKLAEVDELAERTPGAVLDPGSLAQSL
                     SVRLESIRDQYATELESLSGQVENLEREISELRQIKEASLEESAALAAKNEDLAELNT
                     QLTRQTEALQDTLSRVRPPTIFSKGKGHQLQNSPSLASLTGQGLQDVPEETVTARVVK
                     VSKPEPIEAAPVKRFKWYKSSKGPDASNTPANISKPLALDVGKTRGGMTLGVAGLAMG
                     GIGGGARPSTEFGMRDHAFQQHTMMRFTRCELCGEKMWGLQEVKCSSCGIVCHSKCAE
                     KLPRGCTGTKGAVKDEPEGPLPPSMFGRPLVEQVSADKQSVPVIVTKCINAVEAVGME
                     YEGIYRKTGGSSQSKQITQLFERGDYDAFDLADVDAFNDISSVTSVLKTYFRSLPNPL
                     FTHELHESFVTAATIRDTNNKRQAVLALLHELPKEHYNTLKALMLHLNRVTSYSGVNL
                     MSSQNLGVVFGPTLMRSSDPNREFGDMAGKALSVQWLVDNAPSVFTLDRD"
     misc_feature    957877..957931
                     /note="CT-rich"
     gene            complement(<958260..>958727)
                     /locus_tag="CNI03550"
                     /db_xref="GeneID:3259515"
     mRNA            complement(join(<958260..958305,958420..>958727))
                     /locus_tag="CNI03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_572609.1"
                     /db_xref="GI:58270905"
                     /db_xref="GeneID:3259515"
     CDS             complement(join(958260..958305,958420..958727))
                     /locus_tag="CNI03550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572609.1"
                     /db_xref="GI:58270906"
                     /db_xref="GeneID:3259515"
                     /translation="MSTLSQHSTAPLNTKKASTKPPSNILSPRVPSPTNVPSSVGSPN
                     PQHHHHDHMHAHSPTGAKYPGLGISQGEGFPPMNGMDAKCGGCGLMIDQESGGVVVAF
                     GHKSPLAVRWQSGLW"
     gene            961860..964008
                     /locus_tag="CNI03560"
                     /db_xref="GeneID:3259637"
     mRNA            join(961860..962050,962098..962180,962232..962407,
                     962460..963794,963850..964008)
                     /locus_tag="CNI03560"
                     /product="phosphoadenosine-phosphosulfate synthase (PAPS)
                     bifunctional enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41533738|gb|CF679579.1,gi|41534689|gb|CF680530.1,
                     gi|41534701|gb|CF680542.1,gi|41538695|gb|CF684536.1,
                     gi|41538706|gb|CF684547.1,gi|41542776|gb|CF688617.1,
                     gi|41542785|gb|CF688626.1,gi|41545677|gb|CF691518.1,
                     gi|41545687|gb|CF691528.1,gi|41545960|gb|CF691801.1,
                     gi|41562603|gb|CF708444.1,gi|41562611|gb|CF708452.1,
                     gi|41563537|gb|CF709378.1,gi|41563549|gb|CF709390.1,
                     gi|41566922|gb|CF712763.1,gi|41566934|gb|CF712775.1,
                     gi|41574053|gb|CF719894.1,gi|41574772|gb|CF720613.1,
                     gi|41574781|gb|CF720622.1,gi|41574853|gb|CF720694.1"
                     /transcript_id="XM_572607.1"
                     /db_xref="GI:58270901"
                     /db_xref="GeneID:3259637"
     CDS             join(961937..962050,962098..962180,962232..962407,
                     962460..963794,963850..963887)
                     /locus_tag="CNI03560"
                     /codon_start=1
                     /product="phosphoadenosine-phosphosulfate synthase (PAPS)
                     bifunctional enzyme"
                     /protein_id="XP_572607.1"
                     /db_xref="GI:58270902"
                     /db_xref="GeneID:3259637"
                     /translation="MANAPHGGVLKDLLVRDAALHDSLLQEARSLNDIFLTERQLCDL
                     ELILNGGFSPLEGFMNERDYTSVVETLRLAPYNGQKHGDVFPIPITLDVSQEDINTLG
                     LKQGGRVALRDPRDDAALAILTVSDIYRPNKAIEAEKVMGADDIAHPSVAYLRNNVKE
                     FYVGGKVQAIQAPTHFDYVPLRFTPAELRAHFHKLAWRKVVAFQTRNPMHRAHRELTV
                     RAARQRRANVLIHPVVGLTKPGDVDHYTRVRAYQALMPSYPEGMAHLALLPLAMRMAG
                     PREAVWHAVIRKNFGATHFIVGRDHAGPGKNSQGQDFYGPYDAQELVTQFKDELQIEM
                     VPFQAMTYLPGSDEYQPVDEVPKGTPTADISGTELRKRLRTGASIPDWFSYTGVVKVL
                     RESYPPRPQQGFTILLTGLHNSGKDTIARALQVTLQQQGSRSVSLLLGEELRSDLDPQ
                     IGRAITPEQKHINLERIGFVAGELTKAGAAVIAAPTAPYERSRQAFKKQVVGSGGGNY
                     FLVHVATPLEWCEKVDRRGLYKAARAGEIKNLTGVDDVYEAPEDADLVCDLRNDTVPE
                     IVHSIIMILESQNLV"
     gene            complement(964302..964404)
                     /locus_tag="CNI03570"
                     /db_xref="GeneID:3259586"
     tRNA            complement(964302..964404)
                     /locus_tag="CNI03570"
                     /product="tRNA-Leu"
                     /codon_recognized="CUU"
                     /db_xref="GeneID:3259586"
     gene            <965178..>965851
                     /locus_tag="CNI03580"
                     /db_xref="GeneID:3259525"
     mRNA            join(<965178..965263,965560..>965851)
                     /locus_tag="CNI03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_572605.1"
                     /db_xref="GI:58270897"
                     /db_xref="GeneID:3259525"
     CDS             join(965178..965263,965560..965851)
                     /locus_tag="CNI03580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572605.1"
                     /db_xref="GI:58270898"
                     /db_xref="GeneID:3259525"
                     /translation="MGVSGGNYPARAAATLSNIVPRPIGWLDLLEMIPEEKRPSLLPI
                     TPDTPPTYVLHSWQGRPFGAFEESLTLENDMKEHGLSVETDWIDGADHVLRDRKKGGW
                     NGMADGWEDIAKRAVNWAVDLVW"
     gene            966809..969033
                     /locus_tag="CNI03590"
                     /db_xref="GeneID:3259644"
     mRNA            join(966809..966866,967026..967169,967221..967408,
                     967460..967613,967665..968117,968175..969033)
                     /locus_tag="CNI03590"
                     /product="phosphoenolpyruvate carboxykinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530472|gb|CF676313.1,gi|41530478|gb|CF676319.1,
                     gi|41532399|gb|CF678240.1,gi|41533763|gb|CF679604.1,
                     gi|41537007|gb|CF682848.1,gi|41537017|gb|CF682858.1,
                     gi|41537924|gb|CF683765.1,gi|41538018|gb|CF683859.1,
                     gi|41538024|gb|CF683865.1,gi|41539123|gb|CF684964.1,
                     gi|41540452|gb|CF686293.1,gi|41540456|gb|CF686297.1,
                     gi|41540721|gb|CF686562.1,gi|41540735|gb|CF686576.1,
                     gi|41543172|gb|CF689013.1,gi|41543181|gb|CF689022.1,
                     gi|41548094|gb|CF693935.1,gi|41548101|gb|CF693942.1,
                     gi|41552607|gb|CF698448.1,gi|41552618|gb|CF698459.1,
                     gi|41553053|gb|CF698894.1,gi|41553058|gb|CF698899.1,
                     gi|41554843|gb|CF700684.1,gi|41555778|gb|CF701619.1,
                     gi|41555790|gb|CF701631.1,gi|41559097|gb|CF704938.1,
                     gi|41559099|gb|CF704940.1,gi|41559970|gb|CF705811.1,
                     gi|41562459|gb|CF708300.1,gi|41568252|gb|CF714093.1,
                     gi|41568262|gb|CF714103.1"
                     /transcript_id="XM_572603.1"
                     /db_xref="GI:58270893"
                     /db_xref="GeneID:3259644"
     CDS             join(967059..967169,967221..967408,967460..967613,
                     967665..968117,968175..968924)
                     /locus_tag="CNI03590"
                     /codon_start=1
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="XP_572603.1"
                     /db_xref="GI:58270894"
                     /db_xref="GeneID:3259644"
                     /translation="MAPRQHHHDEFESNQFLGKELKYFSQAGFDLDRIHIKRNAPIAS
                     LYEDAILNEGAIISSNGALINFSGKKTGRSPKDKRIVFEETSKDDIWWGPVNIKMDEH
                     TFEINRERAIDYLNTRENVYVFDGFAGWDPKYRIKVRVIASRAYHALFMHNMLIRPTP
                     EELENFGEPDFIIYNAGQFPANRFTTGMTSTTSVGINFKRMEMVILGTEYAGEMKKGI
                     FSVMHYLQPVKFGQLSLHSSANQGIGKNDDVTLFFGLSGTGKTTLSADANRLLIGDDE
                     HVWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKFGSILENVVYNPADRKPDYDDVS
                     ITENTRCAYPIEYIPNAKIPCIADRQPSNIIMLCCDAFGVLPPVSRLTPEQAQYHFVA
                     GYTSKTPGTEDGIVEPSPTFSTCYGQPFIVLHPGRYAKMLAERMEKNSVNCWLINTGW
                     TGGKFGTGKRCPLKYTRAIVDAIHNGSLAKAEYENFPIFNLAIPKAVEGVPSDILNPE
                     KAWPSKEAFKAELDKLGNMFQKAFAKYETDIDEKVKLSGPVFA"
     gene            complement(<970013..971271)
                     /locus_tag="CNI03600"
                     /db_xref="GeneID:3259474"
     mRNA            complement(join(<970013..970474,970533..970633,
                     970695..971035,971099..971271))
                     /locus_tag="CNI03600"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41571742|gb|CF717583.1"
                     /transcript_id="XM_572943.1"
                     /db_xref="GI:58271573"
                     /db_xref="GeneID:3259474"
     CDS             complement(join(970013..970474,970533..970633,
                     970695..971007))
                     /locus_tag="CNI03600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572943.1"
                     /db_xref="GI:58271574"
                     /db_xref="GeneID:3259474"
                     /translation="MATLLTLPSHLIESISHLLREDLELPDNLREPLLETIKQPQTYI
                     VASLDTRNSLYTQDDGDIDGKQEDSTAVPRPPTIDYDLVERLSRWATSDKGKMLLNRN
                     GLDPSRYTDISLLSGTEIYVEPKELARLQAAENPEKPNPYLPSYLSPAPPSFGSEYRN
                     LTRTLSTAFNVIFSILGSSGAVYVAAVSGAGYSREKGILLGILAGLIVGIADGVLVVL
                     FMSRVEKDRKERHERGRKLMKGSGKALDQIEDQAEIEEEVQEKLLAKEGSDSTAVSAR
                     QIQLRRRGLKPSNPE"
     gene            971589..972491
                     /locus_tag="CNI03610"
                     /db_xref="GeneID:3259377"
     mRNA            join(971589..971737,971795..971945,972001..972161,
                     972345..972491)
                     /locus_tag="CNI03610"
                     /product="lactoylglutathione lyase, putative"
                     /transcript_id="XM_572884.1"
                     /db_xref="GI:58271455"
                     /db_xref="GeneID:3259377"
     CDS             join(971627..971737,971795..971945,972001..972161,
                     972345..972422)
                     /locus_tag="CNI03610"
                     /codon_start=1
                     /product="lactoylglutathione lyase"
                     /protein_id="XP_572884.1"
                     /db_xref="GI:58271456"
                     /db_xref="GeneID:3259377"
                     /translation="MSTAASNPATYKFNHTMIRIKDPKVSLPFYEKVLGMKVFYESPG
                     GDFTNYFLAFANGFDDADLNKENIRDKLFDREGVLELCHNWGTENDASFKGYASGNEE
                     PGRGFGHICITVDNLEAACKRFDELGVKFKKRPEDGRMRHIAFIYDPDGYWVEIVARS
                     LNASNI"
     gene            complement(972474..>975418)
                     /locus_tag="CNI03620"
                     /db_xref="GeneID:3259551"
     mRNA            complement(join(972474..972667,972791..973179,
                     973227..973476,973534..973620,973673..973708,
                     974119..974221,974270..974445,974492..974575,
                     974624..974723,974771..975036,975332..>975418))
                     /locus_tag="CNI03620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573016.1"
                     /db_xref="GI:58271719"
                     /db_xref="GeneID:3259551"
     CDS             complement(join(972563..972667,972791..973179,
                     973227..973476,973534..973620,973673..973708,
                     974119..974221,974270..974445,974492..974575,
                     974624..974723,974771..975036,975332..975418))
                     /locus_tag="CNI03620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573016.1"
                     /db_xref="GI:58271720"
                     /db_xref="GeneID:3259551"
                     /translation="MSSYYNKGDAPSWEALDQDGLDDVIDTSEPSAVAEDPGNYQPGN
                     YVFQTLRTINAEEMKRLVKLMQTAKEQYEAQDDDETVETTEPEILRKTFPPIEESHEM
                     NIANVIQTCNFLFRDGGTQLRGNKRVFWITDNDMPPGMNNRQPARTSYGDLTTYGVTA
                     ETFFIDRPDHRFNPNIFWNDILDREAIDYNDDQPDPEGLSSLADLMKDLVIKTSPKRT
                     HFHVPLKLGKDGEIVIGVSGCSMVSEQGKGASRYVKMRGQVVEEVQSKTEYTSAKSLN
                     SGQWGSNPIKVLGFQAASQLRFQDNLKHPFFIYPNEEEYTGSTRTFAALLNSCLKYNR
                     HALALCRLRSNHVPEFCVLIPQEEKTSSNGQEYPPGFHLIILPYKDSIRPPPKKVAEF
                     LQSPPIATDEQINAMKAVIKRTRFKAAAYRPEIYPNPSLAYHYDQLQALAFEEDWDPE
                     DPAKQALDKTMPLYGGMHSRAGEFMEEFNKEIENDERAVEKLAAPTKRGKAEKETTVN
                     EWDLRNIPDMWKKGTLSQLSILARLRLRRRPFTGQNQKGGYHRRRIRTSFHK"
     misc_feature    973811..973917
                     /note="CT-rich"
     gene            975602..977888
                     /locus_tag="CNI03630"
                     /db_xref="GeneID:3259422"
     mRNA            join(975602..976019,976071..976162,976210..976910,
                     976955..977431,977484..977888)
                     /locus_tag="CNI03630"
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-bisphosphatase bifunctional enzyme, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41558794|gb|CF704635.1,gi|41558797|gb|CF704638.1,
                     gi|41559473|gb|CF705314.1,gi|41559480|gb|CF705321.1"
                     /transcript_id="XM_572601.1"
                     /db_xref="GI:58270889"
                     /db_xref="GeneID:3259422"
     CDS             join(975628..976019,976071..976162,976210..976910,
                     976955..977431,977484..977798)
                     /locus_tag="CNI03630"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-bisphosphatase bifunctional enzyme"
                     /protein_id="XP_572601.1"
                     /db_xref="GI:58270890"
                     /db_xref="GeneID:3259422"
                     /translation="MSIPPPPPPNKSPSSSVSPSKSRSPKLKPLTPTSEKPSRTNDDG
                     QVYQPVEPHVLADAVSKLDMIRSAPAPMSTVTSPAASAAPSGPSSPRLSGVGQGPPST
                     GSWAMDHTASGDGRLSAPGTPHFGASTALLKTLDETTKVIRQSSRAPSRAPSVSGIGT
                     VVEKPDYSEAKIVVAMVGLPARGKSYLSNRLMRYLRWLEYNVQVFNVGQLRRSKARSA
                     LQAGQGKVDHSATYFSHSDAEATKKREELAEESLESLIAWLKKEGNVGIMDATNSTID
                     RREKIKKRIDKEPGLQVLYLESFCDDPVVIATNIALKVRSGDPDYQGMSKEDAERDFR
                     KRIAQYESVYQTINEPNIPFCRILNVGQRVTINRIEGYLQSRIAFYLMNLHLKPRSIY
                     LSRHGESMYNVEGKIGGDSDLSPRGWEYARALPALIKDNIGGGPLEVWTSTLQRTQQT
                     ASYLPFEKKTWKSLDELDAGVCDGMTYKEIEQKYPEDYESRDDDKFNYRYRGGESYRD
                     VVVRLEPVIMELERQNNILIIAHQAILRCLYAYFQARPQQELPYINIPLHTLIKITPQ
                     AYGCQEERYPLPIAAVDTHRPRPSKGRNTAGISVAEGTSMADQPVKRDYYGDTQQGVG
                     YGLKPEAISQALENEMEQGKLTPRAAGGAQLHHE"
     gene            978113..980977
                     /locus_tag="CNI03640"
                     /db_xref="GeneID:3259393"
     mRNA            join(978113..978205,978263..978582,978634..979159,
                     979214..979328,979378..979817,979873..980361,
                     980415..980764,980817..980977)
                     /locus_tag="CNI03640"
                     /product="cell cycle-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41540258|gb|CF686099.1,gi|41558297|gb|CF704138.1"
                     /transcript_id="XM_572599.1"
                     /db_xref="GI:58270885"
                     /db_xref="GeneID:3259393"
     CDS             join(978134..978205,978263..978582,978634..979159,
                     979214..979328,979378..979817,979873..980361,
                     980415..980764,980817..980913)
                     /locus_tag="CNI03640"
                     /codon_start=1
                     /product="cell cycle-related protein"
                     /protein_id="XP_572599.1"
                     /db_xref="GI:58270886"
                     /db_xref="GeneID:3259393"
                     /translation="MPKPKTARGILLTSNLPQLQNLIKRDPEGYKEEFLTQYNHYLSL
                     LRLHSVASSTPSSSNDKSNELFADLITFISQVAQCYPEATKDLPMQLSGLLLGGESGT
                     SNVVTGDLRKTAVKNLVMLRNKEIIDSIQLLQTLLPLLPTVPSTLRSIIRHTILTDIK
                     TSNAKTKNHRLNRVVQSLLFGMVESGMGAEVVGDKGRNKGKGREKGGEAMWAVMMVKE
                     LWRKGVWTDAKTVSIVSLAAFHPNTKVQSAALHFFLGSENEDEDDSEDEDEVGEARRD
                     VRKMEHRMEVSRGKRKKEKQVKQLKREASKKRKKRAEGAGVTPNFPALELLQDPQTFG
                     EKLYDNLHRHDKIYSLDHKVLIMQLLSRVMGVHKLCVLGFYSYIIKYLTYHQLQVTLI
                     LVSLAQSVHDLTPPDVLTPVIRKLAQEFVHPGVGAEVIAAGLNAIREVCRRQPWCMEE
                     DLLGDLIEYRKSKDKGVVTASRGLLQLFREVNPGMLKRRERGKAASMGLIGSQVLAYG
                     HSADAAEGIEGLELLEEHYAKLRKEANGDVGDGSDVEMDVGEDDDEGWEGWEAESDSE
                     ADSNGWESVSSGGEDLEISDSEDESDKRRDKKDKREKKRLARGKGKAKAEDGETDEDE
                     EMDDAVSVAATEATEASQTTKKLSLLAQQRILTPADFELLNELRLKAAKELAAAGGGS
                     AAKRKLAALEASKRHVGEDEADRFLTEAEILGPRKKAKATWEERMESIQKGREGREKF
                     GSMKGKKKKAAPSSSTNKEKAKNKPIMMALHSNRVVSKKKASLRDKQIRLRAAIEKRK
                     KQKH"
     gene            981505..984161
                     /locus_tag="CNI03650"
                     /db_xref="GeneID:3259664"
     mRNA            join(981505..982567,982616..982900,982952..983056,
                     983115..983264,983316..983414,983475..984161)
                     /locus_tag="CNI03650"
                     /product="protein phosphatase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534382|gb|CF680223.1,gi|41534391|gb|CF680232.1,
                     gi|41575340|gb|CF721181.1,gi|41575352|gb|CF721193.1"
                     /transcript_id="XM_572886.1"
                     /db_xref="GI:58271459"
                     /db_xref="GeneID:3259664"
     repeat_region   981524..981558
                     /rpt_type=tandem
                     /rpt_unit_seq="gaaa"
                     /satellite="microsatellite"
     CDS             join(981572..982567,982616..982900,982952..983056,
                     983115..983264,983316..983414,983475..983681)
                     /locus_tag="CNI03650"
                     /codon_start=1
                     /product="protein phosphatase"
                     /protein_id="XP_572886.1"
                     /db_xref="GI:58271460"
                     /db_xref="GeneID:3259664"
                     /translation="MPTTHTEPSTEAPAMSPQNTTPGPAHTTSIDHNTATATDTQQPS
                     TGLQPSILPPVATPTTQHPVSAAEMTKDGGATAAQPSTAQTTLPESGTTSTAIKSTEG
                     ETGKGTPLENLSRRLSNKTPSTTASSAPQTTAEKADPKPASSHTQPTTSTSKTTVNTP
                     ASPSVNGATKSKAAPISNTTAPKAGQKKKRKRKGLAGILLALGCLSVDEFEEEPSKSS
                     STTASTGPGKSAGAGATTGTSTKADVSAKPTSGGVGVSSGVAKAPNGSVAPAPSDPSA
                     AKIQDATVGAEQKVDATGPTDSTVVAEGPTEAHKGVVSSEQVVVPPTEPHTLPEDETA
                     GVTSSAVQPPGGGSALLGTPSKHVSHRESETNLGTSSNERTETSGGYSDISNSEMVDE
                     STGQGGDELGEDYLEYDDEEDRLIEQGGIGIPVDENGNPAPLLPPVAAKHRGRKCLVL
                     DLDETLLHSSFKQLPTADYIVPVEIESQVHNVYVIKRPGVDHFLTEMAKIYEIVVFTA
                     SLSKYADPVLDMLDENRVVAHRLFRESCYNHKGNYVKDLSQLGRDIEHSIIIDNSPAS
                     YIFHPNNAVPVSTWFSDPHDSELTDLCPFLADLATVDDVRGVLDGRI"
     gene            complement(984173..985845)
                     /locus_tag="CNI03660"
                     /db_xref="GeneID:3259425"
     mRNA            complement(join(984173..984450,984515..984583,
                     984640..984865,984921..985129,985182..985309,
                     985365..985694,985744..985845))
                     /locus_tag="CNI03660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572941.1"
                     /db_xref="GI:58271569"
                     /db_xref="GeneID:3259425"
     CDS             complement(join(984429..984450,984515..984583,
                     984640..984865,984921..985129,985182..985309,
                     985365..985385))
                     /locus_tag="CNI03660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572941.1"
                     /db_xref="GI:58271570"
                     /db_xref="GeneID:3259425"
                     /translation="MYDGPGACGVFRAFQGWTSMSDTCPTEGTLKIYPLIKELTAYTM
                     MRPLFREKQSRAELPREEYLSASNWELDFETSRFPNSPIARSQEYNDETHPHLELGRT
                     MISIPRVKPGDQAWWHGDMIHSVESMHKGKGPSAVLYIPAVPLTPQNVDYIRDQKRLF
                     MEGRPAPDFPGGVGESQFVGRGKMEDIESIEGKQAMGLEPFDVSGQLTPGERHILEQA
                     NKVLGF"
     gene            987143..989507
                     /locus_tag="CNI03670"
                     /db_xref="GeneID:3259404"
     mRNA            join(987143..987360,987457..988108,988163..988762,
                     988814..989138,989194..989507)
                     /locus_tag="CNI03670"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552068|gb|CF697909.1,gi|41562453|gb|CF708294.1,
                     gi|41565296|gb|CF711137.1,gi|41567347|gb|CF713188.1"
                     /transcript_id="XM_572894.1"
                     /db_xref="GI:58271475"
                     /db_xref="GeneID:3259404"
     mRNA            join(987143..987360,987457..988108,988163..989497)
                     /locus_tag="CNI03670"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546270|gb|CF692111.1,gi|41552074|gb|CF697915.1,
                     gi|41552965|gb|CF698806.1,gi|41552978|gb|CF698819.1,
                     gi|41562457|gb|CF708298.1,gi|41567355|gb|CF713196.1"
                     /transcript_id="XM_572895.1"
                     /db_xref="GI:58271477"
                     /db_xref="GeneID:3259404"
     CDS             join(987155..987360,987457..988108,988163..988762,
                     988814..989138,989194..989447)
                     /locus_tag="CNI03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572894.1"
                     /db_xref="GI:58271476"
                     /db_xref="GeneID:3259404"
                     /translation="MSMNKESLTDEEAIQLRLQLGLSAPGAAAADGGEPPVDTDAIAE
                     ENYAQRKAEMKREKEERELKERIEKARNKSALNAKLKGTTLSAPSTDDSLDAKTWIKK
                     QKKREKQRAREIAAMQARDKEEQDRLMYGEEDLAGLKVGHGVEEFEEGEDVILTLKDT
                     GVLEGGEDELQNVNLVEDAAIKAAKERKRKAQQAYTGYDDEEFEENRIGKRADVLGKY
                     DEDFATGKVRTEGFRLGAPVEKKMKIQDEDEQMGIAPARKVKLNLDYTKEFEVSDYAK
                     EGEAGFKKPKKKKAKRSIRRTEAEEDTMEVDGEPTFTRRVVTEGPDNLVDDEDLQAAL
                     SRARRANAKKKPKVKPEDVAAQIAQRKQEEGEQVKEEDGEEDGRITFDETSEFARNVS
                     LESRAISVKRERISPPPSGITPAADSGPSEEPVVVKIERREEGEVDDEDDEMGEEEAD
                     LAEIAAREGMSLEEYREKIDRQMREMEEMKKEMKDESELEPTVGQGVAGVLALLRHQG
                     ALKARTAEDEERERVQKQKDLWLADYRRRMAQRELERIQARGGNKDQAQREWENRMRE
                     QQEARDALDIYKNYKPDVNIAYHDEFGRQMTPKEAWKSLSHKFHGKTSGRMKTEKRLK
                     KIAEERKQLTMNSSDTPLGMTDAFSRRQQMTGEAHMVLSVGNKQSVQAGSSKRR"
     CDS             join(987155..987360,987457..988108,988163..989179)
                     /locus_tag="CNI03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572895.1"
                     /db_xref="GI:58271478"
                     /db_xref="GeneID:3259404"
                     /translation="MSMNKESLTDEEAIQLRLQLGLSAPGAAAADGGEPPVDTDAIAE
                     ENYAQRKAEMKREKEERELKERIEKARNKSALNAKLKGTTLSAPSTDDSLDAKTWIKK
                     QKKREKQRAREIAAMQARDKEEQDRLMYGEEDLAGLKVGHGVEEFEEGEDVILTLKDT
                     GVLEGGEDELQNVNLVEDAAIKAAKERKRKAQQAYTGYDDEEFEENRIGKRADVLGKY
                     DEDFATGKVRTEGFRLGAPVEKKMKIQDEDEQMGIAPARKVKLNLDYTKEFEVSDYAK
                     EGEAGFKKPKKKKAKRSIRRTEAEEDTMEVDGEPTFTRRVVTEGPDNLVDDEDLQAAL
                     SRARRANAKKKPKVKPEDVAAQIAQRKQEEGEQVKEEDGEEDGRITFDETSEFARNVS
                     LESRAISVKRERISPPPSGITPAADSGPSEEPVVVKIERREEGEVDDEDDEMGEEEAD
                     LAEIAAREGMSLEEYREKIDRQMREMEEMKKEMKDEVSHSLSSLQVETYGVNQSELEP
                     TVGQGVAGVLALLRHQGALKARTAEDEERERVQKQKDLWLADYRRRMAQRELERIQAR
                     GGNKDQAQREWENRMREQQEARDALDIYKNYKPDVNIAYHDEFGRRKYKSFYPILGAS
                     "
     gene            complement(<989592..995679)
                     /locus_tag="CNI03680"
                     /db_xref="GeneID:3259423"
     mRNA            complement(join(<989592..990313,990366..990577,
                     990629..991967,992027..993135,993200..993744,
                     993801..994799,994848..994910,994960..995123,
                     995175..995280,995331..995390,995446..995537,
                     995606..995679))
                     /locus_tag="CNI03680"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543047|gb|CF688888.1"
                     /transcript_id="XM_572939.1"
                     /db_xref="GI:58271565"
                     /db_xref="GeneID:3259423"
     CDS             complement(join(989592..990313,990366..990577,
                     990629..991967,992027..993135,993200..993744,
                     993801..994799,994848..994910,994960..995123,
                     995175..995280,995331..995390,995446..995537,
                     995606..995675))
                     /locus_tag="CNI03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572939.1"
                     /db_xref="GI:58271566"
                     /db_xref="GeneID:3259423"
                     /translation="MSFIGAGELEHKITQLQRQLSHKDHELNSIKNEQMKKQENLEEA
                     KRAKQTAEYKLRDEADRALKAENDSLAKTNELAQLKLKLSNLEASLMQTSEKLKKEEK
                     EKANIQDALDEALSRGSDGAATQIKSQQARIKQLEDNLRKTEDEKDRLRHQASSGDSW
                     GSDEPLSHRERNRLMALQNENAELKTKLESLSPQNVTTSDSFNPESPQKSSKPRASVT
                     AADLRDLETQVDKLKTQLANTKREYDKAVNEKLAAEISARKTAERFENEMYELNGELE
                     YYRRSDGGVDMKQLNELKKTAQDARAEKEELSKKLAQKEREVEHHVSEMARLEEKAQL
                     VQKLKEELEEERQTRQQLEAASNSASFVDEASLAKINALEVELARSKAASSTTAGSRS
                     GDSELRQVRRDLQKALRDKEYLESLVKENDELLAEKDEELARMRAAVPLPGSPSLDSQ
                     AADPGLVAALEEEKAALIDDLEKQVRAHEEGTLRIEAQLAEKTKELEVLRESEQLLRE
                     QHLRGQTEIESIKAQHQFVIVDLQKARDDLSIKEANAQQIIEQLAQVQASLNEHQAAA
                     ISAREEAASTAKQLTELGVSLENKNRELEEVLQQRRALEVSLASRSHDDAEFDEHVLS
                     IKKLQDEISRVSQELSDRTTANAQLINRLAVAEETREASERMVQELEHKVSDSQRKVE
                     ISMEELEVHRAQSKEAIESLNTQLETLNTELTSLEQLVRDKTTELAEVNRLSEQTSCR
                     LAESETTVITLRNQVAELECKLDESAAENVSENDDERIQLRKEKEALEEALQLAKKEH
                     ESELAAIEADSQKALSNAQIHIDTLQNLIQDAPQPNTKDVDVIHKFEEKIGRLRIERD
                     ELRHNISFVQNERHFAVRAANAEKETAIEEVGKAREELKRTSAICERLQQEMEEFRAA
                     LAEKDVEFGDAIATTREVANEKEKLAKQLADIEHELSSSHEAVSTQQTRVFELESQLQ
                     AQEANLKQVEARAGLLQTELTNVLHHMAQSKKLSDRPESRASVPEEEDSDLPKDLAGA
                     VSSQNRRHSHRRSTSGMSITMLQNLQTERNLQAKIDRRDARITLLTNDLSKVQANLTL
                     LQSAQEETMAENAELEEEREKLLSELHEIKAQGADPEALQGCILALILHHRHVRNLES
                     QLRLAREILHKSRETERQLFVSEIEAKKKKVADDKRIAELEYEKTEVESQLNSAKANE
                     QLVRKELDDALASVNNLQSQLTKAESASVLAAESILSLATVEAQIAEKEERIREIEAH
                     NTELVSKLEKLEEELTANKLEKEIKTEALTTKVVELEQKMVDRGAELERMTQEKEQLL
                     EELTAAEKTLADGFADVEAQREALDTTRRELEERLALMGHDMKEKSSELEEMINKSNA
                     LAAELAAERSKSDQAGIALEEHQVTISQLQNDISALQKASQDVDSERQTLRAQISVFE
                     EKATAAEERIRQLQAEVGHCMGETERVKKELVDASSQLEKTMVEKEDLNARRTAEMEQ
                     ATEARMGMEKSLSEREQEISKLTRDLGIIQEELTAATSKLEQAVKESAFKQADIDNLR
                     AENVEVKQKLAKATISSVSSADEQLVADLKERIEDLEASLTQKNQEVDEADDQTREAF
                     KANVKLERKIGKLQRQLDQAQLELNTALNKLMSSQPIALAPVARSQPASSVAAQRTAM
                     PPPPMSTSAPTQSPALALSTAATRTPHTIPPNIFSPPTVPSSGQKRLREADDAEFAHK
                     PAEAIMLPPASVISPRKPFGTRPSFTPQRGISDKTYASKPIGVNANMTSEKAEEGLKK
                     PIDAGRNIFARSPSVSSDPIKRTGFPEPPTRTPFATMPRNAS"
     gene            996214..998107
                     /locus_tag="CNI03690"
                     /db_xref="GeneID:3259512"
     mRNA            join(996214..996440,996611..996778,996826..996856,
                     996914..997002,997058..997284,997343..997443,
                     997496..997635,997702..997801,997855..997887,
                     997943..998107)
                     /locus_tag="CNI03690"
                     /product="2,4-dienoyl-CoA reductase (NADPH), putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41544252|gb|CF690093.1,gi|41544256|gb|CF690097.1,
                     gi|41557140|gb|CF702981.1,gi|41557151|gb|CF702992.1"
                     /transcript_id="XM_572896.1"
                     /db_xref="GI:58271479"
                     /db_xref="GeneID:3259512"
     CDS             join(996420..996440,996611..996778,996826..996856,
                     996914..997002,997058..997284,997343..997443,
                     997496..997635,997702..997801,997855..997887,
                     997943..998028)
                     /locus_tag="CNI03690"
                     /codon_start=1
                     /product="2,4-dienoyl-CoA reductase (NADPH)"
                     /protein_id="XP_572896.1"
                     /db_xref="GI:58271480"
                     /db_xref="GeneID:3259512"
                     /translation="MTETASSKRRVVLMEERTTELYKLRGQVLEGVRARAQEPQKKSD
                     RLRGKVGIITGVGPETGIGTAASKLFAKEGIEHLYLLDYNDKGLPELVSYLKEHYPRT
                     KVTFVKGDAADHKAVSFLVDRTLEEEGHLDLFFANAGISQITKPVKGKSGNIMSFSQP
                     FKDVEEAEFNEIMRINALGVFVAIKYASIAMAKLCPEKGKSIPGGSIVLTASIAGLKA
                     NAGPIPYSASKAAVISMAQTAAYALTGLNIRVNAVCPGLIETDMTKPMFDFARASGND
                     SKIGQLNPTLRQGIGHEVAQAALFLVSDESSYVNGQALPVDGGLSASVPYVRSKI"
     gene            <998312..>999482
                     /locus_tag="CNI03700"
                     /db_xref="GeneID:3259635"
     mRNA            join(<998312..998461,998517..998585,998636..998881,
                     998935..999039,999095..999272,999331..>999482)
                     /locus_tag="CNI03700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572597.1"
                     /db_xref="GI:58270881"
                     /db_xref="GeneID:3259635"
     CDS             join(998312..998461,998517..998585,998636..998881,
                     998935..999039,999095..999272,999331..999482)
                     /locus_tag="CNI03700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572597.1"
                     /db_xref="GI:58270882"
                     /db_xref="GeneID:3259635"
                     /translation="MPYLTEEQKQRWKEDGYLVLPSFFTDEETKDMLNEAKRLCGEFD
                     IEGHPMTTFKTAADDAHIGDEYFLNSGDKIRYFLEPSSVTPATATTPAKLLVPPAQSI
                     NKIGHALAVLNPVFRKYTLETPKMSNLAKELGEQESPRVLQSMVICKQPRIGGAVPCH
                     NDSTFLYTDPPSAIGAWIALEECTPQNGCLSFLPGSHRLSRTSTRFVRAPNGGTTFVD
                     VPGVEPNTENWDEMEGWKEAACPPGTLVLIHGSVMHKSPPNPSDKSRLIYTFHMIEGG
                     KGVKYDERNWLQPTKEMPFPALF"
     gene            complement(999543..1001955)
                     /locus_tag="CNI03710"
                     /db_xref="GeneID:3259752"
     mRNA            complement(join(999543..999754,999843..1000077,
                     1000156..1000314,1000378..1000687,1000741..1001042,
                     1001105..1001371,1001428..1001479,1001535..1001576,
                     1001633..1001692,1001758..1001781,1001847..1001955))
                     /locus_tag="CNI03710"
                     /product="thiamine biosynthetic bifunctional enzyme,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530567|gb|CF676408.1,gi|41534591|gb|CF680432.1,
                     gi|41542159|gb|CF688000.1,gi|41552409|gb|CF698250.1,
                     gi|41553696|gb|CF699537.1,gi|41553702|gb|CF699543.1,
                     gi|41576640|gb|CF722481.1"
                     /transcript_id="XM_572595.1"
                     /db_xref="GI:58270877"
                     /db_xref="GeneID:3259752"
     CDS             complement(join(999607..999754,999843..1000077,
                     1000156..1000314,1000378..1000687,1000741..1001042,
                     1001105..1001371,1001428..1001479,1001535..1001576,
                     1001633..1001692,1001758..1001781,1001847..1001915))
                     /locus_tag="CNI03710"
                     /codon_start=1
                     /product="thiamine biosynthetic bifunctional enzyme"
                     /protein_id="XP_572595.1"
                     /db_xref="GI:58270878"
                     /db_xref="GeneID:3259752"
                     /translation="MPKPTLDYSLYLVTGRELLPPGKDYYESLEESLQGGVTLVQVRE
                     KYADTGEFIEVARRTKAICDKYNVPVLINDRIDVHLAVGTAGIHVGQTDCPIGLARSL
                     VGPDAIIGLSVSNVNEAKRAIQQGADYVGIGAVWPTNSKDVANKKMLGPDGVGEILDL
                     LHGTGVQSVAIGGIHLPNVAQLLHASIAPQSRNALDGIAIISDIVASLTPREAATNLR
                     EVVQSFKRARSQLSNLEAVYGTNLFSGPRGVDGFIKEAVHLMDVIKRETPLINQMTNN
                     VVINDSANVTLAIGASPIMATHPRDVHDLSPAIGALLINFGYDSYQCSFKSLMLMLES
                     STITDKAGMLVAGRQANINRKPIIFDPVAIGATPYRQETSVELLSHWQPTIIKGNAGE
                     IGFMARSTEVASRGVDSVGSGFSRPGAVVKALARKQAAIIVLTGEHDYISDGSTTLKI
                     SNGHHYLERITGSGCQLGSVIASFAATARLEHLAKHGEWENASQLVQGDMLAAAVTGV
                     LVYTIAAEVAAAREDVKGPGTFRAALIDELYNLTPEVLQQRAKVEIL"
     gene            1002213..1005353
                     /locus_tag="CNI03720"
                     /db_xref="GeneID:3259766"
     mRNA            join(1002213..1002552,1002604..1002782,1002838..1002908,
                     1002958..1003307,1003424..1003467,1003517..1003647,
                     1003722..1003879,1003985..1004650,1004738..1005003,
                     1005063..1005353)
                     /locus_tag="CNI03720"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41545063|gb|CF690904.1,gi|41566266|gb|CF712107.1,
                     gi|41566276|gb|CF712117.1,gi|41567925|gb|CF713766.1,
                     gi|41567936|gb|CF713777.1"
                     /transcript_id="XM_572593.1"
                     /db_xref="GI:58270873"
                     /db_xref="GeneID:3259766"
     CDS             join(1002246..1002552,1002604..1002782,1002838..1002908,
                     1002958..1003307,1003424..1003467,1003517..1003647,
                     1003722..1003879,1003985..1004650,1004738..1005003,
                     1005063..1005311)
                     /locus_tag="CNI03720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572593.1"
                     /db_xref="GI:58270874"
                     /db_xref="GeneID:3259766"
                     /translation="MIFPQSQSFTHLSTFPLPSKHYLHPKACNPAMDLIVLLSSYPAP
                     TTAPAPTPMQLHMMRMRGLGGNLKDEGKTKVSLWRTGGDKVWEIDVGGRVTGMAWMED
                     GLHLSLLVINSSKKTTETLSVHSGEVARSVPLELDVPDLQDGQWLDMEYRDSGLRWEK
                     PLNGSAPMIIDSLPRVTPVEPPKPVNVLPFMRPKEQVAPKPTLHPRLISFPALLPANP
                     PTPPTVLHIQPGHASSISLLTGTFQLPSIPSAELLSLAQVSDRITGLLDIVLRGLESA
                     EAAFRDGEKQTMIHREDLETCAKQQGRVAVSEWLGSRMTPRTIAKWESTMDSSYRTIQ
                     KLISESITPALERILLLLEEIKGWSLTRRYIENLNLGSSSAIQRCMDLVSGLGKLVEG
                     MRVRAKHEWMAASEFMKWLKYDDYPYAVHDLKYVWAFMENGFIRPPFRRHFPELIERE
                     RPPQDLLPEEFISRLGVKPEKRLLSEVLQETLTCLKKPPGSGSGCESQVMTSQSDRQS
                     ASQSISMSLTAAEDDSLFHDESGVANLSLSSSVDTVAAPKDDLAHREGEEGEKTVART
                     LEEEPWVWANTVVEKCEELVKNAAGKESRDVERPDRGVKEWAGMKDVRVVGGGGTWMA
                     LLSANSNDNEQMWIIYDHPEEPARITACQLHSEEESATCLAIQFFDDEELVLLLEETE
                     SGQRYLVTVRYADLLEDMSIVPEDMGMWDVSMLVEMGKREVTELPAIPIARCRPLATR
                     HPQTVSVALNGRKGRRLGCILVETEDDRQIEVLDLDADEDEEEEGEEPEEEDGIEYGG
                     QHWDGDVV"
     misc_feature    1005221..1005265
                     /locus_tag="CNI03720"
                     /note="GA-rich"
     gene            complement(<1005387..>1006154)
                     /locus_tag="CNI03730"
                     /db_xref="GeneID:3259546"
     mRNA            complement(join(<1005387..1005795,1005846..1005925,
                     1006101..>1006154))
                     /locus_tag="CNI03730"
                     /product="expressed protein"
                     /transcript_id="XM_572940.1"
                     /db_xref="GI:58271567"
                     /db_xref="GeneID:3259546"
     CDS             complement(join(1005387..1005795,1005846..1005925,
                     1006101..1006154))
                     /locus_tag="CNI03730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572940.1"
                     /db_xref="GI:58271568"
                     /db_xref="GeneID:3259546"
                     /translation="MALAVAVGATCVPSGLSSPPKEASIHHVTFHFYRSAVLLSLPNT
                     TTFTSLKSSLLPALQPLAQTLPISLPASPNDIQFWEFTNSSSAGEEGDAAAAGAAGEQ
                     KTLRCLENDPGIAGRDIKQLGWPRWKAILVRWVELPFLIAVGANHAMYSFKGEDGSFK
                     EPIYTIPDPDDDYGGSEAEA"
     gene            <1006953..>1008030
                     /locus_tag="CNI03740"
                     /db_xref="GeneID:3259402"
     mRNA            join(<1006953..1007900,1007980..>1008030)
                     /locus_tag="CNI03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_572591.1"
                     /db_xref="GI:58270869"
                     /db_xref="GeneID:3259402"
     CDS             join(1006953..1007900,1007980..1008030)
                     /locus_tag="CNI03740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572591.1"
                     /db_xref="GI:58270870"
                     /db_xref="GeneID:3259402"
                     /translation="MPKNVRDKGKGKETDEFLAAGGGEQRDDLWFSQGVNGDSPHSFL
                     PCTNIAYDHPTLPTIPPPIPHPNDPTLDPPINSTPEPTPRVLDVVRIPSSQLRFFPRA
                     RPSEPSSRASTEQDRPSPPGGNTHPDDNDEDGNDLSNALRRASITLNANRSDGNGPSI
                     VPNLFTLPEPLRPPPSNFSLPPAKPSHTRSKSTTVVRLRPPQPAPIQTGNNSSLANRL
                     SSFFTVPPPPTNMSPISGPSSAGAGVGVGVGAGSASGRLPQGKSRRSLESTGSHRTAT
                     PKSATSVTRRGSGIDPGTSTGKAGREQREEMELVTRVREGGRRVRRMIEEKGLPLF"
     gene            complement(1008189..>1009314)
                     /locus_tag="CNI03750"
                     /db_xref="GeneID:3259526"
     mRNA            complement(join(1008189..1008375,1008474..1008588,
                     1008658..1008733,1008825..1008886,1008956..>1009314))
                     /locus_tag="CNI03750"
                     /product="expressed protein"
                     /transcript_id="XM_572938.1"
                     /db_xref="GI:58271563"
                     /db_xref="GeneID:3259526"
     CDS             complement(join(1008220..1008375,1008474..1008588,
                     1008658..1008733,1008825..1008886,1008956..1009314))
                     /locus_tag="CNI03750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572938.1"
                     /db_xref="GI:58271564"
                     /db_xref="GeneID:3259526"
                     /translation="MAIPHTIQEQHPADPLLLLPIPEKLPPLPLPALPSLISAFEPYI
                     DPSKASSSSENEAIALPVLVSSMRQITRNAQVLLNAARLGAAEAREELDGVDVRLREV
                     EYERNRIREETERCMNYESSREPIDLPDVETFLASVDQTPKDDEGYEHALTILRLEHE
                     LEEILKREAQVAQLTKDRDAYIRAKKEIKIKTDAVDVHLAGFARAQRSKTLQMSMLLQ
                     FPVLRHHDYSKAQAPCSIHSKKKLYPALFIYPPLSRK"
     gene            1009510..1010243
                     /locus_tag="CNI03760"
                     /db_xref="GeneID:3259707"
     mRNA            join(1009510..1009660,1009753..1009862,1009931..1009992,
                     1010059..1010243)
                     /locus_tag="CNI03760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573017.1"
                     /db_xref="GI:58271721"
                     /db_xref="GeneID:3259707"
     CDS             join(1009527..1009660,1009753..1009862,1009931..1009992,
                     1010059..1010205)
                     /locus_tag="CNI03760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573017.1"
                     /db_xref="GI:58271722"
                     /db_xref="GeneID:3259707"
                     /translation="MPRLVPSFSSLPKTQPVQGYKHFLTPLRKLIFDYDAESPSQHGI
                     RSYIRKPLLDMARENPDVEIVVRRLKRGKAAVLRGHYVNGRDKVICVNKLEANEVANK
                     VGLLLNSSGAKIKHLKNLTLEAAPGAESARGIWSALHDKTRDGKGYQI"
     gene            complement(1010292..>1011337)
                     /locus_tag="CNI03770"
                     /db_xref="GeneID:3259369"
     mRNA            complement(join(1010292..1010788,1010852..1010959,
                     1011018..1011096,1011183..>1011337))
                     /locus_tag="CNI03770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572589.1"
                     /db_xref="GI:58270865"
                     /db_xref="GeneID:3259369"
     CDS             complement(join(1010384..1010788,1010852..1010959,
                     1011018..1011096,1011183..1011337))
                     /locus_tag="CNI03770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572589.1"
                     /db_xref="GI:58270866"
                     /db_xref="GeneID:3259369"
                     /translation="MSKQLIVFDFDWSFVDQDTDRWVFEVLSTELRRLLQSRKSAGTG
                     MQCTPDVVNDTMKDLYEKGFKKEDVLEALRILPVHPAMKRAVTSLKQRSAETTFLCLS
                     NSNEVYIGTILEKHGLTDLFSEIITNPAHWSEEAPDHLIIGRRLPASEPPHGCSVGCL
                     ANMCKGDELDRYLAANGGKDAFKKIVYVGDGGNDFCPLLRMRQGDLALVRKGLELDER
                     VKKEGEQCGLKVDVKFWEQAWQIDEYFQEL"
     gene            complement(1011552..1012339)
                     /locus_tag="CNI03780"
                     /db_xref="GeneID:3259582"
     mRNA            complement(join(1011552..1011669,1011730..1011738,
                     1011815..1011919,1011983..1012048,1012118..1012180,
                     1012301..1012339))
                     /locus_tag="CNI03780"
                     /product="expressed protein"
                     /transcript_id="XM_572628.1"
                     /db_xref="GI:58270943"
                     /db_xref="GeneID:3259582"
     CDS             complement(join(1011601..1011669,1011730..1011738,
                     1011815..1011919,1011983..1012048,1012118..1012156))
                     /locus_tag="CNI03780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572628.1"
                     /db_xref="GI:58270944"
                     /db_xref="GeneID:3259582"
                     /translation="MVYVIVVHLQSLPEHVEEIKAKLKEAAEVYRKDKETIDWHVMQD
                     PKDETKFCIVERYEQESSQQYHLSNPYWKTFDPYVVPRLARPMDLTRWEEF"
     gene            1012613..>1013834
                     /locus_tag="CNI03790"
                     /db_xref="GeneID:3259424"
     mRNA            join(1012613..1012791,1012857..1013011,1013072..1013357,
                     1013426..1013517,1013587..1013654,1013730..>1013834)
                     /locus_tag="CNI03790"
                     /product="2,4-dienoyl-CoA reductase, putative"
                     /transcript_id="XM_572626.1"
                     /db_xref="GI:58270939"
                     /db_xref="GeneID:3259424"
     CDS             join(1012628..1012791,1012857..1013011,1013072..1013357,
                     1013426..1013517,1013587..1013654,1013730..1013834)
                     /locus_tag="CNI03790"
                     /codon_start=1
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="XP_572626.1"
                     /db_xref="GI:58270940"
                     /db_xref="GeneID:3259424"
                     /translation="MSPPPPLTPDPKSTFRPDLFKGKVLFCTGGRSGICYQIVETMMS
                     LGVDAAIVGRDAKGLEESAKKLEASTGGKCIPAPADVRQPDQLKDAVKRTQEAFGRID
                     FVICGAAGNFLAPISGLSERAFRTVIEIDLLGTYNTLKATLPLVRASRGSYVHISATL
                     HYRGVPYQSHVGAAKAGVDALNHSIAVEEGPWGVRSNVIAPGPIAETVGMDKLGTKGR
                     KVEREVPLGRLGSTVDIANAAVFLFSPASAWITGATLVVDGGEHHIRSTMLPYPESLL
                     DPESVKSLIKPRL"
     gene            complement(1013980..1016247)
                     /locus_tag="CNI03800"
                     /db_xref="GeneID:3259625"
     mRNA            complement(join(1013980..1015289,1015340..1015656,
                     1015726..1016247))
                     /locus_tag="CNI03800"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41534461|gb|CF680302.1,gi|41534471|gb|CF680312.1,
                     gi|41541797|gb|CF687638.1,gi|41541803|gb|CF687644.1,
                     gi|41559905|gb|CF705746.1,gi|41559912|gb|CF705753.1"
                     /transcript_id="XM_572959.1"
                     /db_xref="GI:58271605"
                     /db_xref="GeneID:3259625"
     CDS             complement(join(1014036..1015289,1015340..1015656,
                     1015726..1016191))
                     /locus_tag="CNI03800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572959.1"
                     /db_xref="GI:58271606"
                     /db_xref="GeneID:3259625"
                     /translation="MPTQPPPTPWLPNTRFADQSLLLDAQPIFDVSFDDESMWGGETM
                     LVDNGNKTQENKNLEASDNVDAGDEATMNMTLDLGDYLPDEVDQKEVRQKDKTVSQGS
                     NRKRGLSEISTSAISTSTTISDSSTSSATATSRLAHKREGSPTPLSVAGPSKRPRRPK
                     EKNDDLFSRRLSDSNRRSSLTPIPQISIIMTPSSVVKTQEETRLKANKAPTSSVAFAS
                     SSSQPYNQSTTSSNTASARLKARLHADGSKSEPSNNSTSHHAQQPESSRPAQTVSEKS
                     SALSRYLAKSTVLAAKESHEVPAEKGNQKVPNPSATESSHTQQSSVPLPNTSQLQTVT
                     LTPQPYDNGEPAPDVPHNGSLKRRESRRSSIGEKVVNFISGLIRPATPATVEIYPKGQ
                     KDEEQTKEKLLFDPLKVAPTIDEKERVEATVSQSGRIRRKESEGVSHVRTLTKPVPFS
                     RPLHVRAPPQRDVEAKEQRAKQQPLVAKATVVAISKVPSRGPLQPSRTQPNTKPVSKT
                     GPSSPNSKNNPPHLRPASTSAFASAALAKLPPPGKGHKVAAEPIKVRDVEKIHDIAAV
                     RGVFERLSSTSSSLNRPPTTESCTKSHANRPGVLQRTVPIRGHTPGKSSALRAQQRAV
                     FDQAVKEKMEEKEKKEAEERQRKEMEEEMEYRRRRKETVIRANPVPDMYRGRRQ"
     misc_feature    1014095..1014186
                     /note="CT-rich"
     gene            <1016505..1017113
                     /locus_tag="CNI03810"
                     /db_xref="GeneID:3259624"
     mRNA            join(<1016505..1016507,1016589..1016762,1016933..1016975,
                     1017012..1017113)
                     /locus_tag="CNI03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_572624.1"
                     /db_xref="GI:58270935"
                     /db_xref="GeneID:3259624"
     CDS             join(1016505..1016507,1016589..1016762,1016933..1016975,
                     1017012..1017019)
                     /locus_tag="CNI03810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572624.1"
                     /db_xref="GI:58270936"
                     /db_xref="GeneID:3259624"
                     /translation="MKTSTLATTDPFQPASSTRKIGENKLLSARAKAAPYTKPGQGSK
                     KGSINPYGNKCIDCKGLCAICGNLILDTSRR"
     gene            complement(<1017642..>1024841)
                     /locus_tag="CNI03820"
                     /db_xref="GeneID:3259757"
     mRNA            complement(join(<1017642..1017772,1017944..1018106,
                     1018204..1018249,1018301..1018454,1018502..1018785,
                     1018839..1019091,1019191..1019623,1019677..1020735,
                     1020789..1022460,1022487..1023646,1023701..1024301,
                     1024354..1024671,1024762..>1024841))
                     /locus_tag="CNI03820"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_573028.1"
                     /db_xref="GI:58271743"
                     /db_xref="GeneID:3259757"
     CDS             complement(join(1017642..1017772,1017944..1018106,
                     1018204..1018249,1018301..1018454,1018502..1018785,
                     1018839..1019091,1019191..1019623,1019677..1020735,
                     1020789..1022460,1022487..1023646,1023701..1024301,
                     1024354..1024671,1024762..1024841))
                     /locus_tag="CNI03820"
                     /codon_start=1
                     /product="cytoplasm protein"
                     /protein_id="XP_573028.1"
                     /db_xref="GI:58271744"
                     /db_xref="GeneID:3259757"
                     /translation="MSSQQPYMASSYHSFRDSAPGPSRSQHVTGTWQPLPYIYSGFVI
                     YPFHPEVPPPTPTTLDETSPKLPPFVPQHGLDILPWSGGKPDLAGGDLYPQGERNPYE
                     IRLDIGDEFYAFEEYRCPIEEDGRGDLWYRGFVVQAVSITSLSPVIPSEAMSAQTVSF
                     PRPEPSVLTGIFPASVCHIRPGNENDTGELSIAYEKAIQAAEQRNRRVLEESDYNLRA
                     LGTGILSEMDTVKEEDEGYAGLVSKPQNFGLERGVVEVGSSEGRPVDALSRKGSKNSF
                     SKPNRPKSLVLEQRKTVIEEDKDQPPLPRLTAGDSTAGGQQWPLIDEIACAIREWYSR
                     LPTYLANREYRLFNTVTQHIDALSLGRRQLLSQMLSGDELVRVRRECVSRLVKCNVAQ
                     GLDVIVRNLEDGSVVVVDRERAYSGTKWVGGISCYVYQVRLAYIDVIPLDNVFAEVFL
                     TPQKAVFQSHTLTSSKGELSDLPAGSFYHLFLELRAFVANPCAPGETAELYFSLYNKA
                     DKRFISEEYCLILNHYGSPARDSEQRLGRIRTLFTDLKVEDLAPDTYLVCKIIRNGAM
                     KMRSDDSMLPASLSASVAGQRSSLYGISETGLSGHNQWRGDSLMNLTDDSFSVTSAYG
                     PETHRPPTTTGTTNAPSSTIGGGSGFGGKVRVRRPLGWAVMLLPPMSKLMGDGLDRDG
                     GGVEQSVKIYVPREEKDFAGMFDDVIHNRVKQYMDFSRYSSDVIRSYRAQSIVLYLKS
                     LRGPAPQLVREHPSLLLDIPLTSRLSFPDVVFPGHSRHDLYIKLCSASFTSAPSSSSG
                     SMRLKKNVSPGYNSDVQVTMEMRKADGTVVEDAIMAGGSGEPGTSQWNSMVFHHNDKP
                     VYDELVKIPLPVQLSEYHLFLTFGSKSKNKQMTADEAEKPFAFTYLPISTANIFVKDD
                     DHELVLYHMDKNFQSTPSLYFDAPHSAKDWAHDPVLPDTILKGMSPLRDRVMIRTRLC
                     SSVHTQDETLRSLFAWQTATESENAIGLCEMLKMFGFVEEEEISRFVPQVLDSLFGIL
                     VTSLSERQEQLNDLVFKGMVKVLTMANDRRFPNFKAILHMYTSKQFHFPAASFQLLRS
                     MKSVMALPHTKDYRLFLKVWHLFFQFIIRSREQDRGRSVGADVTSAHIEAEFQSQIKH
                     ILKEINNLMESPDKSLIGTQTLAVQHYANILPDLAHIFQPLEIAEIIIAFADTLSYAT
                     GSIAVYKLLLLLQVVKNTFEMSESRRLLVPAIVRWLKPHLGRFDEYSGGMEPDQTAKD
                     GRRMKWLECNRLAVTGLAWMTDKLQQCYVSPQVQANEDVKRQEEDNLEYCLTLLSGLY
                     SSYAELSNPRTLDAFHRQRSSITSSIWEDTPDIFPTSYPFALISQLPPPSLFEAHQNA
                     NDSGMSASELFNCGLAECAVVIVNVILATPVDSIIRWIRETLEIEGAESCGKLFIHSF
                     DFVKSVISFEAFPSQWLTLRSMCFSGLLKLLECIATVMEDDIFVPSPPKSTGNSIFPS
                     KIEGFDANLWRKCFELLCDFCGSEELTLEDQTPQRRRAEWIISGDLREGGARLLLRLW
                     NAVGWPLDIPGGHALRMGGYQTKFTGLGSKVLELCQSGHDVLCETAVEILFSLIYAEH
                     LLDKECTSIETEVFVTLDKLFTAEATPSSSDPTLKSYFVAELRNVFESSPEIHPSFTT
                     KLSSFLSQAEYFIDLLLALRDVPVGPLWHDERATAIYQLMNFVSAMGRKGLYVRYVHE
                     LVKNSKSVKNWLGAGLALKLHADIYKWKVGDEHWVDAGRWGDLELPAHTQAEAHEFSI
                     NLCQELITQHQRLTYDINMITELLGHQAKLWMTIGEAPRPKQEYFRVAYFGDILSLDK
                     NKDYVIRAQVGQKYTDFCDILQTKYRQATIHRSKIPPPESIKRGTDPVIWIMPVTPEP
                     DLTNPVFGENVSDNVQSYWRWNGIRRFSSVRPYLKDPGERETALAWTEKTLLITKDEL
                     PGVLCRGEIVNIRYEQIAPIAMAIMEIKAAIKSLQKSSRGENGRLPESKALGTAINNA
                     VDSPLFIEGTYLDSHPEDCEEIQQLKTAIIQYVRAIQDSLEVHKRICRDVAFYEILKN
                     PRLKASRPFRSAFTAHPPTVLSLTTENRTSLQRWVRRAIICLL"
     gene            <1025068..>1027285
                     /locus_tag="CNI03830"
                     /db_xref="GeneID:3259509"
     mRNA            join(<1025068..1025093,1025139..1025407,1025461..1025556,
                     1025611..1025760,1025811..1026188,1026244..1026416,
                     1026468..1026498,1026566..1026845,1026933..1027041,
                     1027157..>1027285)
                     /locus_tag="CNI03830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572897.1"
                     /db_xref="GI:58271481"
                     /db_xref="GeneID:3259509"
     CDS             join(1025068..1025093,1025139..1025407,1025461..1025556,
                     1025611..1025760,1025811..1026188,1026244..1026416,
                     1026468..1026498,1026566..1026845,1026933..1027041,
                     1027157..1027285)
                     /locus_tag="CNI03830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572897.1"
                     /db_xref="GI:58271482"
                     /db_xref="GeneID:3259509"
                     /translation="MPISKQFVRIAPLKATFTHTRFHLALRTVDHPVVYHRLLLFRIN
                     KPGAESSGSVIGQVSTGLSSWRAPELYCMEETCPHLGAPLSHAEIEDIEDTRAIVCPW
                     HQYDFGMFDRAFRQRLLTFIVDLKDGSSSTGLQACTYEVKVQGIEDEAEVWVEAPHTE
                     SFGTDADRQWELVEMRGVSEEFLDPPIPSLASLSVSGHCSPSSLPPHLSHSAPTLPDP
                     LPTSLLAFAHLILRTSDPQLKCLLTREAVTRLRAGQLKSIRPTKGEIKRERENGGLVD
                     EPPREVEIIAPGKTPRRGKGGSEKSRILMLHALANIEQYAIDLAWDIIARFAHVEVNG
                     ERLPVEFFLDWAKVAEDEAKHYTLLARRLVEMGSYFGAHTVHAGLWESATQTADSLSA
                     RIAIIHLVAEARGIDMNPLTLAKLQAAGDVESSKVLEIIHADEITREFPSGLRFVSDR
                     VDIHPKDVTTGHRWFTWLCAKQGLDPIATFRSEVEANFRGKIKGPFNAEDRLKAGLTP
                     DFYEDLTGQLGWKEELVKRAEKAAREAEGDEHLHPRLT"
     gene            1029726..1034985
                     /locus_tag="CNI03840"
                     /db_xref="GeneID:3259596"
     mRNA            join(1029726..1030498,1030564..1031106,1031172..1031290,
                     1031357..1032195,1032251..1032439,1032491..1032604,
                     1032657..1033107,1033158..1034392,1034446..1034985)
                     /locus_tag="CNI03840"
                     /product="cell division control protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41542973|gb|CF688814.1,gi|41542986|gb|CF688827.1,
                     gi|41552027|gb|CF697868.1,gi|41552037|gb|CF697878.1,
                     gi|41569527|gb|CF715368.1,gi|41572542|gb|CF718383.1,
                     gi|41572554|gb|CF718395.1"
                     /transcript_id="XM_572622.1"
                     /db_xref="GI:58270931"
                     /db_xref="GeneID:3259596"
     CDS             join(1031006..1031106,1031172..1031290,1031357..1032195,
                     1032251..1032439,1032491..1032604,1032657..1033107,
                     1033158..1034392,1034446..1034727)
                     /locus_tag="CNI03840"
                     /codon_start=1
                     /product="cell division control protein"
                     /protein_id="XP_572622.1"
                     /db_xref="GI:58270932"
                     /db_xref="GeneID:3259596"
                     /translation="MSISGPISRRRIGSVSQRGNESLPQLDIQSIQMPQNALALKTAA
                     LSTSTRSLHQICSILKKRLLCVDGFQPFLEQPPNAEPLDVVSHMCHLFRLGSPLCHLY
                     NLLIPSFVDPLSPLYADLPAPAKIEYDFPQFYDSSNGVRNWAKRPENAKPCQRYIAAF
                     CMAMKKRIEEGRWTSDMWALHELWGKSTGEDIEAYDSTGLMKVLSTVEEMLDNLPVSA
                     MSPISPQTPFAASGSIAQRAQSRQSYDLPFSMGGIGSGASAVANMAATMNGGVHIEAG
                     PSENSPTAVEMQRGLSTSLADANAFKSVEELVASEKSYVQELEILVRCSQEMLEAQLV
                     STETNHQIFSNLSKILDFHRKFLIKLETEYEPIQERGPGAWAEGVWGRPFILSEAEFD
                     CYGPYCANYLDAITVVNEQMPILMRGQELSPTERPCLDPQRELQAFMIKPIQRITKYG
                     LLLDAILHATAKHEYPFRPELEEASAAVKRIAAGINEVTDFKAKQATVRELIERVDDW
                     KGHDVDKFGSLHIDDHFTVTKADQPREYHVFLFEKMMLCCKEITPEKKKQNKNSSMLR
                     KDRGTSKSGPLDKKKLALKGRIFVSNIKEATILPSEPGDAYGAARLLIGWTIPLRNQD
                     GYHDDQEDSFVMIGKSEEQMRKWSEKVLELANNERKIQEDMRAARMKAGRLSNSERQY
                     YQHSSFGPPTPATEHPPVSPFNMPPLPNGSTTPYYSEDEDPEGLRSGRTTPSIQGYHP
                     YAYSGQPSTGRRVQSQQSVTSVLPTELRARAMTEDQYGPSMTQWRTQQPTAPPLPRLT
                     SAMSGMSVASEISFGSGPGSTGIRTGMVRQMSSTRLPRATEVDEGEGNPMDTRESYGR
                     YGSLRGMMRAPSHAMPSVPHPPPLRNRSASSPNVYQQPTVTGAVSLPYTAGPNGTWTT
                     SPLASTLQMSTHPYVQSTPVPGFGPSSSTTLVGGTAYFNKRMSNEKRSSGESHHSTTT
                     TDTSDQTSPATPYGSGNGDVRGPLRQNSGDNVSGSVLVKLRFGNDQFVLGVSQEIDFI
                     TLYQKIHKKIRLCSSSNRPANVHDKLQIRYVDNDGDEIQVKFDSDVELMFEDARDQAG
                     HINLIARWAEDRRGSPQGEIY"
     gene            complement(1035296..1038816)
                     /locus_tag="CNI03850"
                     /db_xref="GeneID:3259788"
     mRNA            complement(join(1035296..1035654,1035710..1035808,
                     1035859..1035929,1035982..1036229,1036280..1036341,
                     1036399..1037516,1037558..1037741,1037792..1037851,
                     1037906..1037934,1037986..1038171,1038232..1038295,
                     1038355..1038816))
                     /locus_tag="CNI03850"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531913|gb|CF677754.1,gi|41531921|gb|CF677762.1,
                     gi|41567546|gb|CF713387.1,gi|41567557|gb|CF713398.1,
                     gi|41568375|gb|CF714216.1"
                     /transcript_id="XM_572957.1"
                     /db_xref="GI:58271601"
                     /db_xref="GeneID:3259788"
     CDS             complement(join(1035547..1035654,1035710..1035808,
                     1035859..1035929,1035982..1036229,1036280..1036341,
                     1036399..1037516,1037558..1037741,1037792..1037851,
                     1037906..1037934,1037986..1038171,1038232..1038295,
                     1038355..1038735))
                     /locus_tag="CNI03850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572957.1"
                     /db_xref="GI:58271602"
                     /db_xref="GeneID:3259788"
                     /translation="MTATPPGRIALPPKPTITDILGGSSALASDTPSPQAHQSFNSPH
                     SSAVNGHSRGTIPRSKARTKSARLSFSSYGRGRAASSRGPAGGIVDDLLDDEDFGPKL
                     PTLVPGIRAAYATPLPALPMIVMCIAMLSELLAANLCTPFILKQVEGFFLNSGREKNS
                     ETEAAVGLWTGNLVSVFFITQFFTSLLWSSIADRHGRRAVLVASLAGSAIALVIFGTS
                     ESLPEAICVRLIQGIFGGAVGVFRGSIRDLTDDTNAARAYAMLGFSWGFGGVIGPIIG
                     GVFESPKENFPGTALAQIRKMTGILTLFQNFPYILPTIIGGGVLAVGAILSCLLSWDG
                     GVRGGRRITLAVEKNEPLAGISPAAGRHASPAPSSRTAIRVPSVSLRRVLSPSQEEED
                     AAHGAGYPELSRSAGGRRDSRASLGTAYGYGGIRSKHPTLAARAALEAARRASAAVGR
                     PDESDEEDGEMGNRALKVAQRLLLANEENTFNINDLWVSAAVAQDTAVFDDEEETEDD
                     QEEEVNEAVPDTSFASPSLHALSPSTYDGHQGDLSFRRSSRARLTSVGNISLHRNLPG
                     HRLSVSHGGRRFSTTSGHMPAIFSNTGVKTPPAVAAAYEAESPRHEADSFFRAASPSP
                     DHGRGSTGGLSAIAEGPGNAVDSATAGVAAQISEKEASSFSLLPVQVIIQYGLLALHN
                     TIHDQIFLSFLVTPYRSGGLGLNPAHFSLVVALMCLCQLVYQFYIYPRLGPPLGRFTH
                     LQMFRIGCALYLPAYFSLPILHKIASPDSEGSFFLMFCLVTITAVRYCAGTFSYTSVM
                     VLINAMSPPHVVGLANGLAQSTVSFSRFFGPVIGGAVWSASINGNPSGYPYGFYFCTV
                     ACFIQWSLSFFIR"
     STS             1039965..1041535
                     /standard_name="ha3112"
                     /db_xref="UniSTS:515652"
     gene            1040053..1043033
                     /locus_tag="CNI03860"
                     /db_xref="GeneID:3259508"
     mRNA            join(1040053..1042163,1042214..1042355,1042405..1042654,
                     1042712..1043033)
                     /locus_tag="CNI03860"
                     /product="chitinase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531026|gb|CF676867.1,gi|41531688|gb|CF677529.1,
                     gi|41531693|gb|CF677534.1,gi|41531760|gb|CF677601.1,
                     gi|41531765|gb|CF677606.1,gi|41532337|gb|CF678178.1,
                     gi|41535252|gb|CF681093.1,gi|41535262|gb|CF681103.1,
                     gi|41536051|gb|CF681892.1,gi|41536059|gb|CF681900.1,
                     gi|41539802|gb|CF685643.1,gi|41539811|gb|CF685652.1,
                     gi|41540430|gb|CF686271.1,gi|41540435|gb|CF686276.1,
                     gi|41541509|gb|CF687350.1,gi|41541519|gb|CF687360.1,
                     gi|41549962|gb|CF695803.1,gi|41551465|gb|CF697306.1,
                     gi|41552119|gb|CF697960.1,gi|41552122|gb|CF697963.1,
                     gi|41552127|gb|CF697968.1,gi|41552132|gb|CF697973.1,
                     gi|41553783|gb|CF699624.1,gi|41553796|gb|CF699637.1,
                     gi|41557160|gb|CF703001.1,gi|41557166|gb|CF703007.1,
                     gi|41561709|gb|CF707550.1,gi|41561720|gb|CF707561.1,
                     gi|41562062|gb|CF707903.1,gi|41562078|gb|CF707919.1,
                     gi|41564120|gb|CF709961.1,gi|41564129|gb|CF709970.1,
                     gi|41564337|gb|CF710178.1,gi|41564351|gb|CF710192.1,
                     gi|41564847|gb|CF710688.1,gi|41565184|gb|CF711025.1,
                     gi|41565201|gb|CF711042.1,gi|41565291|gb|CF711132.1,
                     gi|415"
                     /transcript_id="XM_572898.1"
                     /db_xref="GI:58271483"
                     /db_xref="GeneID:3259508"
     CDS             join(1040267..1042163,1042214..1042355,1042405..1042654,
                     1042712..1042906)
                     /locus_tag="CNI03860"
                     /codon_start=1
                     /product="chitinase"
                     /protein_id="XP_572898.1"
                     /db_xref="GI:58271484"
                     /db_xref="GeneID:3259508"
                     /translation="MLLSTPAFLSFALLLVSQSSAQGHTAPPGRHRHPRIFKDLQERG
                     QLDERLLPITATTTVVVPMTATRTIWVDSTQLVLGDGGNDGDNDASGDVSSVWSSQAS
                     QSTEGASTSSEAMLPTASASSSVSDLTSSSYDTDAQSSSFVTGSYIEDVTATSSLLSD
                     SLPTSSSISSDYPSLSVSQSEASSSTTGVATSSATVTDSSFSTFAEEPASTGSSSSQS
                     IAADSAPSSSASTSASTGSSSSRPTSLPQTESATKSEDLGAASTNIASNATVSDNVSV
                     SESQWASVTSTKSSSISETGSASLSGSESVSLSDSFSISATSTDSAAVIGTASSSYSR
                     FESSATASETASASANETGSKTKSHGNWWETSTSSSAWASSSLSASESASESASLTAS
                     GTVSVSDSSTWPESASVSSAATATTFESSTSISATSTSTSSSSSPTSTLASTLMLGYY
                     PDWSAYYLSPESVDWDRFDILDFAFAIPNSDGSLYFTDDSSTDSLQRLVTTGHAAGKR
                     VKLSIGGWTGSAYFSTIVADDSLRATFVSNIYDIYNQYNLDGIDIDWEYPGTAGADGN
                     AVSSDDSANFLIFLQDLRAALPSEAIITSATQVWPFADSNGNPMTDVSEFAKVLDWIL
                     IMNYDVWGSSSTPGPNAPLSDGCGNSTQPLANAYAAVSSWTSAGMPANQITLGVPAYG
                     YIQVSSASSLIQRRSLPLLPHKRSKHAKKASYVTVQNESGGTTDGQVMWYGLLNQGAL
                     TLSDGEYVATGGFTRHWDDCSSTPWLKSSESGQIVTYDDPQSMNLKAQFAAQAGLRGC
                     NVFSVDGDWTGSSWPLTDAVRSGLGLPAV"
     gene            <1043337..1047287
                     /locus_tag="CNI03870"
                     /db_xref="GeneID:3259784"
     mRNA            join(<1043337..1043494,1043555..1044260,1044309..1044671,
                     1044719..1044984,1045197..1045349,1045437..1045735,
                     1045758..1045858,1045915..1046015,1046063..1046151,
                     1046204..1046367,1046422..1046496,1046546..1046672,
                     1046724..1046781,1046844..1047287)
                     /locus_tag="CNI03870"
                     /product="spindle pole body duplication -related protein,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41557805|gb|CF703646.1,gi|41569412|gb|CF715253.1,
                     gi|41569415|gb|CF715256.1"
                     /transcript_id="XM_573018.1"
                     /db_xref="GI:58271723"
                     /db_xref="GeneID:3259784"
     CDS             join(1043337..1043494,1043555..1044260,1044309..1044671,
                     1044719..1044984,1045197..1045349,1045437..1045735,
                     1045758..1045858,1045915..1046015,1046063..1046151,
                     1046204..1046367,1046422..1046496,1046546..1046672,
                     1046724..1046781,1046844..1047240)
                     /locus_tag="CNI03870"
                     /codon_start=1
                     /product="spindle pole body duplication -related protein,
                     putative"
                     /protein_id="XP_573018.1"
                     /db_xref="GI:58271724"
                     /db_xref="GeneID:3259784"
                     /translation="MFMTSTSSSRSAYTDSTTLAVDLDIVEEIFQRGRYATSFPQVFK
                     SYTEVLQEHGISATNDSVYYNFLLKVGVLKASTWGDKWDLWKSTRLNQTLPSSASVSR
                     INQEDFGNKKSQKSFASSHLPEVRKRVPFLASASSDLDEGYTGGEESEASIRASPRIQ
                     LVKKEIADYTPVETVDVTGEDLLSFDPPIRTSTPIFAQYPQSGYPPDYTASDVSQDLE
                     QATEEFSTLGLSTPKAQTKQTLQTVSWVDRIDDLPLEMKRQMEQKADTFYMYGLTWRC
                     WNMWFKTSEWYRITYKNIITARNNLLLRQMLERWHKSSRRLLSLPPIADRHREQHLKS
                     ATLKTWMTKLKERDLDRMEQRLTRRKEVERIRKALAHWKRKWDDRRTERWKKDMAERE
                     LGFIERRRENHILTVFQHWRVEARLRYLKAFKEQGLILSIFYAWHDLTTKQRYLKSIL
                     QDIQLRQKEDALHLWQKMAMLKPKEKLAIDTGKGRLLARVWNDWNVAKSETFDKLRLL
                     QTSLKQWRIASRESLFNQIREKRLQSRAFVVWKGEMDRVEKRQSHALSSHFIRWRSHL
                     SSLQTLSLQARLVHKQHLVINCFSKWKASSRTVIANQALADKAHGFFALRMAFKTWGV
                     QYRRRKATAWIKEKEKERLKPIFDNSDGANDVAGWRVLAKRYRGLEKRETAFQRFVEE
                     RTKERLLAKWTERVVEVKDLELKIVRQRDEQTVKNALGRWKSHLEEIRASKKKADDFL
                     EIRENENLRRAFRFWRSQAKRSKRLRLASERSIIERKNKLLRCIWDKWWNRKREKDLD
                     DIRKEVEFLHENVILYGVMDKWKANTHILPGITADSQRVKSKTWATWERALERRKWAK
                     AMRKEWDQKLLAEVFRLWKEAAAHKSMLNARKHRGRPRPSGSTPTTTTHTIGARRSLP
                     LTHSCDPAPSSSHILLSAAASGTSASGRTQSNQHRHDARGSESVASEPVYSRLREELG
                     RKRRGVSEEPAYGNMIGGESRNAERLETPRSGSEMLRALRGVMPGR"
     gene            complement(1047267..1048516)
                     /locus_tag="CNI03880"
                     /db_xref="GeneID:3259651"
     mRNA            complement(join(1047267..1047440,1047493..1047917,
                     1047974..1048101,1048158..1048308,1048364..1048516))
                     /locus_tag="CNI03880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572936.1"
                     /db_xref="GI:58271559"
                     /db_xref="GeneID:3259651"
     CDS             complement(join(1047392..1047440,1047493..1047917,
                     1047974..1048101,1048158..1048308,1048364..1048438))
                     /locus_tag="CNI03880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572936.1"
                     /db_xref="GI:58271560"
                     /db_xref="GeneID:3259651"
                     /translation="MSTLTDQEIMNLMENMENQENTSDKPLVSTPVPLSVIREEYLKG
                     SQQIVKKLDYLQENGWDQVWRARGDGDCFYRSFTLAYLLRILHSPEPDVEANLAYDAI
                     QRALPAMEQCGFQKDIYEEFLDPLLALIRSFAESDETTANEYSIVQALQDPERSNYIV
                     VSLRLITSSYIRTHADLFSPFLFSPTTFLPLSTEEFCRQEVEPCGKEADNAQIMALAE
                     AMNAGVRVAYLDRSEVGGKTINWVEFGKDTSENARPLTLLYRPGHYDVVTKDVPPKV"
     gene            1048792..1050355
                     /locus_tag="CNI03890"
                     /db_xref="GeneID:3259470"
     mRNA            join(1048792..1050066,1050132..1050355)
                     /locus_tag="CNI03890"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531216|gb|CF677057.1,gi|41531225|gb|CF677066.1"
                     /transcript_id="XM_572947.1"
                     /db_xref="GI:58271581"
                     /db_xref="GeneID:3259470"
     CDS             1048796..1050034
                     /locus_tag="CNI03890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572947.1"
                     /db_xref="GI:58271582"
                     /db_xref="GeneID:3259470"
                     /translation="MTQPRPYRAGLGLPQVMTITSDPAPPRSAHEDIHEYTSPPGSPI
                     QSSTDAPSQVSISGQPEKKAEHYVYESLPKHIAWREWNINPSRHGPERLKHPPVFVKS
                     QTVYDELGRSVVDGVGVEVSLGEKEEKPGKILHNGDSMKDWYLKLAKKSDAQQEDSQP
                     SNKPAIAVAKTTMEPANTVSDSKSSAEAIRIHRSEWFIRRALLSKSQTPNSTPEISKP
                     TTPSSISSLLTIPSQAQSKKMAPNYALGPENKGYGMLKGFGWGGGGLGKPERWEEENA
                     DTPKEDRKGKRRAESDDEIQEVDASGNAIIDLTLSSSEESSSEDEEALSGPGRTAPIP
                     TALKLDRLGLGHRSASESKITHTHKEIVQAQKRAKYGQRRTNKGEEKGEMGRKQKIDW
                     KRKDKREREERRRLVATLNS"
     misc_feature    1049930..1050010
                     /locus_tag="CNI03890"
                     /note="GA-rich"
     gene            complement(1050410..>1053365)
                     /locus_tag="CNI03900"
                     /db_xref="GeneID:3259796"
     mRNA            complement(join(1050410..1051362,1051416..1052190,
                     1052241..1052592,1052650..>1053365))
                     /locus_tag="CNI03900"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41543724|gb|CF689565.1,gi|41543729|gb|CF689570.1"
                     /transcript_id="XM_572620.1"
                     /db_xref="GI:58270927"
                     /db_xref="GeneID:3259796"
     CDS             complement(join(1050617..1051362,1051416..1052190,
                     1052241..1052592,1052650..1053365))
                     /locus_tag="CNI03900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572620.1"
                     /db_xref="GI:58270928"
                     /db_xref="GeneID:3259796"
                     /translation="MDSQPDEDQGDISLSLAAARTPTRRTSPSQPTPAIDLDVAVPQP
                     KRLFLEPQRARGVSTDKLISATTNTHSRNESAGNDLSDDGATTPESITRKFWDGKASD
                     IGPRPSSAQPPVSENPSQDAFSPFPAQPPARRTPSSLGRSRSLNVRMPSADTSCRQLG
                     SSSTPLSATEVCPTPSDKIGWARRPGEPRPPPLMSEDVARKMGRWVKEIVVCNFDLER
                     GPVVERRAGGRRWGLGEKENVAFSSFPDTSLFSEGTILFSFKIRHISPDPVTLAKPEP
                     LSPLPKEKSMEERLMDTTVQDTEGSPVDVMPGNGTVPALMSTGQKAEEYRKWDERGRE
                     WLYGFVWFEQRRDKRITRGYMQKSLVILTHLPFPALFSAVQQKIAPNFFEYGYSAIEA
                     ACHSIASWPDPTPDTVLHLPLLSDIITVKLPDTTENPQILKIAPASPLPVPILASLPT
                     SSPLRAFAPFIASLWSLWECLILAEPILIIAPDPRTCSEIVWWLRDFLRPIPPTGDFR
                     PYLHIHDHDLPLLINANKPQPGVVVGVTNPFFRNAASHWPNVISIPSQRGKRKPTGGA
                     GSGTGTIGGGVGGWEEPEGFISRRTRSVQKDRVLLKRLEGLIAEGKLDDPAGNEALRT
                     HFQQITERFLVPLNRYFQTLVPTRTPQPSSRSSSPFPTSSTTPSINTPNPTSTHLSPL
                     PQFPHPSPTFSLHTATSTAGIRPFSLPTFLSHLRTSGPNPLLFKTKGLTSKSRVENDF
                     YASFCMSPGFAGWLAGRVDSLRAVLGGGANGITGNQKPMRRGLNIVQKTPPRGKSPHS
                     QTRSVSTTVPASSPGARRLNARGGSEGSTPRPPFGRSASVGLGITGPVIYGEPETTRE
                     EDEEKV"
     gene            1053580..1055872
                     /locus_tag="CNI03910"
                     /db_xref="GeneID:3259461"
     mRNA            join(1053580..1054324,1054389..1054460,1054515..1054608,
                     1054665..1055872)
                     /locus_tag="CNI03910"
                     /product="transmembrane protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41536891|gb|CF682732.1,gi|41542215|gb|CF688056.1,
                     gi|41547317|gb|CF693158.1,gi|41562373|gb|CF708214.1,
                     gi|41574291|gb|CF720132.1"
                     /transcript_id="XM_572899.1"
                     /db_xref="GI:58271485"
                     /db_xref="GeneID:3259461"
     CDS             join(1053771..1054324,1054389..1054460,1054515..1054608,
                     1054665..1055666)
                     /locus_tag="CNI03910"
                     /codon_start=1
                     /product="transmembrane protein"
                     /protein_id="XP_572899.1"
                     /db_xref="GI:58271486"
                     /db_xref="GeneID:3259461"
                     /translation="MSSPPTPPTPSSPPSYTHLNTPPKAYPQPPTFHPRRSAAAIIPI
                     HSADDSDGTSTPSTSSLSPPSELDDEESVHSQDSCDQPCHPAHALPLHMRSNTLSRVP
                     SNASSLAEEGEATPLLSSGEDDGYRGKWYKGPLFVAAFKLGILFAVFTAIVGITFYWG
                     MPKLDDEDKGIIKLPKSFADLQALNALFQKYKHRYPLKLLACGVVSYLFVQTFSLPGS
                     MYISILFGAAYGIMYGLLLSCICESIGSLFCYSLSAVLAPPLLTLPFYRARVETWRTK
                     IMGDPKKGKKVTWDSIFAILLVLRIAPFPPHWIANFVAPHLGIGMFLFWSSCFIGIAP
                     VSVIHVTIGSSLDDMTSAADFHILSLRNILGLSAVIIAVLIPIGLKRIFKKDLGDLGE
                     AEEALASTRGGDREVNVPAVGQNHGRMYHAIDSGVVLATPSKGNGMDMRRKLVKSQGR
                     VLEIIPDHESDAEDREHVELDDHSPSPLPRQLISFDNIEEPLMDDNAPGPSSRSSLQS
                     TSHKDDYIVFDPANHFHKIQVKPYRPNTQKGYGTIEQPAPVMDDSERTTTAVGMGWWP
                     WARDGVA"
     gene            complement(1055834..1058094)
                     /locus_tag="CNI03920"
                     /db_xref="GeneID:3259607"
     mRNA            complement(join(1055834..1056442,1056682..1056696,
                     1056767..1056818,1057103..1057657,1057713..1058094))
                     /locus_tag="CNI03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_573027.1"
                     /db_xref="GI:58271741"
                     /db_xref="GeneID:3259607"
     CDS             complement(join(1056215..1056442,1056682..1056696,
                     1056767..1056818,1057103..1057657,1057713..1058068))
                     /locus_tag="CNI03920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573027.1"
                     /db_xref="GI:58271742"
                     /db_xref="GeneID:3259607"
                     /translation="MSSNPSHLLISRNPPRSPAHPQLDPALTSRHSSSRSDNRSSSGR
                     WVYAEDRPSRYLSEDDIDEEAELEDEGPIDVHPTFRSDAELPGKVKVIVGRNEFWCHK
                     EVLWFASPFFEGLLNGNWAESNPLHEDAYSRPSTVIETDVSSSDVPDVDGMASRLAVE
                     AKITTDQPAPAIMIEKLENNQAGNVTAAQGLEMNHGQDIQGPHSHSATVSDETQETFS
                     LREVPQDLTNTPVHRPTPHAETSSTTPTVISKKRDRTALRASFSSSLHSFQNFKSSPL
                     PGGAETVVELHEESASAFQDFLFWAYPHMEMQNFIGRPVGSCLINQRGMKRPDCPDPS
                     RCQSQLDDKWRQAHHAVIKYGPPQPSVAFRCLRQLETFPTNPSLVMPHALCQLAAKAW
                     VMSCRFFFF"
     gene            <1058599..1059238
                     /locus_tag="CNI03930"
                     /db_xref="GeneID:3259547"
     mRNA            join(<1058599..1058733,1058925..1059026,1059127..1059238)
                     /locus_tag="CNI03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_572618.1"
                     /db_xref="GI:58270923"
                     /db_xref="GeneID:3259547"
     CDS             join(1058599..1058733,1058925..1059026,1059127..1059222)
                     /locus_tag="CNI03930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572618.1"
                     /db_xref="GI:58270924"
                     /db_xref="GeneID:3259547"
                     /translation="MIPLGVELPWIGMQVKRLSRRELSFEVGVVDSRGREGVIRCSSY
                     KSLARKHEENEDHGSRKKRKTEVELPNGGFGSVSYSSAGEKTLEGMGRGVKDEWALHA
                     AQNISSLS"
     gene            complement(1059264..1061617)
                     /locus_tag="CNI03940"
                     /db_xref="GeneID:3259670"
     mRNA            complement(join(1059264..1059949,1060017..1060099,
                     1060160..1060282,1060333..1060415,1060467..1060477,
                     1060537..1060792,1060854..1060970,1061024..1061082,
                     1061128..1061382,1061439..1061617))
                     /locus_tag="CNI03940"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41552511|gb|CF698352.1,gi|41552516|gb|CF698357.1"
                     /transcript_id="XM_573026.1"
                     /db_xref="GI:58271739"
                     /db_xref="GeneID:3259670"
     CDS             complement(join(1059316..1059949,1060017..1060099,
                     1060160..1060282,1060333..1060415,1060467..1060477,
                     1060537..1060792,1060854..1060970,1061024..1061082,
                     1061128..1061382,1061439..1061602))
                     /locus_tag="CNI03940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573026.1"
                     /db_xref="GI:58271740"
                     /db_xref="GeneID:3259670"
                     /translation="MPICPVCDSSIDADQAAFEHHVNNHFVESAGTSSIGKETSKEGS
                     MKRGREESLVAPELDICPACDFPLSFLTPIESQTHLATCLSGQEIEDDVEFDYSSIDI
                     TAQQQRDNDVIDKEWDGPARPGKWTGWVGRKVEKGDRWWDPLNGSTVPSELPSNFSPG
                     VIIILAAALRTSAHQGKTRRAVLCRDTAHIKGVWKFDLGWGCGYRNALMSLTSLLSVP
                     SYAPLFSKSINGAEPGVRRVQGWIEEAWEEGYDPEGKQQLGGTVLGRRKWIGPSDLYA
                     MFTYKGIPCIIYDFPKPPSAKDDSKAAYARLQQWVKDYFNESTESPSNGSAFDVLMRS
                     GENGSGRGEVVRVSIKFPLILQHSGHSRTIVGYEENARGDVNLLLFDPGKTMPKDIRN
                     AALTHLAKSRAQALPLINTSLSTSGNDNAGNDERSRRPGGLRKKSSSQSQLEKTHESV
                     PFSPPFTNGRAEVIYDVDRDKNTSGVESQTVEHLRGGAQDGSDQGGKSPSTAIPIEDD
                     EEITPSGWVRKKRALKSKISSPSSTSRTLIDPTSPTQAIKTLNHFRVNLGNLSKHTQY
                     QILMFTGGPVLSDSEKERRKIVSSTVIR"
     gene            1061919..1063205
                     /locus_tag="CNI03950"
                     /db_xref="GeneID:3259743"
     mRNA            join(1061919..1062005,1062067..1062597,1062647..1063205)
                     /locus_tag="CNI03950"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41537012|gb|CF682853.1,gi|41537023|gb|CF682864.1,
                     gi|41542115|gb|CF687956.1,gi|41569923|gb|CF715764.1,
                     gi|41569933|gb|CF715774.1"
                     /transcript_id="XM_572949.1"
                     /db_xref="GI:58271585"
                     /db_xref="GeneID:3259743"
     CDS             join(1061931..1062005,1062067..1062597,1062647..1063171)
                     /locus_tag="CNI03950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572949.1"
                     /db_xref="GI:58271586"
                     /db_xref="GeneID:3259743"
                     /translation="MSDNRQDAQRELHTQVETNIEDSLGSALESSFNIPPPAPKPKVP
                     VPSQEKESAPAATASAPVPGLDEWPQTLQGYLDEWQAESATARAKAEATRKRFEEERA
                     AEAKALEDAKKAEKTNKEEEEKRKRDAERLRQELEGEEDEVQGGKGHGHGDKSRVKEA
                     WELVAKKEGQSKDTPVVETDVRGVTGEDVFAGQAGEKKEVKAPAYDPTTSTDPIPPIF
                     QDPKPVAPAPAPTESATLSRHSATSQAWEEISGQSSGSGEQVSPPRSSGSDDIVQVPS
                     NPEKAPEAPRPPTQPPSLTLTLFTNASSLSIPRIFAVIGINLVLPFINGVMLGFGEIF
                     AREVVKVGKAVWRGERSLFNWNRGSGLGGRGTTGVGLSGAGF"
     misc_feature    1062329..1062418
                     /locus_tag="CNI03950"
                     /note="GA-rich"
     gene            complement(1063196..>1063933)
                     /locus_tag="CNI03960"
                     /db_xref="GeneID:3259600"
     mRNA            complement(join(1063196..1063255,1063297..1063490,
                     1063541..1063875,1063927..>1063933))
                     /locus_tag="CNI03960"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_572934.1"
                     /db_xref="GI:58271555"
                     /db_xref="GeneID:3259600"
     CDS             complement(join(1063243..1063255,1063297..1063490,
                     1063541..1063875,1063927..1063933))
                     /locus_tag="CNI03960"
                     /codon_start=1
                     /product="ADP-ribosylation factor"
                     /protein_id="XP_572934.1"
                     /db_xref="GI:58271556"
                     /db_xref="GeneID:3259600"
                     /translation="MGVTFSSLWSRLFARKETKVLLIGLDNAGKSTILYRITTGAVVA
                     SAPTVGSNHEIYDYKGVRFGLIDIGGQTSLRSSWSQYFNGTEAVILVIDSCDGPRLGL
                     VKQELMKIVADESLSTALLLVLANKQDLPVSQGRLTPAQISEALSLTDLRQREWQIMG
                     CSALTGAGLMEGMDWLVTNNDR"
     gene            <1064162..1065161
                     /locus_tag="CNI03970"
                     /db_xref="GeneID:3259552"
     mRNA            join(<1064162..1064219,1064315..1064380,1064448..1064732,
                     1064886..1065161)
                     /locus_tag="CNI03970"
                     /product="small nucleolar RNP protein, putative"
                     /transcript_id="XM_572900.1"
                     /db_xref="GI:58271487"
                     /db_xref="GeneID:3259552"
     CDS             join(1064162..1064219,1064315..1064380,1064448..1064732,
                     1064886..1065088)
                     /locus_tag="CNI03970"
                     /codon_start=1
                     /product="small nucleolar RNP protein"
                     /protein_id="XP_572900.1"
                     /db_xref="GI:58271488"
                     /db_xref="GeneID:3259552"
                     /translation="MSGRGFSRGGGGGFRGGARGGRGGGRGGFQQRDMGPPDTVLEIG
                     SFQHDVESEMLCSLTAPTKIPYFNAPIYLQNKTQIGKVDEILGPINEVYFTVKMEQGM
                     LASSFKKEDKVYISGEKLLPIERFLPKPKVAGGKERGAQGGRGAPRGRGGAGSRGGRG
                     GFSSRGGPGGRGGARGGAGGRGGFSSRGGGAPRGRGGFRGRGQ"
     gene            complement(1065235..1067114)
                     /locus_tag="CNI03980"
                     /db_xref="GeneID:3259677"
     mRNA            complement(join(1065235..1065398,1065453..1066534,
                     1066588..1066787,1066856..1066968,1067023..1067114))
                     /locus_tag="CNI03980"
                     /product="translation initiation factor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41538072|gb|CF683913.1,gi|41538081|gb|CF683922.1,
                     gi|41542648|gb|CF688489.1,gi|41542654|gb|CF688495.1,
                     gi|41550380|gb|CF696221.1,gi|41550387|gb|CF696228.1,
                     gi|41571635|gb|CF717476.1,gi|41571639|gb|CF717480.1"
                     /transcript_id="XM_572932.1"
                     /db_xref="GI:58271551"
                     /db_xref="GeneID:3259677"
     CDS             complement(join(1065251..1065398,1065453..1066534,
                     1066588..1066787,1066856..1066968,1067023..1067111))
                     /locus_tag="CNI03980"
                     /codon_start=1
                     /product="translation initiation factor"
                     /protein_id="XP_572932.1"
                     /db_xref="GI:58271552"
                     /db_xref="GeneID:3259677"
                     /translation="MFDPRAGAPKRWASQSQDFQAVILVGYGENLYPFNQGTNVISKA
                     LLPVGNVPIINCVIDWVLAAGLLDILIIVPNAFHDQIADHIAEAYNKSTHSRVRINLR
                     KNSEGERDEDEGDSEEKDGTARILKKFRSFIKSDFVLLPCDISPPSYLPLKTILDKHR
                     SSPKAVMTSVFYEPIESVKDAEEKILVGLDKTSDELLLITPLEGMEEDLELRMSLLNR
                     HPTLSLTTRILDAHVYVFRRTFLDLLATRRAKDLSSMKEQVVPWLVKGGWQRGLGERW
                     EPILDPPSRDPLAEALARSTTAPPSRSLLHPSSSPSSDRTPLPQTSPASPSGDADTMY
                     SSGILPTAPSRTRKGFKPEWKCQVLVITPPPAPPAPAPVQGKGGKQDKSRAPVYEPEH
                     LIRANSLAGYWELNRRFIKSLSSTTPAAKSAQPVRNIIPEDAGTAPAISPAAQISPDS
                     VLGEGTRVGEKTSIKKCIIGRHCVIGKGAKLNNCVIWDFVTVEENARIENSIICSNGR
                     IGEKAQVKDCEFGTGFEAKPGAILKGERLIAGQEA"
     gene            <1067494..>1068857
                     /locus_tag="CNI03990"
                     /db_xref="GeneID:3259431"
     mRNA            join(<1067494..1067521,1067577..1067630,1067686..1067805,
                     1067849..1067922,1067979..1068183,1068238..1068456,
                     1068510..1068591,1068650..>1068857)
                     /locus_tag="CNI03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_572616.1"
                     /db_xref="GI:58270919"
                     /db_xref="GeneID:3259431"
     CDS             join(1067494..1067521,1067577..1067630,1067686..1067805,
                     1067849..1067922,1067979..1068183,1068238..1068456,
                     1068510..1068591,1068650..1068857)
                     /locus_tag="CNI03990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572616.1"
                     /db_xref="GI:58270920"
                     /db_xref="GeneID:3259431"
                     /translation="MDYVSVLPQDIDLSSSHQYLRIPHPRTGEAQLYLPYTTAAGQDV
                     VLEAAKLNGSQRRTWFIGDSGIDAGAMLVHYPIDPLFIVIPLILALVPNGPPPPFQPL
                     HDLLSAASTSTSFALPLPFTSGTKGKSPNRSEGVNEDIERLLTLKNVKRAFKACCEKK
                     VISTAPPSPDPSSSPQPPTQSFYRPSQDLIIQHLKRKAGFFAGPEEFEKFDHLVRGLG
                     RDGLLEKDIDEELLSSARLRAACDHLAQWLPGPVLSKLVKSYDFAALEEHLASRSAAA
                     FAASQITTSNNKKEAKGIKRKAPPASRGVESLKKVNTNKMAKLTSFFKPKEKK"
     gene            complement(1068950..>1071468)
                     /locus_tag="CNI04000"
                     /db_xref="GeneID:3259430"
     mRNA            complement(join(1068950..1069823,1069884..1069986,
                     1070075..1070709,1070762..1070822,1070871..1070972,
                     1071040..1071174,1071244..>1071468))
                     /locus_tag="CNI04000"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548612|gb|CF694453.1,gi|41548622|gb|CF694463.1"
                     /transcript_id="XM_572955.1"
                     /db_xref="GI:58271597"
                     /db_xref="GeneID:3259430"
     CDS             complement(join(1069111..1069823,1069884..1069986,
                     1070075..1070709,1070762..1070822,1070871..1070972,
                     1071040..1071174,1071244..1071468))
                     /locus_tag="CNI04000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572955.1"
                     /db_xref="GI:58271598"
                     /db_xref="GeneID:3259430"
                     /translation="MAHQITYDYVEHVDPNLTCAICQSALVDPVTTTSCKHTFCRDCI
                     TRAIVHNPQCPIDRSALTMSSLRDTEQLVKLMLDELKVKCGAEGCGTVLQRGLLLAHL
                     KTCSKAIVTCQDGDCGLSMTRQRLPHHRAYECFQRKMECRKCGTILVFKDQTTHTNIE
                     CRDETGVCGLCGQNMGPDAHMHKWQCPLVRIPCPHSARGCSSIIPRSDLQAHISICPF
                     EAFSGFFEMNDARLKSLTSRVESLEEELERMREHLKRIEGNVETMGNMRRETGDEWRW
                     REVGRMRLGDTPPPVASSHSDPQTTSTILSSPLTPTSSHPSPQPVISSIFPGISILSS
                     GGARPDLAPHHHRSLVAPSFGSHQSYADWAFSRLSGNAGNVGWEEVINGLRAHDLMKK
                     IHRRTMTESLRVLEEVGSLRAIVTTMRMLMMERPFRPPSFQFQGDSLFSRTAESTLTP
                     TLNQQATVAFSSTTDQSTSEQRSQSSDENLSVSVSGDQEDSGRETASITESVVFSAQG
                     HPASSSRPSSSTNSLITAGAGLSGNKRTPMSRARPNLGGYQGVTVEVRYDENADGIEG
                     GASYSRTSNAASGNRNTIGTSGAEMTGRPMAFPPASQDDDDVSATTNRNAGGDVNEAT
                     ERSMGTRERKVNLANPIARLMRRGPQGNGSPRL"
     gene            complement(1071683..1071772)
                     /locus_tag="CNI04010"
                     /db_xref="GeneID:3259802"
     tRNA            complement(1071683..1071772)
                     /locus_tag="CNI04010"
                     /product="tRNA-Arg"
                     /codon_recognized="CGA"
                     /db_xref="GeneID:3259802"
     gene            complement(1072024..1074508)
                     /locus_tag="CNI04020"
                     /db_xref="GeneID:3259414"
     mRNA            complement(join(1072024..1072431,1072483..1073239,
                     1073285..1074508))
                     /locus_tag="CNI04020"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538183|gb|CF684024.1,gi|41538190|gb|CF684031.1,
                     gi|41549597|gb|CF695438.1,gi|41549611|gb|CF695452.1,
                     gi|41551064|gb|CF696905.1,gi|41551071|gb|CF696912.1,
                     gi|41553661|gb|CF699502.1,gi|41553672|gb|CF699513.1,
                     gi|41568075|gb|CF713916.1,gi|41568080|gb|CF713921.1,
                     gi|41576540|gb|CF722381.1,gi|41576550|gb|CF722391.1"
                     /transcript_id="XM_572614.1"
                     /db_xref="GI:58270915"
                     /db_xref="GeneID:3259414"
     CDS             complement(join(1072055..1072431,1072483..1073239,
                     1073285..1074487))
                     /locus_tag="CNI04020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572614.1"
                     /db_xref="GI:58270916"
                     /db_xref="GeneID:3259414"
                     /translation="MDHLVLDPVIDPALADNSPQHTDDHHQPLQNSASTSPVAQPSQR
                     TTKTGRPSKARGTVPGSAADFRRREANRLAADRSRSRQAEKGAALENASRILSEENAR
                     LKEQIAALEGGIEGSDFQHGVQDAEHQPTPGPSRTEEPHDDDQQVSQESDTQAQEQEA
                     HSHTILAALTDITGVDFSEGNEANWMQGMETFLKDSESGRLGELAAVAMGHDDPQLQH
                     QEKADAPHTSPFKIGNMSIPFPLPGQMSIPGASAAIGLAAALNTEMERIIMEDLALTK
                     AAIVRVENQISHLRAHPDADIDAASNDSSIAPLLPKDIFSEDLEALQVVQTDIQNSIS
                     YLENTLPPVRDEFVRTRDDKTAEEKRIIDLVKEVKELEVRDEDQKEKVLSNLRSVGTF
                     VENLLTEEHPDNQYLTGAFSSPALARRRRGRPPKGEVSRTFYQSYLIGPLSQEVDPKG
                     KGKAPTAKNPRRSRLGESPLTGHASSHEQDDHHVAESSQSAQAHLPDSHEPGTLQAAQ
                     HDQDHPDEHDTTEAVNRAEAYILSHLNASNATDGQDADPHPEREDAIGLESTSFADFL
                     PAQEALERQVEGPASQHGNADAFGQSASSNGQNQELVHVSQGDHDVPLSVLSRLKQGP
                     PGSCDICMRTETTVWRKLVLGGIDHKVCNACGLYHSKFGVIRPPELWGDGKSLKKRRS
                     TRPATDEEDADAHAKKKVKKSIGEGSEQLESLDDEHQELGNMVENHLSAQQREEEEAA
                     TVTAGENVEGTIVDRSVIQGAVQPGIGMDEAEGNVFEV"
     gene            1074740..1076760
                     /locus_tag="CNI04030"
                     /db_xref="GeneID:3259780"
     mRNA            join(1074740..1075068,1075121..1075264,1075315..1075373,
                     1075423..1076760)
                     /locus_tag="CNI04030"
                     /product="ubiquinone biosynthesis monooxygenase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41539910|gb|CF685751.1,gi|41556811|gb|CF702652.1"
                     /transcript_id="XM_572612.1"
                     /db_xref="GI:58270911"
                     /db_xref="GeneID:3259780"
     CDS             join(1074768..1075068,1075121..1075264,1075315..1075373,
                     1075423..1076736)
                     /locus_tag="CNI04030"
                     /codon_start=1
                     /product="ubiquinone biosynthesis monooxygenase"
                     /protein_id="XP_572612.1"
                     /db_xref="GI:58270912"
                     /db_xref="GeneID:3259780"
                     /translation="MRPPTTIYKPGLSNALKVSSKPAISVPAITSRNLHLARPAFSSI
                     PLRATVSKSAHVTFKRSHSHHAPQPTEPIPEISSENTYDIVIIGGANAGLAFACALLS
                     QPTISQTCRILLVEGSSLDRTRNWPESSEWENRISSLTHENIEWLESIGVWRHITNDR
                     SCPVHEIIVWSNPSPTETPTIHFPPVGRPLARMTENLNLQKALLRRIEEAGKGIVDIR
                     ENSRVREMRLGEGGRWVGLRIGDEWVRGSLVVGADGPNSPVRHFSEIESYGHGYNTHA
                     VVATLNHDPDPLYPNTTAFQRFLSTGPIAFLPLSDTSSTMVWSTLPENAAALKKLSHD
                     ALTQMVNAAFTLPEETLSSLCEAMLSAQSEGTPLTAPQIVTLIATLPTPLTSSDQPII
                     PPAITSIHPPSVASFPLRISHATSYLGERTALVGDAAHTIHPLAGQGLNMGLADVKCL
                     AEVLEETRRLGGDLGSLEGTKGYPKERYPLNHLMLSATDKLHYIFRARNGLVNWVRGT
                     GFDVINELGPIKRILMGGAGSGVGLGGASARTEKEREFGRARAEDKLKPAGGWPMAVA
                     NGVEGWFALKGVMGMVGGVVGEAARNGLRRAADALDGKR"
     gene            complement(1076770..1079100)
                     /locus_tag="CNI04040"
                     /db_xref="GeneID:3259595"
     mRNA            complement(join(1076770..1076879,1076937..1077187,
                     1077251..1077585,1077640..1077822,1077873..1078316,
                     1078365..1078442,1078504..1078572,1078628..1078792,
                     1078857..1079100))
                     /locus_tag="CNI04040"
                     /product="conserved hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41538577|gb|CF684418.1,gi|41542428|gb|CF688269.1,
                     gi|41552619|gb|CF698460.1,gi|41552985|gb|CF698826.1,
                     gi|41573081|gb|CF718922.1,gi|41573516|gb|CF719357.1,
                     gi|41574723|gb|CF720564.1"
                     /transcript_id="XM_572930.1"
                     /db_xref="GI:58271547"
                     /db_xref="GeneID:3259595"
     CDS             complement(join(1076866..1076879,1076937..1077187,
                     1077251..1077585,1077640..1077822,1077873..1078316,
                     1078365..1078442,1078504..1078572,1078628..1078792,
                     1078857..1079045))
                     /locus_tag="CNI04040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572930.1"
                     /db_xref="GI:58271548"
                     /db_xref="GeneID:3259595"
                     /translation="MSKAGNYLKTAISMVTSLEEGKPHSSITDWIEVLSSDRYEELSL
                     DGISELVESVNILGSQGTTEASRAIRKKLKYGNVHRQIRALVILRALTENAGKGFQLN
                     WANEQLMERLRLMAADQLTDPKVKRMLLLVFHAWSLQYKDEPRMHEVAGLYRKYTGHG
                     TRPAPRKPTTASSPTTATSATAGHGTFDDIFSHDWNPAPGNRGADTYTDLAAAKADAE
                     ERKRAREARIALEQREAEIERRERELRRKRDMAEIEERRRKDAAEEAENRRKLKEQGK
                     KKNQQPKRLPFSFEKEKPQIMVAVANAIQCANNLVNACRLVNREVENVTESPKVQDNL
                     DKAKVARRSVIKYIQLVTDEEYVGTLLDANERIVEAIQLYDRLSKPAVLDSDSEDDAA
                     DVSALHKRLAAQKLEADRTGELQKIQEDQKRESARRQQRQLLRQASETGTPVRGTQQP
                     SSTYSDLQDLDFGSIAHTQANLPPPMRPDSGDDESYGGSLSDFSDYDSSDAEWQAVHG
                     SGSVANKGAPTAGPSSRVPRQYASLEDDYPGQSGLLAKEDDNPFGDPFADELDTPVQE
                     KQRLQWAEI"
     gene            <1079285..1080775
                     /locus_tag="CNI04050"
                     /db_xref="GeneID:3259445"
     mRNA            join(<1079285..1079305,1079352..1079436,1079485..1079658,
                     1079714..1080539,1080590..1080775)
                     /locus_tag="CNI04050"
                     /product="conserved protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41546094|gb|CF691935.1,gi|41546605|gb|CF692446.1,
                     gi|41565498|gb|CF711339.1,gi|41565505|gb|CF711346.1,
                     gi|41571653|gb|CF717494.1,gi|41571665|gb|CF717506.1"
                     /transcript_id="XM_572610.1"
                     /db_xref="GI:58270907"
                     /db_xref="GeneID:3259445"
     CDS             join(1079285..1079305,1079352..1079436,1079485..1079658,
                     1079714..1080539,1080590..1080662)
                     /locus_tag="CNI04050"
                     /codon_start=1
                     /product="protein"
                     /protein_id="XP_572610.1"
                     /db_xref="GI:58270908"
                     /db_xref="GeneID:3259445"
                     /translation="MSSERVRGIQVHRPIIFGSHARLLTEAEKQLAPAGHTHKWTVFL
                     NSAASPPLKQGEPPDYEDIDYLPGGADDLSYFIRKVTFKLHETYATPNRVIDKPPYRV
                     SETGWGEFTVQIRIQLIPESSEKPLGLQHNIKLHHWGAPVEPLPVVSGAPTPTPVPTE
                     SNTEVKLEPDTPAPLEESVTPAPTIQRPASEPATNEPGSNQGTPAPPGGDSTEQIKVD
                     VATPALEVIEPSATPAPLSLAARLPIHAWQYDEIVFSDPPRQFLDILNAHPPTPLPAK
                     SRRPRDQREDYEARKKGKSAARGASVTASARASRAGTVDTAAAGTPAPAQIGIPGEPG
                     SADVPLEFTQEMLKGEHNAMLDARVKIVEQMDRWRERLIALEKELAKAKEDVKATAAM
                     "
     gene            complement(1080669..>1081964)
                     /locus_tag="CNI04060"
                     /db_xref="GeneID:3259484"
     mRNA            complement(join(1080669..1080844,1080896..1080973,
                     1081029..1081157,1081215..1081362,1081421..>1081964))
                     /locus_tag="CNI04060"
                     /product="mitochondrial genome maintenance protein,
                     putative"
                     /transcript_id="XM_572928.1"
                     /db_xref="GI:58271543"
                     /db_xref="GeneID:3259484"
     CDS             complement(join(1080784..1080844,1080896..1080973,
                     1081029..1081157,1081215..1081362,1081421..1081964))
                     /locus_tag="CNI04060"
                     /codon_start=1
                     /product="mitochondrial genome maintenance protein"
                     /protein_id="XP_572928.1"
                     /db_xref="GI:58271544"
                     /db_xref="GeneID:3259484"
                     /translation="MSLLASTARRAPNSLQLSTRNLSTTSARFAEAAPIASRYVRKTA
                     VPARAKPTAYSRPATFNSASTAASRTRPAPAARPVVDEFPEDLPLPSTEPPIDDYAHL
                     SAPPSAKVSPPLSELPSENYEPLPSATASARVGGKLAGEVPVGLDWSTSFSGLSEKPF
                     PKEAADELLKPLTPVDVEIKPDGLLYLPEIKYRRTLNAAFGPGGWGLAPRGETDVGPR
                     IVSREWGLVCLGRLVSVARGEQEYFDPSGIATATEACKSNALMRCCKDLGIASELWDP
                     TFIRDFKKQHCVEVFVEHAVKKNKKKLWRKKNSDKFEYPWKEL"
     gene            complement(<1082604..>1084718)
                     /locus_tag="CNI04070"
                     /db_xref="GeneID:3259476"
     mRNA            complement(join(<1082604..1083747,1083797..1084135,
                     1084191..1084524,1084571..>1084718))
                     /locus_tag="CNI04070"
                     /product="DNA-(apurinic or apyrimidinic site) lyase,
                     putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41545270|gb|CF691111.1"
                     /transcript_id="XM_572926.1"
                     /db_xref="GI:58271539"
                     /db_xref="GeneID:3259476"
     CDS             complement(join(1082604..1083747,1083797..1084135,
                     1084191..1084524,1084571..1084718))
                     /locus_tag="CNI04070"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="XP_572926.1"
                     /db_xref="GI:58271540"
                     /db_xref="GeneID:3259476"
                     /translation="MSRLPPVGHHKLRRLRCHLTRSIYRFSSMKKKNIEGLLDELDAQ
                     IFCFQEHKTVRTRLEKSMACPGPYDGFWTFPRSKTGYSGVCTYVDSRYCVPLKAEEGI
                     TGLLLGDRLSTMKPPWTDAERIGSYPDVNDMEWMDELDGTKFDVKKLDMEGRAVVCDF
                     GLFVLFNLYCPNETNSARRPYKMNYLHALQERVQLLQAAGREVMLVGDINIVRQPMDS
                     GEGPVRSSAEQHYSHPARRILDDWCAPKGPMIDVVRESWPQRDDMFTCWNQKLDARSA
                     NYGSRIDYVLCTPGLRPWIKGGDILPKVYGSDHCPVYVDLHESIVTPEGETLHLRDML
                     NPKDRPTSTSPVYPNDVKREAPEPPRFATKFMDEFSGRQTSLKSFFGGGSKRAQEKTN
                     GASLSTSVSASASPAPTPTASELSSAVQASESGATKIVSLPQAPEECVSAPFSLARTA
                     FSSLDNPSPVHSRELSSKTSDGAPVKATLSSKQDKSSAKPIDMTLDDDEDDEPILVSS
                     KSENKPPPKPTRSSLSGSKSASSQVKLSSFFSQPHTEGKRKSPPPPSSAPSISKRPSL
                     APLPQSNNAPFAASPSATTAEDECQGMTEEENQLISQAIAEADAERAEKNAKAAPQWS
                     SLFAKKLPPLCTVHHKPCKDFGKLPQWIFC"
     gene            1085010..1086865
                     /locus_tag="CNI04080"
                     /db_xref="GeneID:3259432"
     mRNA            join(1085010..1085225,1085277..1085336,1085390..1085454,
                     1085517..1085613,1085676..1085748,1085798..1085967,
                     1086019..1086323,1086381..1086468,1086523..1086618,
                     1086671..1086865)
                     /locus_tag="CNI04080"
                     /product="peptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531292|gb|CF677133.1,gi|41531298|gb|CF677139.1,
                     gi|41531300|gb|CF677141.1,gi|41531301|gb|CF677142.1,
                     gi|41542424|gb|CF688265.1,gi|41542433|gb|CF688274.1,
                     gi|41549060|gb|CF694901.1,gi|41549067|gb|CF694908.1,
                     gi|41551633|gb|CF697474.1,gi|41551644|gb|CF697485.1,
                     gi|41551733|gb|CF697574.1,gi|41551736|gb|CF697577.1,
                     gi|41554651|gb|CF700492.1,gi|41554655|gb|CF700496.1,
                     gi|41558387|gb|CF704228.1,gi|41558397|gb|CF704238.1,
                     gi|41574589|gb|CF720430.1,gi|41574597|gb|CF720438.1"
                     /transcript_id="XM_572901.1"
                     /db_xref="GI:58271489"
                     /db_xref="GeneID:3259432"
     CDS             join(1085029..1085225,1085277..1085336,1085390..1085454,
                     1085517..1085613,1085676..1085748,1085798..1085967,
                     1086019..1086323,1086381..1086468,1086523..1086618,
                     1086671..1086728)
                     /locus_tag="CNI04080"
                     /codon_start=1
                     /product="peptidase"
                     /protein_id="XP_572901.1"
                     /db_xref="GI:58271490"
                     /db_xref="GeneID:3259432"
                     /translation="MLITPAILALPLLASAVPTAKEQLAFQGSIGSAILEGQDIFAAH
                     DGFSLDLGEMRLVQFSEEEPPVWMSELEKIQAKAKGLRFMDITETPGLGFSSYFLPSA
                     ANVKYSYPTPGNHTKTISSIIKKLDIDHMKDFLTKFTSFRTRYYKSDTGKDSQKFLLK
                     TLKEIAKPHSGITVKEFAHPWGQNSIIVRFAPADPANEDAPITIVGSHQDSANMWPFL
                     PAPGADDDGSGTTSSLEGFRALVNANYTPSTPLEFHYFSAEEGGLLGSQAVAKSYEDE
                     GKKVLAMLQMDMTAWVKAGTEERVGIIQDFVDPDLTEFIETLVEEYLSIPPVKTQCSY
                     ACSDHASFAKAGYQSAFAIEATFDDSNTRNIHSTADTMDHPEFSFTHMREFSKLVVAF
                     SVELAGIADQ"
     gene            complement(<1086950..>1087970)
                     /locus_tag="CNI04090"
                     /db_xref="GeneID:3259793"
     mRNA            complement(join(<1086950..1087185,1087239..1087444,
                     1087517..1087706,1087735..1087867,1087950..>1087970))
                     /locus_tag="CNI04090"
                     /product="SNAP receptor, putative"
                     /transcript_id="XM_573025.1"
                     /db_xref="GI:58271737"
                     /db_xref="GeneID:3259793"
     CDS             complement(join(1086950..1087185,1087239..1087444,
                     1087517..1087706,1087735..1087867,1087950..1087970))
                     /locus_tag="CNI04090"
                     /codon_start=1
                     /product="SNAP receptor"
                     /protein_id="XP_573025.1"
                     /db_xref="GI:58271738"
                     /db_xref="GeneID:3259793"
                     /translation="MMRWCDAQVYNVNTNLRVHLSATNNHLIPLTGTLTHSLAQPQTL
                     PVLHPANHLEQLELESKGLVLGGKKGKGKGGDDGEEEVKELEERYDRLLGMLEEDDLG
                     REKAKDLKRTSQIPPSPIASPQPDTLSPPADASPSAQDVPTFNVDPPAPAVGYQPFKD
                     YPENEEPELAPHEMLSNQQMLMNDQDERLNLLSHSIGRQNDLSLQIGSELDVHHQLLE
                     ETDTAMDRTAASLGRAKRRLDRVADEAKQHGKLGFQSSREIWQ"
     gene            1090284..1092945
                     /locus_tag="CNI04100"
                     /db_xref="GeneID:3259439"
     mRNA            join(1090284..1091329,1091408..1092945)
                     /locus_tag="CNI04100"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41531146|gb|CF676987.1,gi|41539970|gb|CF685811.1,
                     gi|41563056|gb|CF708897.1"
                     /transcript_id="XM_572951.1"
                     /db_xref="GI:58271589"
                     /db_xref="GeneID:3259439"
     CDS             join(1090976..1091329,1091408..1092679)
                     /locus_tag="CNI04100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572951.1"
                     /db_xref="GI:58271590"
                     /db_xref="GeneID:3259439"
                     /translation="MDQSSGSSSSRHLPFGGPGARTILDDEPGPSSLPDSQGYPENMY
                     ESHPDGAQQLSQQSRETHTASPSLDGPPIKRVGGKANVSSACGPCKRAHLACDIGRPC
                     KRCINMGKQDQCEDVPHKKRGRPKVARPPLGEPYHRTSRPVPVAADAGGIGRWRGPSV
                     YDPSFVPNMDAAPGPSMTGRVSPRRASSSSMDASAASYPTPDPTAHPFTLFTTTDFKI
                     LRASPSCFSLVGYHPNEFVNLNLLDWIHPQDRHLIDMERNKLLAVPYVEGQLRSVEVT
                     QAAITQRTELELLSPAEGMREPYPNKNVRVLHVDNRFSPFNVRLHLGGGLGASLWQPV
                     TLGRVYLVVSFLAIPRSHHFPPDVPPVRRLSQISPPTPITPAPGMSGQGLPGFSSIAA
                     GVDGPQPRYDQPPPQVYYPPPQPPTARPPPPLSAQPYPSYPQTAMPANAPMYPPRRSS
                     SPNSAYRTPQTASYPISPTEYQMQPGFYPPAGPHPLGPPTVIAGGEYRRSNYEEWRMA
                     QQAGAPASLLPPRDHAAVTGGSSNDATRRTWEL"
     gene            complement(1092909..1095041)
                     /locus_tag="CNI04110"
                     /db_xref="GeneID:3259639"
     mRNA            complement(join(1092909..1093227,1093283..1093416,
                     1093467..1093768,1093822..1093886,1093938..1093955,
                     1094006..1094130,1094184..1094257,1094317..1094387,
                     1094441..1094551,1094603..1094650,1094749..1094779,
                     1094847..1094855,1094910..1095041))
                     /locus_tag="CNI04110"
                     /product="calmodulin-dependent protein kinase, putative"
                     /transcript_id="XM_572924.1"
                     /db_xref="GI:58271535"
                     /db_xref="GeneID:3259639"
     CDS             complement(join(1093180..1093227,1093283..1093416,
                     1093467..1093768,1093822..1093886,1093938..1093955,
                     1094006..1094130,1094184..1094257,1094317..1094387,
                     1094441..1094551,1094603..1094650,1094749..1094779,
                     1094847..1094855,1094910..1094962))
                     /locus_tag="CNI04110"
                     /codon_start=1
                     /product="calmodulin-dependent protein kinase"
                     /protein_id="XP_572924.1"
                     /db_xref="GI:58271536"
                     /db_xref="GeneID:3259639"
                     /translation="MAPQTVPCQYKTGKTLGSGTYAVVKECVHITTGEYYACKVLNKK
                     FLMGREHMVRNEIAVLKRVSAGHKNIVQLHDFFETTHNLYLVFDLCTGGELFDRICAK
                     GSYFEKDAANIVRTVTSAVKYLHDQGIVHRDLKPENILFKSKAEDADLMLADFGLSKV
                     LDDDKFAILTTTCGTPGYMAPEIFKKAGHGKPVDIWAIGVITYFLLCGYTPFDRDSQY
                     EEMQAICKGDYRFEPVEYWGGVSETARQFVRDCLTVDPTNRPTVDELLNHPWLRDVEA
                     SKDEPAEAKGVDLLPNVKAAFDAKKTFRKAVLGMMAVHRLQDHSATIHGQTEAEQEKL
                     KKEVEAFKEEAAQEDVKDVIQPGAPASI"
     gene            complement(1095359..>1096281)
                     /locus_tag="CNI04120"
                     /db_xref="GeneID:3259621"
     mRNA            complement(join(1095359..1095511,1095571..1095691,
                     1095745..1096115,1096171..>1096281))
                     /locus_tag="CNI04120"
                     /product="expressed protein"
                     /transcript_id="XM_572608.1"
                     /db_xref="GI:58270903"
                     /db_xref="GeneID:3259621"
     CDS             complement(join(1095488..1095511,1095571..1095691,
                     1095745..1096115,1096171..1096281))
                     /locus_tag="CNI04120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572608.1"
                     /db_xref="GI:58270904"
                     /db_xref="GeneID:3259621"
                     /translation="MMNEQIDPDAPISGTNVPKTIPQVTTAPAAPDTSLIDPPRTSDA
                     SASELPAAETNDILAPAPSTEPEVELTPDQKAMKARAERFGIPFNLPKPSATKPAKTE
                     KAESKPAETREKAASINKDSLGLSDDILAKRAAKFGLPEKKEAGKPASKPEKKAEEVD
                     PELAAKLAAEEEKKRKRAEKFGSNKPPVVEETEGQNAASEPDTKKVKV"
     repeat_region   1096733..1096786
                     /rpt_type=tandem
                     /rpt_unit_seq="cat"
                     /satellite="microsatellite"
     gene            complement(<1096929..1098224)
                     /locus_tag="CNI04130"
                     /db_xref="GeneID:3259379"
     mRNA            complement(join(<1096929..1097288,1097335..1097493,
                     1097546..1098224))
                     /locus_tag="CNI04130"
                     /product="acyl-CoA thioesterase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530093|gb|CF675934.1,gi|41530109|gb|CF675950.1"
                     /transcript_id="XM_572953.1"
                     /db_xref="GI:58271593"
                     /db_xref="GeneID:3259379"
     CDS             complement(join(1096929..1097288,1097335..1097493,
                     1097546..1098145))
                     /locus_tag="CNI04130"
                     /codon_start=1
                     /product="acyl-CoA thioesterase"
                     /protein_id="XP_572953.1"
                     /db_xref="GI:58271594"
                     /db_xref="GeneID:3259379"
                     /translation="MSLASRISVSPYPNKSFTFIPHDTWIPPGARSIYGGLVISQALC
                     SSLLTVESPFGLHSIHCYFLHPALPDGDIEYRVDKLAEGQRYCRREVRGWQNGRIFFI
                     LFASYESLYERSSASSEDHTSIKVSHSLTAMTQPWDEDPTQKNGESFEVKQSFQMPFP
                     KELRPWDQCEENEVFLQRLVQEKSKEELGWKWEYFDNWSKKRGSAPFFTSVARKIPGV
                     PSSKEYYLNGLPTTRMTWYRPRIDPDETISEEMYKSMIIYLTDYQLVGAATRSIGLNM
                     SSTPQIGLIASLDHSVHFYPLPPDLNYQEPVLHVMESQVADMSSGRAVARGRVYSAKG
                     KLLAVTCQEGVFKVREPGKKPMGVAASGIDEEDLQARL"
     gene            1099507..1100686
                     /locus_tag="CNI04140"
                     /db_xref="GeneID:3259792"
     mRNA            join(1099507..1099696,1099762..1099914,1099971..1100044,
                     1100110..1100215,1100279..1100437,1100499..1100686)
                     /locus_tag="CNI04140"
                     /product="metalloendopeptidase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41557773|gb|CF703614.1"
                     /transcript_id="XM_572606.1"
                     /db_xref="GI:58270899"
                     /db_xref="GeneID:3259792"
     CDS             join(1099846..1099914,1099971..1100044,1100110..1100215,
                     1100279..1100437,1100499..1100633)
                     /locus_tag="CNI04140"
                     /codon_start=1
                     /product="metalloendopeptidase"
                     /protein_id="XP_572606.1"
                     /db_xref="GI:58270900"
                     /db_xref="GeneID:3259792"
                     /translation="MLSAILAHEIAHVVERHTVENLGFLNLATVGFDVLRGLAFAFTI
                     SFPFITDSAGMCINWINNVLADRAYSRKLEMEADAVGLEIMATAGYDPRAASDLWELM
                     ACVEDDAAAMGQGISVENRFTLLRTHPTSDVRLKALSKDMEGALKIWRDHRRKRQPKR
                     VEKKQEKKDNVPESDKAVSE"
     gene            complement(<1100841..>1102685)
                     /locus_tag="CNI04150"
                     /db_xref="GeneID:3259627"
     mRNA            complement(join(<1100841..1100931,1100988..1101061,
                     1101116..1101372,1101427..1101736,1101792..1102016,
                     1102072..1102231,1102284..1102450,1102500..1102577,
                     1102626..>1102685))
                     /locus_tag="CNI04150"
                     /product="cytosine-purine permease, putative"
                     /transcript_id="XM_572604.1"
                     /db_xref="GI:58270895"
                     /db_xref="GeneID:3259627"
     CDS             complement(join(1100841..1100931,1100988..1101061,
                     1101116..1101372,1101427..1101736,1101792..1102016,
                     1102072..1102231,1102284..1102450,1102500..1102577,
                     1102626..1102685))
                     /locus_tag="CNI04150"
                     /codon_start=1
                     /product="cytosine-purine permease"
                     /protein_id="XP_572604.1"
                     /db_xref="GI:58270896"
                     /db_xref="GeneID:3259627"
                     /translation="MDILVEHGVEERGIDPRPENERDELNKWTYLPQFTLWAAWNTNI
                     LSFSEGVIGPSLFGLDWKTSCLCIVFFTAASALPVAYCATNGPKTGMRQMVQARYGMG
                     YGLALIYGILNCATMIGFMALTAILAGQCLALASNSTMSWDVGIVIAALIALILSFVG
                     LNALHIVSLASFPVMVILYVVLAGVVGDKLHLVQSDVAKAATAVTASGVLGYGASLIG
                     FSITYTSLASDFTTSLPPQTPGWKLFLCVYVGMVVPMILCQMFGAACQLAAYSIPDWE
                     TASNVGVPNLIYTMTGNGNGASRFVMVLFSLSVVANTAPTIYSAGLSGQVAIPWLVRV
                     PRYFLALVVSAIYLPIAICGASKFYSALENFSSVLSYWSALYIPPTLIEPILFRGPVS
                     RKTYPVEIWNQIGKLPIGLAAIFAAICGIPVVTGGMAQSWWTGWIARKIEGTGDIAFE
                     IGFVVVGLIYIPARYLERKFTGR"
     gene            1103177..1107457
                     /locus_tag="CNI04160"
                     /db_xref="GeneID:3259603"
     mRNA            join(1103177..1103270,1103362..1103632,1103711..1104251,
                     1104298..1104908,1104962..1105018,1105066..1105180,
                     1105243..1105394,1105623..1105673,1105731..1105816,
                     1105860..1106003,1106098..1106141,1106376..1106548,
                     1106602..1106679,1106733..1106785,1106853..1106941,
                     1106993..1107036,1107090..1107457)
                     /locus_tag="CNI04160"
                     /product="signal transduction-related protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41553839|gb|CF699680.1"
                     /transcript_id="XM_572961.1"
                     /db_xref="GI:58271609"
                     /db_xref="GeneID:3259603"
     CDS             join(1103257..1103270,1103362..1103632,1103711..1104251,
                     1104298..1104908,1104962..1105018,1105066..1105180,
                     1105243..1105394,1105623..1105673,1105731..1105816,
                     1105860..1106003,1106098..1106141,1106376..1106548,
                     1106602..1106679,1106733..1106785,1106853..1106941,
                     1106993..1107036,1107090..1107374)
                     /locus_tag="CNI04160"
                     /codon_start=1
                     /product="signal transduction-related protein"
                     /protein_id="XP_572961.1"
                     /db_xref="GI:58271610"
                     /db_xref="GeneID:3259603"
                     /translation="MKFGRYLQENLTPEWKRAYIDYRACKKAIKVIAARLGQIKQEED
                     VDGGGSSSGPDDDHGPSAPQIKSPDTLRGSKGSLRSRLGTARDTPRLARFSSRPSENQ
                     SPNYGSTLESPHPHPPQPAVSNPPPLDLGEPGVDDDYTPSTDLRTDELHLASNPDQCK
                     DRSHTPNPKKGVAFSPTAEEIGGQRIDELPETSTRSQSSEDGKSSDGVVQSDSREPLK
                     RRPADLIVNTDKTAPSPRLLGRSGKGFLTPRLSSIRGDATPTSRGNKSPARSPARSLR
                     SMTLPSPALGIRTTATSAHPTETFDDLYDRMERDEKAFFDLLQRQLDKVEKFYVEREQ
                     EAIKRAHDLRVQLRELADHRKLYHEIYPEGIPEWEAKMGRILPNGVQPRAPAFTKIRS
                     RFKYTFDDRENTSSNPNERPNGDPNVTSSGSQSPVMSEHERQHLRQAMAEDKEHQTYS
                     PERYQKYKKDLRNAVLEFYRQLELIKNYRIMNLTGFRKALKKFEKVTKIPCLEMYTDE
                     RIAKCTFSKSEAIDDLIKQCEELYTVHFEHGDSKKARERLRRQQMEKTHYQSVFRSGL
                     MLGIGLPAAIAALVEGKLHLNFVMELARPAIDYRSFMEIPAFLFLTLSYCFYFSFARV
                     GSSNIDPTTYRADGQLHGLYSYVCSGSILSRYFEGEHDTGFCESCFEFLLQATAALSL
                     AYSLQNIYFIACSSCLYSNLALCLQAGKYASVITQQCLFVWWRNKGNNDSGASFIIWV
                     IIATISAIYTCSWDFIIDWSLFRPNSGLLRKDLGYSRRYVYYFAMVSNFLIRFVFVWY
                     IPFSTQNIRLRSFFFSLAEMLRRWQWNFFRVETEHLGNADAYRVTREIPLPYRRVDRD
                     SDEESDPHEIEKSKGRSGRHHMSVNLDRLRRSIRDRNTDEGRGPDALDAGPRGHAPER
                     DYEARRPGDIQERVPIGEQRV"
     gene            complement(1107459..1110750)
                     /locus_tag="CNI04170"
                     /db_xref="GeneID:3259559"
     mRNA            complement(join(1107459..1107742,1107795..1108142,
                     1108195..1108425,1108481..1108663,1108727..1108938,
                     1108997..1109082,1109141..1109216,1109267..1109429,
                     1109484..1109585,1109640..1109780,1109839..1110010,
                     1110061..1110129,1110178..1110493,1110549..1110686,
                     1110734..1110750))
                     /locus_tag="CNI04170"
                     /product="DNA ligase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41531768|gb|CF677609.1,gi|41531774|gb|CF677615.1,
                     gi|41557329|gb|CF703170.1,gi|41560335|gb|CF706176.1,
                     gi|41560342|gb|CF706183.1,gi|41570306|gb|CF716147.1,
                     gi|41570318|gb|CF716159.1,gi|41573370|gb|CF719211.1,
                     gi|41573377|gb|CF719218.1"
                     /transcript_id="XM_572602.1"
                     /db_xref="GI:58270891"
                     /db_xref="GeneID:3259559"
     CDS             complement(join(1107575..1107742,1107795..1108142,
                     1108195..1108425,1108481..1108663,1108727..1108938,
                     1108997..1109082,1109141..1109216,1109267..1109429,
                     1109484..1109585,1109640..1109780,1109839..1110010,
                     1110061..1110129,1110178..1110493,1110549..1110686,
                     1110734..1110740))
                     /locus_tag="CNI04170"
                     /codon_start=1
                     /product="DNA ligase"
                     /protein_id="XP_572602.1"
                     /db_xref="GI:58270892"
                     /db_xref="GeneID:3259559"
                     /translation="MSDIEYPVKSNIRKKRTVILSDDEDEGLGPSVIKEQVSSPKHSH
                     LSDEETEPPRKVAKTSSKVAPIFAPKEKKEKPSPKTSSALSKAPAKKIEVKSKGEKPL
                     ASIFTKATRKPEPKDDDEMSDEVKQKGKDEEEEDEIYDEVEDKQEGEAAVKLASIFTK
                     NQKSVPVADKGWKDGEAVPYPALVSTFEKIEATTKRLEILEFLTQFLLVVAKRDTATD
                     AKGSMLLKVVYLCINRLCPDYMGIELGIGESLLIKAIAESTGRAMPKIKEDLKKEGDL
                     GKVAMNSRNTQSTMFKPKPLTVPYVFQCLTDIAKASGNASQAKKVGIIKKLLAACQGT
                     EAKFIIRSLEGKLRIGLADKTVVVALAHAIVLKTIGDKKPPPEKLAIMLEQGAETVKA
                     VYSELPSYDLVIPALLQGGVEGLRERCKLTPGVPLKPMLAKPTKAITEVLDRFEGKEF
                     TCEYKYDGERAQVHLLEDGTISVFSRNSENMSAKYPDLVDQIPRSMKPTAKTFVIDAE
                     AVAYDLETKKILPFQDLSRRKRKDVKAEDITVRVHIFAFDLLYLNGESLLAKELKERR
                     QLLQEHFQPVESEFAFAKSSDGSTTEEIQALLEESVKDGCEGLMVKMLTSESSTYEPS
                     RRSMNWLKLKKDYLSGVGDSLDLVVVGAYHGKGKRTAVYGAFLLACYDPDSEHYQTIC
                     KIGTGFSEEILTQFYELLKPLELEVVRGDIEVGGAKPDVWFEPRVVWEVLTADLSLSP
                     IYAAAHGVIDSRGISLRFPRFIRIRDDKSADEATTAEQVSEFYQRQISAGGKKGAGAD
                     VDDFW"
     misc_feature    1110191..1110273
                     /note="CT-rich"
     gene            1110943..1113656
                     /locus_tag="CNI04180"
                     /db_xref="GeneID:3259428"
     mRNA            join(1110943..1111066,1111120..1111407,1111448..1112051,
                     1112099..1112733,1112787..1113656)
                     /locus_tag="CNI04180"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41536284|gb|CF682125.1,gi|41548167|gb|CF694008.1,
                     gi|41548177|gb|CF694018.1,gi|41550314|gb|CF696155.1,
                     gi|41550317|gb|CF696158.1,gi|41561280|gb|CF707121.1,
                     gi|41561290|gb|CF707131.1,gi|41563324|gb|CF709165.1,
                     gi|41563331|gb|CF709172.1"
                     /transcript_id="XM_572963.1"
                     /db_xref="GI:58271613"
                     /db_xref="GeneID:3259428"
     CDS             join(1110962..1111066,1111120..1111407,1111448..1112051,
                     1112099..1112733,1112787..1113632)
                     /locus_tag="CNI04180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572963.1"
                     /db_xref="GI:58271614"
                     /db_xref="GeneID:3259428"
                     /translation="MESSRSSQHGKRSERLTRTPYARPTPQGARTTPNSALGAIKSAL
                     SLFTSPFSRSTSTLPTHNAIEVDRRSESGSEDNWDGEAPAAMKGQDVFSLAAAAGRSG
                     EDFEGRQIAWRGKGEALGGKREVARRELQLAPPKASAEIRNGQPITPNTPIFPGHFHK
                     DGAASQSDPSHPSRALPAPLVPSSGVLNAATGQNSTASATAKPQPVTPSSLSLPSRLP
                     LPASFMTPTRSAIASASSSQCALALSSFLDDKQGKVLTSEDRTIIEALSSRIAVEENA
                     SPVAQERRGGWLPSSTSGEVAFRGNLSQSTSSSYLGSGTPYKQRYLGPGMSPKKMPSS
                     RSSPASDRLQSSQSNPPASVGPDASALPPSFPNRHLVNTILRYSATSSPLRQSYRPGA
                     PSTPAAAAPEPVARSPAAGGKRKPESPADRDVSKRREIEAAGRQKAAAIMQSLIEETD
                     STTPKPNTEPVRWNAYDRGSLHAKATGEPFAGPSTPAKQVPPVPISTPSTAHAGSTPR
                     KRTPLRGAAAKLEAHRQAMKGAKPLSTIERIKGVRPWDNNQSANLTAAEKVVEPEQQV
                     EEPEESEIDELDSEREQDTDAADISEVEDASRARRRAAPLTPAEEVPHPSKVPEATKF
                     EPFPTQPIGFASSSISKPAVSSPAPAAAESYDSPLRKSIIEAPKKAEESAKTFKFSFD
                     QPAKSASEAETEPATQPIVRSEIPKTSRQEKTYLSAKEAALKVDKLSLPFFTFVPPAS
                     GPIPANSTKERTEKAKAEAAKLSPPTFAFKLELSAPVRASSTPLSSAVKKVSGGKWTC
                     SMCMLENPESATEKCTICEEPRKNSTV"
     gene            complement(<1114441..>1115302)
                     /locus_tag="CNI04190"
                     /db_xref="GeneID:3259617"
     mRNA            complement(join(<1114441..1115102,1115170..>1115302))
                     /locus_tag="CNI04190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573024.1"
                     /db_xref="GI:58271735"
                     /db_xref="GeneID:3259617"
     CDS             complement(join(1114441..1115102,1115170..1115302))
                     /locus_tag="CNI04190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573024.1"
                     /db_xref="GI:58271736"
                     /db_xref="GeneID:3259617"
                     /translation="MAPYALYARDNSSSSNSTDSSSSSDTSSDSSVSSFMDAHGKQVY
                     IALAVIGVLLLLVFIWALCTHRLSFAPFNQRRCSKCGHGIPKSAKLDDDYFKNDDDNG
                     KKGGYLCRKCQEEKEDEELEEELESEGLGKKGLRKKDDAGTGYAGRGGRKKNKRMKDW
                     EDEDEGHNDYPDEEKQVGKQTEIKSTRATRDDIPSDRSPSVKNEKMERTTAKAAKDDS
                     GRNDNIRSTRRQEEGRRPSRQRGKEEQRKPPVRKKREESDDDDYSD"
     gene            complement(1116635..>1117802)
                     /locus_tag="CNI04200"
                     /db_xref="GeneID:3259580"
     mRNA            complement(join(1116635..1117092,1117180..1117211,
                     1117269..1117315,1117367..1117411,1117469..1117570,
                     1117629..>1117802))
                     /locus_tag="CNI04200"
                     /product="expressed protein"
                     /transcript_id="XM_572922.1"
                     /db_xref="GI:58271531"
                     /db_xref="GeneID:3259580"
     CDS             complement(join(1116818..1117092,1117180..1117211,
                     1117269..1117315,1117367..1117411,1117469..1117570,
                     1117629..1117802))
                     /locus_tag="CNI04200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572922.1"
                     /db_xref="GI:58271532"
                     /db_xref="GeneID:3259580"
                     /translation="MFIQAIFGASVTAMAGLYALKSGANPTHSDNVPYEVDLHWMRKS
                     IEVMPPCHFNAYGSVIVNASNNELLCSGYNSQLEIGDPTEHGEVNAIRNCVKKYTELG
                     WTPAQITEIWPQSWIYTTAEPCPMCGSTILQSGFKRVVYGTSSPDLVGMGWTEYLVSV
                     RNKWLRKAAVVQPGFGGNRPVTQVVGHVGNNETDPRLAWQFNLDYPCPEGCHRHGEEQ
                     ICKPVA"
     gene            1118275..1120510
                     /locus_tag="CNI04210"
                     /db_xref="GeneID:3259682"
     mRNA            join(1118275..1118480,1118535..1118596,1118651..1118822,
                     1118879..1118981,1119043..1119211,1119266..1119388,
                     1119453..1119628,1119689..1119800,1119870..1120201,
                     1120280..1120510)
                     /locus_tag="CNI04210"
                     /product="cytosine-purine permease, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41546638|gb|CF692479.1,gi|41546649|gb|CF692490.1,
                     gi|41552812|gb|CF698653.1,gi|41552821|gb|CF698662.1"
                     /transcript_id="XM_572600.1"
                     /db_xref="GI:58270887"
                     /db_xref="GeneID:3259682"
     CDS             join(1118301..1118480,1118535..1118596,1118651..1118822,
                     1118879..1118981,1119043..1119211,1119266..1119388,
                     1119453..1119628,1119689..1119800,1119870..1120201,
                     1120280..1120422)
                     /locus_tag="CNI04210"
                     /codon_start=1
                     /product="cytosine-purine permease"
                     /protein_id="XP_572600.1"
                     /db_xref="GI:58270888"
                     /db_xref="GeneID:3259682"
                     /translation="MSITPPEYDEKDIEAQTYVSPAGRQHDHASAGGLLEADDGVPRG
                     KGISAPLWKAMAWFDRFGVEARGIERVPEDDRPHTSWWDNGTLWFSVNSCVGTFSVGY
                     LGHLYYGMGLRDAALTIVFFNLLSCAPVAYMCTFGKELGLRQMVLSRFALGYWTGVIP
                     VIFNLIACCGWATMNTIAGISCWRAISTTHQIPVVAAAVILALLTLIVSFCGYKVIHL
                     YEKFAGYPVLIAFLVSMGTSAKYMDLPGAWGPSGPVEAAGVLTFGCAIVGYAIGWVGF
                     AADFTVSMPRETSTKKLFWVTFWGLAIPLIFIELMGALAVTTFSARPDWEEMFNDGAA
                     GGLLAGLLQPCGGFGKFLLVILGLSTVAVNTPNVYIFTNTFHALSPYCQAIPRPFIAL
                     IVSIIYAVLAAAGANSFSAVLENLLLFLAYWLAMYFGIVATEHLVFRKNSFDNYVPDD
                     YTNWRMLPLGVAGFFALGLGWTGAALGMNTSWFIGPIAKQIGGGGDVGFELAFGFAVT
                     TFIPLRYFEKKYWGH"
     gene            <1120776..>1121724
                     /locus_tag="CNI04220"
                     /db_xref="GeneID:3259488"
     mRNA            join(<1120776..1120975,1121051..1121126,1121200..1121333,
                     1121457..>1121724)
                     /locus_tag="CNI04220"
                     /product="GTPase inhibitor, putative"
                     /transcript_id="XM_572598.1"
                     /db_xref="GI:58270883"
                     /db_xref="GeneID:3259488"
     CDS             join(1120776..1120975,1121051..1121126,1121200..1121333,
                     1121457..1121724)
                     /locus_tag="CNI04220"
                     /codon_start=1
                     /product="GTPase inhibitor"
                     /protein_id="XP_572598.1"
                     /db_xref="GI:58270884"
                     /db_xref="GeneID:3259488"
                     /translation="MSRSPSPTLSDSALLDSLEDSFDFSAHREARMEALSRQIKQVKD
                     LRESEYGRVVEFNEEKALIERMAKEKYCVLHFVHPNFQRCDIMDRHLSQLAPKHKHTL
                     FLRANVDNVPFLVTKMAIKVLPCVMSYVDGRAVDRLIGFEELGQTDNFTTKALEFRLS
                     QTGVLPTDLTLATNVSSSLLTQKQQGSRSDFEEEDSEEEKDRRRGKSGIRGGFRNKRG
                     DESDDDW"
     gene            complement(<1121846..>1122944)
                     /locus_tag="CNI04230"
                     /db_xref="GeneID:3259777"
     mRNA            complement(join(<1121846..1122059,1122113..1122507,
                     1122564..>1122944))
                     /locus_tag="CNI04230"
                     /product="spliceosomal zinc finger-containing protein,
                     putative"
                     /transcript_id="XM_572920.1"
                     /db_xref="GI:58271527"
                     /db_xref="GeneID:3259777"
     CDS             complement(join(1121846..1122059,1122113..1122507,
                     1122564..1122944))
                     /locus_tag="CNI04230"
                     /codon_start=1
                     /product="spliceosomal zinc finger-containing protein"
                     /protein_id="XP_572920.1"
                     /db_xref="GI:58271528"
                     /db_xref="GeneID:3259777"
                     /translation="MSEAPAPVVTFKKGPSRRPAQSRQRRRSPSPLDPVAEASASASG
                     SNVVRPERKSLANPLVQGTKRRRTNANNEEEEDGVGGGLDEFDYAAEGGLTRKGDELA
                     TRANDWDLEDVDGQGQRDKKVRLDEDGEIVTDDGLYRGASAYLPTINKTRETLDKKMK
                     SGPIKATSHVRTITLMDYQPDVCKDYKETGFCGYGDSCKFLHDRGDYLAGWQLDKLPE
                     EGVREVEEEDEEEEVPFACLICRQPFTQPVVTKCGHYFCMGCAAKRFQKSPKCYACGA
                     PTQGIFNIADKVIAKIEARNKARREAREERAEQTGGGGIEIGGGSDEEGSDEE"
     misc_feature    1122192..1122237
                     /note="CT-rich"
     misc_feature    1124879..1125027
                     /note="CT-rich"
     gene            1125687..>1126677
                     /locus_tag="CNI04240"
                     /db_xref="GeneID:3259687"
     mRNA            join(1125687..1125937,1126002..1126438,1126520..>1126677)
                     /locus_tag="CNI04240"
                     /product="hypothetical protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41563262|gb|CF709103.1"
                     /transcript_id="XM_573019.1"
                     /db_xref="GI:58271725"
                     /db_xref="GeneID:3259687"
     CDS             join(1125786..1125937,1126002..1126438,1126520..1126677)
                     /locus_tag="CNI04240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573019.1"
                     /db_xref="GI:58271726"
                     /db_xref="GeneID:3259687"
                     /translation="MKYKGSNPFQTSLYITSLPPGIRPAHLNRILAHPPRPLGKRRRK
                     RDTGVELIQIYTIPKKPKRRYLPKSRSTQPTGLLDPRHSPPQAIERVVSLLRTILCIP
                     HAPDLGPQRPATSTEEGSLKSQLSISSPLPSGVGDRNGTGTEVVVERELGEGELNEDE
                     NDQTTMVDEDENVMDQKQEADGEETVGYIHFCCEQHMYLGKRILRHVTIDGYRPKVRT
                     RRFNVGILRHWARPIGRITTNVDRKDKHKP"
     gene            1127591..1129143
                     /locus_tag="CNI04250"
                     /db_xref="GeneID:3259473"
     mRNA            join(1127591..1127728,1127781..1127946,1127999..1128199,
                     1128261..1129143)
                     /locus_tag="CNI04250"
                     /product="expressed protein"
                     /note="supported by cDNAs and ESTs:
                     gi|41548183|gb|CF694024.1,gi|41548192|gb|CF694033.1,
                     gi|41575484|gb|CF721325.1,gi|41575494|gb|CF721335.1"
                     /transcript_id="XM_572902.1"
                     /db_xref="GI:58271491"
                     /db_xref="GeneID:3259473"
     CDS             join(1127600..1127728,1127781..1127946,1127999..1128199,
                     1128261..1129003)
                     /locus_tag="CNI04250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572902.1"
                     /db_xref="GI:58271492"
                     /db_xref="GeneID:3259473"
                     /translation="MPAKKLPPYHPSQPEPDIAPFDISTAVDAEHDKPAGDDELLPKI
                     PKDANDKTVVFPPLILGCSTFGYGIYADDDNVRSSMPLRVVRLALRSGMNAFDTAPWY
                     HPSEIILGNALAALDYPRGSYHIITKVGKYGPNSSDHMYSPEVVQASVERSLRRLRTD
                     YLDAVYLHDVEYALPGPSYEGDPVSLLSTILSQPPVPTAEELKILDGIGALRKLQTTG
                     HIILVGIAGYPLPILLRLALLVLHSTRKPLDVVQTYAHHTLQNDALQQGYLQALAEKA
                     GVRQIVSASPLAMGLLTTSGGPGWHPAKDYPELFNATRAAVELCKEKGTKLEDVALSF
                     GYRPLSQPNGRRVPIVVGCKDLQEMKETVRRWKEVNPAQGGEGGLEKKELEEEVKKLF
                     TEKGVQGWSWACPSEAQRAG"
     gene            1129733..1130412
                     /locus_tag="CNI04260"
                     /db_xref="GeneID:3259565"
     mRNA            join(1129733..1130176,1130241..1130412)
                     /locus_tag="CNI04260"
                     /product="expressed protein"
                     /transcript_id="XM_572903.1"
                     /db_xref="GI:58271493"
                     /db_xref="GeneID:3259565"
     CDS             1129748..1130137
                     /locus_tag="CNI04260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572903.1"
                     /db_xref="GI:58271494"
                     /db_xref="GeneID:3259565"
                     /translation="MSPQSILVSYNLCPPAETPQPTAGPSSQPVPSSATFSFPIPPPS
                     LKTKASTLSATTQYYTSASAALLAAQATLNEKLTYWKDAIGDKEKAKEDVGAVGFGRG
                     KAMMMSNEVIGEMKNGQEQEESSEEEE"
     gene            1130818..1134599
                     /locus_tag="CNI04270"
                     /db_xref="GeneID:3259810"
     mRNA            join(1130818..1131216,1131279..1131365,1131433..1132127,
                     1132187..1132303,1132383..1132999,1133084..1133179,
                     1133256..1133344,1133447..1134001,1134114..1134336,
                     1134407..1134599)
                     /locus_tag="CNI04270"
                     /product="protein phosphatase, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41552773|gb|CF698614.1,gi|41568139|gb|CF713980.1,
                     gi|41568145|gb|CF713986.1"
                     /transcript_id="XM_572904.1"
                     /db_xref="GI:58271495"
                     /db_xref="GeneID:3259810"
     CDS             join(1130909..1131216,1131279..1131365,1131433..1132127,
                     1132187..1132303,1132383..1132999,1133084..1133179,
                     1133256..1133344,1133447..1134001,1134114..1134336,
                     1134407..1134487)
                     /locus_tag="CNI04270"
                     /codon_start=1
                     /product="protein phosphatase"
                     /protein_id="XP_572904.1"
                     /db_xref="GI:58271496"
                     /db_xref="GeneID:3259810"
                     /translation="MSDPPTPLTLPPTLPYPITLTRLVARPGDKIKRGSRLLEYTFMS
                     SDLKEKVAKRRLQGGGMGEIENEKEKDDLSGTWESLIDGDVVEWKGAKPGMIVERNQA
                     SQIIVTVQQACSHPVQLHGLCGVCGADLTEDDYLSRPVSNQTQAGPSRYPGGFEIAHD
                     AMGVTVSKNEAQRLENLTRDALLSTRRLSLIVDLDQTIIHTTVDPTVAEWMDEIHREE
                     MKDAQEKANVPTEEVKGKGEETTTPPGSPGPGALGITVESPKEKNPNAEALRDVAKFQ
                     IADDLPPGYVKLKTKTTKGQNPPESEGRWYFTKPRPGLQRFLDEMCQLYEMHVYTMGT
                     RTYADAIVKVIDPDGKIFGGRILSRDESGSFSSKNLKRLFPTDTSMVVVIDDRSDVWG
                     DCPNLVKVVPYDFFLGIGDINSSFLPTNKSTPPPSAATTAATTAAAASSSSAPLSPSL
                     STSPSPPPTLPPSPPSASSNASTPPPVTPSEVSADLEPIERVEPVEPTREEELMMQAK
                     LLDQLSTSRPLARLQEELEKEDSEDDESGEGQGGEAAVAAEAETGMKKVTGKEEEKEK
                     EHEEKAVASVRDDSRKERSKSPNKHRKPLLNPNDYELVRVANILQEIHSRFYKAFDAI
                     DGWDPKKALPMSCDVEFIIPEMKAEVLDGCNLVFSGMIPREANPSTTAIWQTAESFGA
                     LITPSLTPRTTHLVTALLNTEKTWRAGKMEGVKVVWAEWFWDSVALWERQDEEKYIAG
                     KKEGTGDAGKGVGPEGEAGNSDNHKDLKEEDEDGEEHEDMNDDTQVGQGWDEEAEREW
                     EEFMAGEDDWSDGEGSVGSRKSVKGESAPSTPSKKRVRYADEELLPLEEFKDPSPTAS
                     SDAPPSKRHKAYLIEDTTSGEERSEESRSQHKDHWTYEADVEKHDEKAGDEDDGRSVA
                     ESMEGAEGDDEFALLLMDSLANDDADGDENRDGDSVVAGEK"
     repeat_region   1132455..1132569
                     /rpt_type=tandem
                     /rpt_unit_seq="ccg"
                     /satellite="microsatellite"
     misc_feature    1132826..1132888
                     /locus_tag="CNI04270"
                     /note="GA-rich"
     gene            complement(1134993..>1139884)
                     /locus_tag="CNI04280"
                     /db_xref="GeneID:3259457"
     mRNA            complement(join(1134993..1135874,1135930..1136013,
                     1136065..1136284,1136336..1136763,1136812..1137193,
                     1137259..1137432,1137491..1138054,1138100..1139234,
                     1139535..>1139884))
                     /locus_tag="CNI04280"
                     /product="Rho guanyl-nucleotide exchange factor, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41566239|gb|CF712080.1,gi|41566250|gb|CF712091.1,
                     gi|41571430|gb|CF717271.1"
                     /transcript_id="XM_572596.1"
                     /db_xref="GI:58270879"
                     /db_xref="GeneID:3259457"
     CDS             complement(join(1135321..1135874,1135930..1136013,
                     1136065..1136284,1136336..1136763,1136812..1137193,
                     1137259..1137432,1137491..1138054,1138100..1139234,
                     1139535..1139884))
                     /locus_tag="CNI04280"
                     /codon_start=1
                     /product="Rho guanyl-nucleotide exchange factor"
                     /protein_id="XP_572596.1"
                     /db_xref="GI:58270880"
                     /db_xref="GeneID:3259457"
                     /translation="MPRLPSGPTQAFPAGAMTPAQAYQASQGYPTSSVAFPRPSTASP
                     AIPTQATQNIGTPFDPSSSVTSFSTTNSATSRIPTSTSITSFHKPTSQSPSLAETSKE
                     RSATPDYIGKMGQLASRSPAASPTYDTASSPTTPTVDMSFHPRASTDSTVSLPLALHT
                     TESLPPGARRGYENRSTSFSGSSREIIRPLSNPAARLSNPQAQSQTRAPLPSLYPAIL
                     SMVSAAFKSYIPLADLTKDGITYKDSFSGQAAVTLIAELIKTSDRNLALLLGRSLDAQ
                     KFFHDVTYDHRLRDNPKEVYRFKDRLAAPFTDTNGNGESPVSEGRLTRNGSGASSTAM
                     GLGGGLKALTAARPADSSSSMHTESTPVSMTPSRSSTMPFLDSDSPDGLDSEDTLPVG
                     VFTLLTDCYSPTCSRDSLCYSINCPRRLEQMKRLNMKPEPGLNRKLSRESLVDVKETG
                     TLWIHSVSQEILDSVDDKEKKRQEAINEVIYTERDFVRDLEYLRDSWVKPLRTQEVID
                     AKRRDDFVRQVFWNVHDVLSVNHVLAERLTKRQKKEPVVSRIGDIFLERVPLFEPFVT
                     YGAHQLFGKYEFEKEKGANPVFQKFVDDTERKPESRKLELNGYLTKPTTRLGRYPLLL
                     EAVLKYTPDDHPDKEDLPEVIKMIRGFLTKVNAESGKSENIFELAQIEQQLVFRPNER
                     IDLRLRDKNRQLVHKGPLKRRGGNREEIADLLGFLFDHAFLLVKPKWVNKSEQYKVYR
                     RPIPLELLVLVTPDEQYNSGKLSYGHGRSRLITRHPNSKTNHSSQNNSITAPPKPESK
                     HGFSITILHLGKKGYSMQLWVDTHIGRKKWLENIDKQQGLLREKSTVFVSETITEGIL
                     SGVRKVNCSSPYDQGNRMIFGTDEGVYFANLRDEKLREPVKVINLIDVTQVDVIEEFQ
                     LLIVLHERCVTTFPLDSLDPSDPNAALKRGKRISSHTSFIKSGVCLGKTLVAIVKSST
                     LSSTIKVMEPVDLSQNRKKTQAGFMKRLNGKDDALKLFKEFYIPTESSSVHFLKTKLC
                     VGCTKGFEIVDLETLDMQGLLDPSDGSLDFVLKRDNVRPIAIYRIEEDFLLCYDEFAF
                     YVNKNGWRSRPKWAIVWEGIPTSFALQYPYVIAFEPTFIEVHHVETGHLVQIIPGNNI
                     QCLFADTPPSRVNAPLPPNRMMYAPPTLGTPPYARPPNMPGYPAYPNVSYPGHPQQPR
                     QTSNGAYPPHRINQAPSAGVRHPQQTPMGYGMPAPHPPPLMNRFARPQVVFVSDDSHV
                     QFLKFPPASHSHPQRPVMTHYQTAPAGHSARSSR"
     repeat_region   1142722..1142783
                     /rpt_type=tandem
                     /rpt_unit_seq="cagaga"
                     /satellite="microsatellite"
     gene            <1143289..>1145156
                     /locus_tag="CNI04290"
                     /db_xref="GeneID:3259653"
     mRNA            join(<1143289..1144664,1144728..1144922,1145006..>1145156)
                     /locus_tag="CNI04290"
                     /product="protein kinase, putative"
                     /transcript_id="XM_572942.1"
                     /db_xref="GI:58271571"
                     /db_xref="GeneID:3259653"
     CDS             join(1143289..1144664,1144728..1144922,1145006..1145156)
                     /locus_tag="CNI04290"
                     /codon_start=1
                     /product="protein kinase"
                     /protein_id="XP_572942.1"
                     /db_xref="GI:58271572"
                     /db_xref="GeneID:3259653"
                     /translation="MSFAEYIPKADDPISVPRPQLESSFQSLPDTAGPTAELQTRTSP
                     VKISFGQPSGGAVKKGWKSISPKKKARVSLFDEDEEEIQGAKGEKEDKKEVMPEKEQD
                     IMGEALPHPDTLIHRLTLASTRYTTLLTSLSAPLRAAFDSFSTLPSSPPPPPIDLFLD
                     EYLGRKARDDEVKRVEEVWDAKKEWEREEEMGRRYLEEVGKGGRVEGVNVAPAEPGGA
                     RVSPAAVVVAPKPEPELAPIPVSGTELQAPAPGAEPHPQTQKVPIPLPPAATLVYQKL
                     AAVGEGTYGKVYKALSLITHQPVALKRIRMENEKDGFPVTAMREIKLLQMLQHENVLR
                     LVEMVVERGGVYMVLEYMEFDLTGLLAHPEIKFSPANIKSLSHQMLSGLSYLHRQSIL
                     HRDMKGSNILVNSRGELKLADFGLARVYAKKRREDYTNRVITLWYRSPELLMGETIYG
                     PEVDMWSAGCIILELYTTKPIFQGSDELNQLEVIYALLGTPTEAEWPSVKELPWYELV
                     KPKEEIGSKFRTSFAKWLSPAALDLVEGLLFYDPSQRLLADSALQTDYFLMEEPKMEK
                     PTQYVPF"
     repeat_region   1145245..1145287
                     /rpt_type=tandem
                     /rpt_unit_seq="gaa"
                     /satellite="microsatellite"
     gene            1145686..1145765
                     /locus_tag="CNI04300"
                     /db_xref="GeneID:3259725"
     tRNA            1145686..1145765
                     /locus_tag="CNI04300"
                     /product="tRNA-Gly"
                     /codon_recognized="GGA"
                     /db_xref="GeneID:3259725"
     repeat_region   1147846..1147933
                     /rpt_type=tandem
                     /rpt_unit_seq="atg"
                     /satellite="microsatellite"
     gene            complement(1149187..1151368)
                     /locus_tag="CNI04310"
                     /pseudo
                     /db_xref="GeneID:3259616"
     gene            complement(<1152331..>1155381)
                     /locus_tag="CNI04320"
                     /db_xref="GeneID:3259620"
     mRNA            complement(join(<1152331..1153781,1153841..1154985,
                     1155320..>1155381))
                     /locus_tag="CNI04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_573023.1"
                     /db_xref="GI:58271733"
                     /db_xref="GeneID:3259620"
     CDS             complement(join(1152331..1153781,1153841..1154985,
                     1155320..1155381))
                     /locus_tag="CNI04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573023.1"
                     /db_xref="GI:58271734"
                     /db_xref="GeneID:3259620"
                     /translation="MLGLKRTIATIQRSGTVSYFTPLRLAMRPVAMAVAGPGPTSWLH
                     RIALFSSRSPMPASSSRSSSSTTSQKSRRKPSSFKPTPKSQHPPSKKPITLRRMDVIE
                     NDVILLRPPPDYPITAQLEELSIAMKEYNLDRVIFIWSHLVDLGAISRFDSITFKYIS
                     EFIADILHRRGSPNLNKLAAISPEKYGLLLNMSIESAARDHISGFFFILLRLLEIGRP
                     GDVVNAFNTCKVKMRELQGKDANDLLSWDREKRLAARLEGEGLRSLMMVNIAALTLLD
                     QCDEAALFGMLDATADLRPNSKFNFAPIHRSLSRANVSNKQHDLYSQFRQNVDKLILA
                     LQCYHPNAFVHRITIHGRAKTFGALNKLYQQVLEATVGPDAFVKVRNLGDHSAHFQSS
                     KHIPLPAIVWHQFLRAFEHRNDVDRIVSMIDTDLPLRNLRPDSTILSLAMVHMAIIST
                     RLHLPLQTRQNARYWADEYWRRLAQNGWHMEDLAFSRRVRTLDILGRKEAQLKGEVDK
                     LYDMAKAGHLSKIGRQTRAAFVESFMARNDIKQTLDVFKMFPHNPSAEQHDFTPAVSA
                     FIRLLATRNYTANKSFTFCARILKLVAQTGTPIETSTLGPLLSIQLNAGLPIQPAVDT
                     ILSHSLTPTHPIPGINKWTRILTGLLTKWSHCRPATKVELEAGLYILSKARDEDLYGR
                     KREREYDLWLAFLRPAAKTTSLNNEERYEIIETAMSLFPRGGKGKLSTIVWFEVVHAL
                     VTRPDGLGFGEGWARWCELVKIRELEGIWWDRMLRTIVRINHNFAVNLVRSAWEHGNT
                     KVRVDEAFWMRAEAEGLVKELGIEQHLEKKRNGLVEGKSWRQNLVTHMMEEDDDMVDW
                     DMMLGKEEVIDEVEAEYGGGDELSMGEEE"
     gene            1155592..1157391
                     /locus_tag="CNI04330"
                     /db_xref="GeneID:3259570"
     mRNA            join(1155592..1155644,1155714..1156400,1156445..1156786,
                     1156832..1157391)
                     /locus_tag="CNI04330"
                     /product="cell division control protein, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530027|gb|CF675868.1,gi|41530036|gb|CF675877.1,
                     gi|41556396|gb|CF702237.1,gi|41561264|gb|CF707105.1,
                     gi|41561273|gb|CF707114.1,gi|41563738|gb|CF709579.1,
                     gi|41563744|gb|CF709585.1"
                     /transcript_id="XM_572594.1"
                     /db_xref="GI:58270875"
                     /db_xref="GeneID:3259570"
     CDS             join(1155604..1155644,1155714..1156400,1156445..1156786,
                     1156832..1157339)
                     /locus_tag="CNI04330"
                     /codon_start=1
                     /product="cell division control protein"
                     /protein_id="XP_572594.1"
                     /db_xref="GI:58270876"
                     /db_xref="GeneID:3259570"
                     /translation="MLEENTSSNLPGDVSNPFITKPNSPKKSRGNSSTSDSTLASLRQ
                     GMGRMDISSKGSSIPYTIDVRERKDSKDTRRELDRFVPARPASLSHNSHSSSTLPTLA
                     IDSAGHTPDTSVDHSLSQDQSTLSLQASLGLNSNRRILSFQSAPPLASHATSHLDAQR
                     NYLLQSSASANRGTGSHSGKDTKKRAPPYMPERVLDAPGFEDDYYLDLIDWSCANRVA
                     IGLGDMGYVWDAETGSVSALGSGAEEDTNKVTSVSWSNDGAYLAIGLDTGDIEVWDVE
                     ENKKMRTMKGHLARVPVMSWHGHVLTSGCRDGSIYHHDVRVAKHKVMELVGHNAEVCG
                     LAWRSDGQFLASGGNDNVVNCWDGRIGASILNDEGTPRGVAKWTKRNHTAAVKAIAWS
                     PWQSSLLATGGGTADKHIHFWSTSTGARTASLPTSTQVTSLIFSPHSKEILGTHGYPD
                     NTLTLWTYPTLEKIWEVPAHDSRIISSALSPDGTTVCTGAGDENLKFWKVWEVRQAKK
                     EREEGESGRGKTAVRIR"
     gene            complement(1157371..1159209)
                     /locus_tag="CNI04340"
                     /db_xref="GeneID:3259390"
     mRNA            complement(join(1157371..1158086,1158150..1158517,
                     1158568..1158862,1158916..1159134,1159189..1159209))
                     /locus_tag="CNI04340"
                     /product="40S ribosomal protein S0, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41534844|gb|CF680685.1,gi|41534853|gb|CF680694.1,
                     gi|41543812|gb|CF689653.1,gi|41543826|gb|CF689667.1,
                     gi|41552570|gb|CF698411.1,gi|41552576|gb|CF698417.1,
                     gi|41553994|gb|CF699835.1,gi|41553999|gb|CF699840.1,
                     gi|41554615|gb|CF700456.1,gi|41554624|gb|CF700465.1,
                     gi|41565819|gb|CF711660.1,gi|41565830|gb|CF711671.1"
                     /transcript_id="XM_572918.1"
                     /db_xref="GI:58271523"
                     /db_xref="GeneID:3259390"
     CDS             complement(join(1158010..1158086,1158150..1158517,
                     1158568..1158862,1158916..1159054))
                     /locus_tag="CNI04340"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="XP_572918.1"
                     /db_xref="GI:58271524"
                     /db_xref="GeneID:3259390"
                     /translation="MSADKLPKALQATEDDIQLLLAAQCHLGTKNCDKSMENYVWKRR
                     ADGIHVINVGKTWEKLVLAARVLATIENPNDVCVISARPYGHRAVLKYGSFTGAQAIA
                     GRFTPGSFTNYITRSFKEPRVIIVTDPRVDHQAIREAAYVNIPVIAFCDTDASTKFVD
                     IAIPANNKSRHSIGLMWYLLCREVLRLRGTVPRGPTGPSGWDVLPDLFFYRDPEEIER
                     EAAEKAAAAAAQEGADAEAAATSAAAGVTAEYDAGNAADAVLAAQPTETALDWSDEPV
                     AGDWAAEPAADAQGGW"
     repeat_region   1158207..1158282
                     /rpt_type=tandem
                     /rpt_unit_seq="cgg"
                     /satellite="microsatellite"
     gene            <1160390..>1163742
                     /locus_tag="CNI04350"
                     /db_xref="GeneID:3259710"
     mRNA            join(<1160390..1161197,1161260..1162901,1163135..1163250,
                     1163408..>1163742)
                     /locus_tag="CNI04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_573020.1"
                     /db_xref="GI:58271727"
                     /db_xref="GeneID:3259710"
     CDS             join(1160390..1161197,1161260..1162901,1163135..1163250,
                     1163408..1163742)
                     /locus_tag="CNI04350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573020.1"
                     /db_xref="GI:58271728"
                     /db_xref="GeneID:3259710"
                     /translation="MSRAATATPPPQTYFPQRNATPSMRHAAPSPAIHFGRQHQHLGQ
                     SHVKRRVKGNGGSGLKKQHIPNSREQNEEDQLGMSFEDLGAERVLQNPNSDKADIDVD
                     IDIDLDLDPNLTPASSRASIVSGLSQDQGPVLLTPVQSDSEGRGPVLVSNSGRVSSAG
                     SEGGEEEGRASPGWMGKMAMAVVNTGMSVSRGFGNAQAHGKRVQSQPQPQPQAQAQAH
                     DQTLAHPAEKIDDQQRQREWAEAENRRIHECARLCSQWPLSGYNLGKYGPGGAATFYQ
                     PQSFCNPQHVAWVMHRQAQIEQRLALTEGTFFDCRKVRQRKRQGDCENGRGCRAREED
                     EQSEVSTSTDDSTLSSRLSGSTCSTDSRSNSTANSSNPSSSQDENNSEPLSLVQPQRP
                     SAPRSLTAEHYAYGRTAQKMEREKEMAEDLREAMACSLLEFSHPERRGSVTSSATKDV
                     SADGRDENGEKLENAEVEGRRERGRKMFAELEALARDVGLGHVGEGMDVDEDLCEESQ
                     PQPQPDTQATPSAQTHAASYSSEPSMPRTRTQRAQSCGSKRPIPSTRCSADGEEEKRR
                     KVRPVAPPTTSSGFDPMCTATMEVEEAVDEAMVVEEAVDNGVIMPATQTQSQNQSHTG
                     ESRLKTGRGKGMSSSVPDLSKTYPHSESATTYPPQRQQQPEQSNSRDIYPPPAVFGVV
                     VKTSESHPIIISPFFPKDLLGILAEHLVLPLGGARKPLLLGSKLDVPSLLLSYSPGMP
                     FPSSGSMRNQSQSTQTQPVSNLCQAPRVPALGNLLLSSCPGKRLRMEGPSKGRGPVCR
                     DLATDLKRIKGEGVGCLVWLPMPDGFTPVSMELFDSQVSLIATKYTLQGINVLVHCRG
                     GVGRAGMTACAWAIKMGFVQPHPSLVIVEEAARQRYNLTHGISPTSNSPTPIAPSAAV
                     PAELEHQIVMSMVERVIAMIRCRRGLKAIESFEQVAFLMRYVGWLRQGARSA"
     gene            complement(1164346..>1165984)
                     /locus_tag="CNI04360"
                     /db_xref="GeneID:3259636"
     mRNA            complement(join(1164346..1164620,1164699..1164812,
                     1164905..1164941,1165043..1165253,1165366..1165528,
                     1165596..1165676,1165850..1165886,1165960..>1165984))
                     /locus_tag="CNI04360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573022.1"
                     /db_xref="GI:58271731"
                     /db_xref="GeneID:3259636"
     CDS             complement(join(1164467..1164620,1164699..1164812,
                     1164905..1164941,1165043..1165253,1165366..1165528,
                     1165596..1165676,1165850..1165886,1165960..1165984))
                     /locus_tag="CNI04360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573022.1"
                     /db_xref="GI:58271732"
                     /db_xref="GeneID:3259636"
                     /translation="MQMPRIMYGRRREQRSWCVKLEDLVGQAIKSLISEGVVKREELY
                     IQTKFTSVDGQDPSLPLPYDPSSPIEEQVKQSFETSLKNLGVEYLDAVVLHSPLKSRE
                     DTLKAYLTLSRFFSTKQIRHLGISNCYDPLLLQWLIDSVAEYSSKHQEEPEVKVGIVQ
                     NRWYEGNGWDWDVYDICRAHGIRYQSFWTLTGSPTLLKQPFLINLAAKYGLTPEQTVY
                     KLCQLWDITPLCGTSSLAHAKEAVSVENATGLMSSTEEVVELWNAMGGRYKEGSH"
     gene            complement(1166246..1168065)
                     /locus_tag="CNI04370"
                     /db_xref="GeneID:3259650"
     mRNA            complement(join(1166246..1166574,1166705..1166749,
                     1166839..1167034,1167088..1167209,1167294..1167483,
                     1167563..1167801,1167851..1168065))
                     /locus_tag="CNI04370"
                     /product="lectin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530367|gb|CF676208.1,gi|41530373|gb|CF676214.1,
                     gi|41539978|gb|CF685819.1,gi|41540573|gb|CF686414.1,
                     gi|41540584|gb|CF686425.1,gi|41541656|gb|CF687497.1,
                     gi|41541660|gb|CF687501.1"
                     /transcript_id="XM_572915.1"
                     /db_xref="GI:58271517"
                     /db_xref="GeneID:3259650"
     mRNA            complement(join(1166246..1166749,1166839..1167034,
                     1167088..1167209,1167294..1167483,1167563..1167801,
                     1167851..1168065))
                     /locus_tag="CNI04370"
                     /product="lectin, putative"
                     /note="supported by cDNAs and ESTs:
                     gi|41530367|gb|CF676208.1,gi|41530373|gb|CF676214.1,
                     gi|41539959|gb|CF685800.1,gi|41539978|gb|CF685819.1,
                     gi|41540584|gb|CF686425.1,gi|41541660|gb|CF687501.1"
                     /transcript_id="XM_572916.1"
                     /db_xref="GI:58271519"
                     /db_xref="GeneID:3259650"
     CDS             complement(join(1166533..1166574,1166705..1166749,
                     1166839..1167034,1167088..1167209,1167294..1167483,
                     1167563..1167801,1167851..1168051))
                     /locus_tag="CNI04370"
                     /codon_start=1
                     /product="lectin"
                     /protein_id="XP_572915.1"
                     /db_xref="GI:58271518"
                     /db_xref="GeneID:3259650"
                     /translation="MRRNPTLSLLSLTALTAISGVNAAESEDSLASVIERTVPLRTHS
                     LAAPYVDTDLQNRWWDFGGDTIINTNKHVRLTQDKPSQSGWLWARMPLSVSNWQIDVE
                     FKVDGKAHNIFGDGWAFWLTSDRAKQGPVFGSVDWFKGIGIFFDTYANSKHAYTFPRV
                     SAMLGDGKTSYDHDRDNEANEIGGCSENFRRRGDVPTKARLTYVKGRALQLKLQTKKS
                     DEWKICFETNVDLPESPYIGFSAATGDVSDDHDIVAVNTYSLTLKPEYRASKSSSDSK
                     SKSKSDGKQAAMNANTNGMSGKGRKEVKSGGTGWFMFILKVIGVLAFIAFAVAAFKTY
                     NEQQKSKRHW"
     CDS             complement(join(1166594..1166749,1166839..1167034,
                     1167088..1167209,1167294..1167483,1167563..1167801,
                     1167851..1168051))
                     /locus_tag="CNI04370"
                     /codon_start=1
                     /product="lectin"
                     /protein_id="XP_572916.1"
                     /db_xref="GI:58271520"
                     /db_xref="GeneID:3259650"
                     /translation="MRRNPTLSLLSLTALTAISGVNAAESEDSLASVIERTVPLRTHS
                     LAAPYVDTDLQNRWWDFGGDTIINTNKHVRLTQDKPSQSGWLWARMPLSVSNWQIDVE
                     FKVDGKAHNIFGDGWAFWLTSDRAKQGPVFGSVDWFKGIGIFFDTYANSKHAYTFPRV
                     SAMLGDGKTSYDHDRDNEANEIGGCSENFRRRGDVPTKARLTYVKGRALQLKLQTKKS
                     DEWKICFETNVDLPESPYIGFSAATGDVSDDHDIVAVNTYSLTLKPEYRASKSSSDSK
                     SKSKSDGKQAAMNANTNGMSGKGRKEVKSGGTGWFMFILKVIGVLAFIAFAVAAFVSS
                     LVIVFSFSIPLLWNLPTPTARFLVVNQWKINTN"
     gene            complement(1168284..>1169333)
                     /locus_tag="CNI04380"
                     /db_xref="GeneID:3259577"
     mRNA            complement(join(1168284..1168756,1168816..1168852,
                     1168904..>1169333))
                     /locus_tag="CNI04380"
                     /product="glutathione S-transferase, putative"
                     /transcript_id="XM_572592.1"
                     /db_xref="GI:58270871"
                     /db_xref="GeneID:3259577"
     CDS             complement(join(1168396..1168756,1168816..1168852,
                     1168904..1169333))
                     /locus_tag="CNI04380"
                     /codon_start=1
                     /product="glutathione S-transferase"
                     /protein_id="XP_572592.1"
                     /db_xref="GI:58270872"
                     /db_xref="GeneID:3259577"
                     /translation="MTASSLPSSPIPSPRRPESFPPEATTVTPKLHLFTAATPNGYKP
                     SILLEELHDAYPDNPEIVYDFTQLRFDHTDQKKPEFLKINPNGRIPALVDDSVEGGHS
                     VFESASILLWLVERYDKEYKFWFKDPLQRSKALSWIFFAHGGVGPMQGQANHFFRYAP
                     EKIPYGIKRYQDETARLYSVLESQLAKSDSQGYLVGGKFSVADINVFPWVRSYSWAGV
                     DITPFPNVAKWLERIEARPATYKGLGVPERRKGKRSKEEEEEDAREASKWVMDGQKK"
     misc_feature    1168442..1168483
                     /note="CT-rich"
     gene            1170295..>1171411
                     /locus_tag="CNI04390"
                     /db_xref="GeneID:3259566"
     mRNA            join(1170295..1170758,1171274..>1171411)
                     /locus_tag="CNI04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_572590.1"
                     /db_xref="GI:58270867"
                     /db_xref="GeneID:3259566"
     CDS             join(1170354..1170758,1171274..1171411)
                     /locus_tag="CNI04390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572590.1"
                     /db_xref="GI:58270868"
                     /db_xref="GeneID:3259566"
                     /translation="MSRSYSCLLTLPSRYLIVVVRLLVPFFAALTVLFLILPGVSGNK
                     TGFYWVNIEYEGNEGTWEVGALGSCQYGTEYAFPFSFFLPVERGLLRGGRGWWMMTKA
                     DVDDYCIVDVRLLAKQVLHIGDLSIAFSLSISPLVAVEQRDRARDDYDKEWERVAGKR
                     KDRKRDTQKRKESSRSRSHA"
     gene            <1172235..>1174316
                     /locus_tag="CNI04400"
                     /db_xref="GeneID:3259684"
     mRNA            join(<1172235..1172307,1172364..1172557,1172698..1172768,
                     1172831..1172986,1173052..1173293,1173362..1173427,
                     1173554..1173845,1173972..1174055,1174123..1174147,
                     1174221..>1174316)
                     /locus_tag="CNI04400"
                     /product="kinase, putative"
                     /transcript_id="XM_572905.1"
                     /db_xref="GI:58271497"
                     /db_xref="GeneID:3259684"
     CDS             join(1172235..1172307,1172364..1172557,1172698..1172768,
                     1172831..1172986,1173052..1173293,1173362..1173427,
                     1173554..1173845,1173972..1174055,1174123..1174147,
                     1174221..1174316)
                     /locus_tag="CNI04400"
                     /codon_start=1
                     /product="kinase"
                     /protein_id="XP_572905.1"
                     /db_xref="GI:58271498"
                     /db_xref="GeneID:3259684"
                     /translation="MSKFKISSALWDKIYHFASFPQTGVSLQQMILFGQNPSQGTLLK
                     ASQFLSEELPIRLSHRVVELEGLPDGLNKMTSINIVKEWYAQSFDELVSFPRPRLKPE
                     LEDILRIPPAPTQPFPSATPNPSLDPLMREGPVGSGFVSERHIGTGGNGIGVGKRLRI
                     PIERRYFSPPPPTIIYPPEVHDYNEKFTQLLQVIKHRHDPTVTTVAQGVLEWKRMQKT
                     SVIGTPIQEFLDRFYMSRIGIRFLIGQHIALNTLPPHPDYVGIICTRAVHNARYVCEE
                     HYALFKSPNIKLVCPPNLTFPYIPGHLSHICFELLKNSLRAVVERYGVDNDDEYPPIK
                     VVVVEGREDITIKISDEGGGIPRSAIPHIWTYLYTTMSDEGLEDTIQGSDFKAPMAGF
                     GYGLPLSRLYARFFGGDLRLISMDGYGTDVYISLNKLSSR"
     gene            complement(1175086..>1176325)
                     /locus_tag="CNI04410"
                     /db_xref="GeneID:3259689"
     mRNA            complement(join(1175086..1175179,1175221..1175286,
                     1175535..1175651,1175727..1175988,1176048..>1176325))
                     /locus_tag="CNI04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_573021.1"
                     /db_xref="GI:58271729"
                     /db_xref="GeneID:3259689"
     CDS             complement(join(1175147..1175179,1175221..1175286,
                     1175535..1175651,1175727..1175988,1176048..1176325))
                     /locus_tag="CNI04410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573021.1"
                     /db_xref="GI:58271730"
                     /db_xref="GeneID:3259689"
                     /translation="MYTHNSINAPPPPYTPLAPPGRPSAKPSLANLPLHIVHRILILT
                     LDQKATPSKFWSDPDEERVRRLWGMFRGLRGVNRVFWLGKFKAGLAQLIAHYLPFYLA
                     LVKPSYSSDPFPLESSTLASPSLSIDPSNLGDVYAMRGRETAVLDKFVATRVGEELRR
                     MESELSEGSEAERDIFGRLQPSARSEDLLSTLPQTLITPTTLLPSPPSPKRALPLPQS
                     LTPRTTGRFRGKAIIVHKTKYLTLRITRCDGQQ"
     misc_feature    1176454..1176481
                     /note="GC_rich"
     gene            <1176699..>1177907
                     /locus_tag="CNI04420"
                     /db_xref="GeneID:3259529"
     mRNA            join(<1176699..1177181,1177247..1177582,1177665..>1177907)
                     /locus_tag="CNI04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_572588.1"
                     /db_xref="GI:58270863"
                     /db_xref="GeneID:3259529"
     CDS             join(1176699..1177181,1177247..1177582,1177665..1177907)
                     /locus_tag="CNI04420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572588.1"
                     /db_xref="GI:58270864"
                     /db_xref="GeneID:3259529"
                     /translation="MFRLTLTKRLARASAHVTPSPHPRLLSTSYSLFNKGPPTTQGHA
                     VGKGNDDPQAEAAKQGAAVKGTSSSSSTSTSGEAEPFDAARQAGGEKKWSKSQETSGA
                     GKGQSGAFKDQVGGQEGSTPGVSYGGQEDAAADRTHQGIKNTQPGSNKGNFDNLKKMR
                     EEGKNLHTSTRASFPTPSSVPFAPTSANPPGSNKPIESLPSDQNEHLKHSPASSPDKG
                     KGNAGEEPHLPSQQGQNKAGGSKGQTKGLHTSAKVSGNPPGRKYAKAFPGDRSGGDAP
                     AEALPPELESDYGPEANQPAPEDLKPSSGLPHSSTAQEPPHPVLADHAKSGKLAERNS
                     QPTAEMGRQGNSEAWKHRK"
ORIGIN      
        1 taacccccta accctctaac cccctaaccc cctaaccccc taacccccta accccctaac
       61 cccctaaccc ctaaccccct aagttagcga cgaggagtgg aggttgaatg atcttaaaag
      121 gtgtttttta agtagttttt aattcgggta gcatacacga caacccaata agttaaacaa
      181 cgcaaacatg caacctctat aaccctcgct cattcaacaa tttcgaggtg ttttggacaa
      241 gtagacggtt tgagaagact aagctggaca aaagatgaac attgttagcc agcggcacgt
      301 ctcgccagcg tgatggtaaa cttgcttaaa cattaaacat tacaaggatt tcatgtgaaa
      361 ctattgtgag gggcaaaaaa gctatcaaat atactctgct ggtctgcatc caaaggccag
      421 taattgataa gatcatctgg aagagtgaag accgtatcat cataacctgt ctgacttatg
      481 gcttcaaatg caggctgaga aatcgagtta ctgtctaatg aggaagcaaa tggcaattca
      541 ggaccacttt cgtccgctgg tttttctgca cgactgacaa cagcaatttt gggcagctgt
      601 ggaccgttga tttgtggatt aggctgtggt gcagtgtttg tcctcgctcg agaggggtag
      661 gagactgtgg gcgattcgcc ttgaaaaatg tgatggtccg gttttcggtt gtcaaccgtt
      721 gactgcatga agagatcgat tcgggcgata tgcttaagaa gccgctcgct gatccctcct
      781 ccggggataa aaggagtctc gaggcaggca agtaagtttg cgaatgacaa actgttcggt
      841 cagctttgtt aggacaataa gcgcagttgg acagacagga gggcagctta caggatctgg
      901 cggatatgaa ggtacgtgct gatggtcaaa ggaccctgca ccacgctccc caaaagactg
      961 ccgactgccg atagctgatg aagctataaa ggaaggtggt cagcaacagg tgaagcgctc
     1021 gctctgatga aggcaaaccg acgtacgaat ggcgcgctga tcaactgcat gtacgctgtg
     1081 ggtatattcg ccagaacatc cagcagctcg cctgcgatct gacatcgatc tgccatactc
     1141 atcggctggc aacaagcgat tgccatccga acagcctttc ctctgtcagc aacttgagcc
     1201 cggattgcaa aggtatactt tcggcatcaa ctgacctgta gtgtgacgct caaattcgcc
     1261 gcttgaaagc tacagacatt gtcgacaaag tcccccgtca atggcttcgt ctccttgaac
     1321 accgatggca acgcgtcgta tctatatctg atgactggcc aagactcgct gacggaaagc
     1381 gggggacggc cgaatggact tggtagatct ggaggcttat gtggggcggc ccgttgattt
     1441 tgatacgctg cagcatccat tatctcctcc atggcgcggt acaaatcggt cacggtattc
     1501 cacccctgta tccagttcac ggtatccagc tcgcctacca acgtaggtga aagagataag
     1561 gcgtcgtcca gtcggtgatc tgggtatgag acgaagcttt ggcatcttcg atgacggatc
     1621 acaccgcccc aaacggatga cgcgaagaca tcgagcgtat atattgacca gtactactcc
     1681 gtccgtcacc attttcccca cggaagcaag acatatagat acgcaccaaa cacctcctct
     1741 cctgtacttc ccatttttcc agcccctgcg gccactgtga ctcgtcgtga aacgccaatt
     1801 gcgccgacat cccatgatac tgcccgagca tgatctgcaa ttggtcgaaa tccccattct
     1861 gtatacccaa aatcgccagt aaagctgttg ctctcagatc gtcgaattcc ggtccgctac
     1921 ctgaggcgcg cgaggatatg ctggacaaag cggcgcttcg cagaccgtgg acattcgata
     1981 ttatcgctat atcggtgatt ccgcttgagt ctgactggct ggaaggtggg gaccagacct
     2041 tgagtagctc gctacatgct ccatcgcgca gacgcgctgc tgccacggca cagacggcca
     2101 aaacggatgc ttggaaggat ctatcattat cctgacggcg cgccttgacg tgattaatga
     2161 aggttggcca gtgaaagaaa caatacctgc ggaacattca gctgatgatc atcagttggg
     2221 cagtctacga agttacactg gatagacggt catccggtac acctccgcaa gctgcagggt
     2281 ggtgtcaaga tctatgttgt tggtagctat ccattcgctg gtattgcttg ctcgaatgga
     2341 agacggagct ggctgtagcg gtgcattttt gggaggagcc tggacagggc attagcaaaa
     2401 tgcaacctgg aatgacttct taacccaccc ctcttcttcc ctgaggtcga tcgtacgtgc
     2461 atttttgccc ataatcaata cacggctgac atagtggtgg ggcctctgaa ggcgagcact
     2521 gatagactga tcaatcgaga tccacagctc caaatcgata atttcctcac cttattcccg
     2581 agtttatggc atctatcgca ggctctctgg atgacatcag tgcagggatc gccggaggat
     2641 aacagtaccc actgagaccc gttttctctt ggaacccaac atgattgatc agtcaagtag
     2701 agtttaggat aatcatcaaa gatctggtaa taatcggcaa acaaataaga tgtttttttg
     2761 atactgtaaa gcaggtatca aaataggctc gcgttagtct gtgtgcttaa cctttgcgcc
     2821 gaccctagtt gattcccatt ttcccattac atttagtgct taattatgta cagcaacgaa
     2881 tagtggtaga gtggtagagc tgcatgcagt atcgaaaact atgaaaacaa agcagcctta
     2941 actgaatgag gccgaatatt ccgttcccct cccaatgaga ataatcctcc tcaaaattgt
     3001 ccattaaacc aatccttcgt tctatctgtt attatcataa tatcgtcctc ccatctctgt
     3061 ctcacccaag tccctcttga ggatttcgca ccgttgatct gcatcaacct ctccaactca
     3121 aagccaccat tgaaggcgat atgcccaagc ttcccaacgc gaaacagagc tacgaacgtg
     3181 aattcatgag caaattcgtt ttcctgagat aaagacaaat tctgtcaaga gtcatgcctt
     3241 gggatttgtg tatgatgatg gcaaagacta gttgacgagg atctgaatgc tattacaggc
     3301 aaatccatta tatcatggag gtgattggaa acgcaatggt ggctcaagac attccatacc
     3361 cgcttcctca caaaaatctc ccaaatgggt tgcctagaat ggggaaggat atataagtaa
     3421 agattctttt tcgtatatgg aagatctcat cgggatccat tccatattgt tgtagtcatt
     3481 aaaatttgtc cttcataaat aagaggctgt ccaacgctta cacttccctt ccctagtgac
     3541 atctgaatca aatcatcgct cgttgcacgt gatgcatgta cctaccgtta tcttgctctg
     3601 aaaggtcttg atgcagttga tagcgagcac agtatgttgt gggatagcag gtgtgtcaac
     3661 atcatgcgtg aagggtatac acaaaggagg gatggttctt cggcattcaa tacaggtgtc
     3721 atataattcg cggtcagcct cgaaatgtcc ttgcagaaaa gatttgtcag agaggcacat
     3781 ttgataggtc gatcaggtcg tggtgggttg ccggagctgt tgatcatcct cgtcttcatc
     3841 atcaaaccgt gcaggagcgt gaagttcacg tcttggtggt caatgaagag gagtaggctg
     3901 ttgctcaggg acatggagtt gctgaccacc ttcgttttca tcgtccatct gtgttggagg
     3961 ccggcattca cgtctcggat gacggagagc aggatactgg ccacttggaa agcgatcaga
     4021 gggaagtaaa ttgggaggct cagcctgagg actgtcgaca acgtcgggcg cgatcagatg
     4081 tagagggcat gtcgccaata tcggccaaag ttgtagtacg tttactcatt gtcgtggagc
     4141 gatggtaggg gataccaggg gcacttaatg actgcacgac atataggtag agaatcaaga
     4201 gagtaacagg acgtaacagg acgaacgaat gacaaacgcg acgcgttttt gtaccaagtc
     4261 gcgtcgagga agtgcatgcc tacagccgat caccgcttgc cttaccttct tcagccaaat
     4321 tcaagtaaac ggcgcagaca ttctaagtat gcatgcatag taccattaaa agggcggacc
     4381 tggaagcaac tcagtggtat aagtgtcggt gctgcaggac gagctttgat cgagtaatgt
     4441 ggaattaaaa gagacaaaaa agggggtgtt tcgcgaatat tagtacagaa acgcgtgaaa
     4501 aagtggtaaa aagtgcatgc ctagagcgtt tttgcgcgcg cctaaagaca cgccttcagc
     4561 caatttcaac taagagactg aggggtttat ataatacatg catggtactg ttttacgggc
     4621 gagcctgagc tgagttcaat ggtacaagtt tgaaagccgt acgatgagtt ttaaccgagt
     4681 attatggaaa tgaaaaacac ataaaaagtg ggacgtcggg agtactggtt gcccgctaac
     4741 gcgagcgatg aaagaggtgc agtgtattaa cggctgcttc gttacagtac ggatttgacc
     4801 gaaaggagga atcgtcgcgt aattaccaga attaacagta ttaacaggtt gtctttccgc
     4861 cgaggatatg tgtgtcatgg atttaggggt tcaagtcaat gacatctgca tatataacgc
     4921 tcagaatgat gaaggtcgag acctctgttc atgccaactg cactcgatag tactcgctca
     4981 tttcaatttc gccagctttt caacgatgct ctcacacagt ctccttgctt cccttcgcgc
     5041 tcgttgcgcc gtttccttgc ttgcgtcctc gtccacctcc gtccgatccc tcgccactca
     5101 agcctcgtcc accatcacat ctatcagacc cagccgtgat gaaatcgtca acatgcgcct
     5161 cagccaaaga tctatccaag cagccctcga agctttacgg gcagacggga tagtcgtggt
     5221 cgaagacgta gtcaacaaag aggcgatcga taagctcaat tcccacatgg agaaggacac
     5281 acatacgctc atggcacgag gagagaaggg accgttcaac tataacctag gcaatctaca
     5341 acagagcccg ccatacgatc cggatctgtt ctcaccgtcg atatttgtga atcctttcgg
     5401 gatacaagtg acgaatgcct accttgggga acgcccgacc atgtcgttca tctcggccaa
     5461 ctcggccgtg aaggcagagg tgggacagcc agtacattct gatgctgact tcagccatcc
     5521 aagtgtaagt agacagcgtt catgaatcgg cgccatgacc aaacctcgct gatatgtata
     5581 tagattccat ttgcagctgt ggttaatgtc ggcctcgtcg acatgaaccc caaaaacggc
     5641 tcaacccgtg agcgtcgaaa aggcgatggc ggttattctc tacgctaaca ttcccttcag
     5701 aggtctggct cggaacacat gatggcacgg atctttcttg tcaggaagga gcgcatgggg
     5761 agagagcctc cggtcgaatc aagcaggatt tattggatgc ccggaaatca atttctcctc
     5821 cattgcagcc cactatcccg aaaggtgtgt agaatgactt tccatacctt ggtccaggct
     5881 agctgttctc ttgcaccaaa atgtgtggag atgttaacca tcaattaggc tcactgatca
     5941 tccgcgatct tcgattgtgg cacgccggta tgcccaatac aaccgacgag atcaggatca
     6001 tgttggcaat gatccacttt gcgccttggt acagacaacg aatgaccatg aagctgcccc
     6061 gatctctgcg acccacacta gaaggagtgg accggctggg cgtggcggcg gactggcagg
     6121 acgcagaggt agatcatctg gatgcgccgt atgggaatgc gtttgatttc agccaggatc
     6181 agtagtgttc ttccagcatt gagtaggttt ctagtcatgt atgcaagctg tttattgtca
     6241 ccgttaatct gaaatgctgg ctgtcattca atcttcaaga cactctatac acgttcatga
     6301 aaatatcccg ggtcaccgtg aacactgggt ttaacctcca caacttaaca aaacgttgtc
     6361 agcctccaac cttccctggg ctagggggcc actccaagaa atttcaccaa tggttttgtg
     6421 gatagggcgg aaacgcccgc atggtctggg cagtaaactc gcttagtcca aatgtccggc
     6481 tgccatccgg ttcggaacga gatattatca gagataacag ctgtggcccc tattaattaa
     6541 tgtccattct cactccaaaa aatcgatggc aaattttaca agactgtcgt cttacttgcc
     6601 agacagtaac ggacgagact cgtctttacc tagtcattca aacctgcatg gttcttcata
     6661 accttttggt tgagacttag acttggaagg actcgctgac tacatctgag gtggacgggg
     6721 tgatgaatat cgatgaacat gcaactggca ttggtgatca agcagcaaat agacggaggg
     6781 atgaagttgt tgcggaattg atcagcggtg aagttcgtag agatccggct tttgacgtta
     6841 atacatttgg aatgtgaatt gccgaagacg agacatgcat gcatgaagac ccaagatatc
     6901 tgccggctgt ccgacttcgt ccaagcacgg aaagcgcttc ttgcaaggag atcttcattt
     6961 gagatgcaat ccttgcagcg gcttccgttt cctcaatttc tattttccgc tcataatatc
     7021 cttttttgga ctcacgaagg tcattttgtt tttcaaaata aacagcttcc ctttcccagt
     7081 gatcctcctc cttctccgtt cgcgcgattt cccgcatttc tttatttatg cggcactgcg
     7141 ctgcctcgtg acgtaacttc atgtcctctt ccagcatttt gcggctgtcc tcgctcattt
     7201 ccgaagtagg agctccatga ggtcggtggg ctatagaaac gttagcagac ataaaagcaa
     7261 gtaaacagga cgcatttacg gtggccgagc cgccttctga ttgattcgcc aagcagaaga
     7321 tgttgtgaac ttatatcccc ttcatcttcc tcatgacaag aattccctac ctcctggaga
     7381 tcatcattgt cattatcgcc atagatactc cttgattggt gttgtcgatc ttcgctggtc
     7441 ccctcgtcca cggaccaagg ctgttccaga ggagcattgt cagatgtcgt gtctttatga
     7501 ggacgtgaga cgtgttccct catgcaattt agagagggat tgctgtcgct attggtactc
     7561 ttcataaaca aaggtcttgc gacttgttgg ctttggaaga tctcgttcca gaagttgtaa
     7621 tcgggacaat agcgttctcg gagatctaaa gataattgcc ggcctgcatg tcatggtttg
     7681 atatgatttg gcttctgtgg gtaaacttac caccgagatt atcataggga atatccacat
     7741 cgcctgtcgg tgtatgaatt gtgatgatac ctccgtctcc agctccaggt tgctgagtaa
     7801 ggttataggc agttctccaa ccctttctca cagatatata ctatgtgaat attgattcgt
     7861 tgagcatgtt ggatggatag agatggagct tagagatgga gcttagatgg agcttagatg
     7921 gagcttagat ggagcttaga tggagcttag atggagctta gatggagctt agttatagac
     7981 tgcccaaggg caactcacct tagtttcaat gctcttaaca gaacgcttgg tcggcgcctt
     8041 tttctcgtac aaggaccttt ggaactcttt cgcccctctc ttcaaagtat agccccccac
     8101 ggcaccagac agtgggaatc caatctttga aataagcaaa actcgattgt tggtcttccc
     8161 ctccgcagtc cttttcccag tcattttttc gatcagtcca ccagctctct tccgctggtg
     8221 gagttttatc tgtcccgtca ccgactgata ccacaggatt cttctttgga cgtttggagg
     8281 cgttggtggt cggttggagc ggaacagtcg cagatgcccc ggtctgactc tgagatgact
     8341 gagccgaaga gtggcgacgc ttcgaagggg aagattgttc gggctgggaa gggttgtatt
     8401 ggatccaaaa ttggtagagg aagattttgc agaagactag caaaatgacg aacaagagaa
     8461 gatgcatgct gctgggattg cgtttggcac gtctcgaccc cgatcccaag agtgagcctg
     8521 atatgagtct gatattgacc gttgggacag aatctggacg gatctcgacg aagaattgac
     8581 tccccctccg tcagtaatct ttgcagtcca tcctgtcgaa ttgattggca agccgaacta
     8641 cttccaatga acgcggcccg aatcctaatc gggaatcatg tccatgcttc tttcccccgg
     8701 ctgttaatga ggtgggggtt gttagagttg tagaactaag gttcatcatc aagactccca
     8761 agaagaacgg caggagggca aaatcttggc agggatgtat gtgccttgcc gagccacctg
     8821 gcgttatcag ataaccacaa ttcggccgat taccacattg ctgattcctc accgctgtac
     8881 cacttcgacc ttgctgatgt ataaattgga aacagttgag tcagaaaaat aagttcttca
     8941 acccaaaact ctccatttca aactcctcac ccgccccttt tacaaacttc aacacgatga
     9001 agcttcttct tgttgcctct gccctcgcta ccgctatctc tgtgcaggcc cagtctgagt
     9061 cgtgagtaca ccacgccgta tctcgctgac tgttccagac tctcccagtg tgtactggac
     9121 tgcatgaccc agactgccga gacggtcgac gtttgtgacg ccaattagtg agtgcagcca
     9181 agtaaacatc cgttgacttt tagcaaccaa acctcctgtc tttgtaccga agactttgcc
     9241 caggaaaccc gccactgttt ctacaagtga gttttgtctc ccaagtactt cagctgatga
     9301 cagtaacacg tgctacgcgg acatcatccc attctacaac ttccgagagg ccgaatgcgg
     9361 tactcttgcc gatgacatcg actacgccgg cttcatcccc agtaacggca actccactta
     9421 tgacttggcc aacggtacat catccgctgc agcgtcaggg agtgcatcag cctcagctgc
     9481 tgcctctagc gcggccactt cgaatgctgc cacaacttcc gcttctgcta ccgccagctc
     9541 aggcgctgct gcttcgtcca gcggcgctgc ccttgctgct attgacatgg tcaccgcccg
     9601 tggccttgca gtcggtggaa tgtccgtcgc cggtgtcctc gtcggtggtc tcttgctcat
     9661 ctaggtggga gtcgctttta gagtgctagt ttgggtctgg gtgttgtctc ggtcgtttgg
     9721 aattaccctt atggatatcc tgacaaattt tctcctgccg tcctgccttt caatactccg
     9781 tctatgcgct cgcccgtgtg aagattaaat ttcggtcccc gtacacctga gggagttaaa
     9841 tagcacgaaa tatacattcg attatactga ctgacgataa ctcaaactgc cacagaaggc
     9901 gaggcggaga tagcggcagc tgaaaccaac gaaggtacta gtcggcaatc tgacatgaag
     9961 aatgagagtt actagttact acgtgaggcc gggggatgga taatgaatga aaagcttgct
    10021 gtgcgttgtc gaccacagac ggtgagcagg catgagcgaa agtccgactg tagaagccat
    10081 tgtcagcgac catcacatcg agcaaacgtg caaaacatac acgtacattc ttcgcgtcat
    10141 ccagttggta tagtcattcg ccatatatcg tctctctgca atgtttgcgc tcgttgcctg
    10201 ttccagactt tcatctctcc tcatcaatcc ctcaaaaata acctttaaca ttgaatgaat
    10261 tattgcgtcc aggtaaaagg attccaaacc ggagagtaga aagcaagacg cgacgtcaaa
    10321 tatgaataga gccggcaaaa gaaagtggca gcgaggagtc gggagatttg gtaagctgca
    10381 agcaatgatt agcggcgcca cagtaaatga tcttcgagtc gtacaactca ccaccgctgt
    10441 aaggtcaggc aaaaaacgta gcgctccatc gaggatttca cctcaataag caatgctggc
    10501 ttgagatccc atccatcttt tgaatggcga tggcacacac ttgcgaacgt gatacaggaa
    10561 gaagggtgat atgcgaaaga aacgttctca atattctttt cgatccattg cggagataca
    10621 agtcggctgt ggaaacacag gtcggttgtg gaaatacaag cctgctggga acggtattcc
    10681 gggagctaag tgggaataca acgtcaacat ggatagcgaa tgcgtgcacg ccatttggac
    10741 acacttgaat ttccatatac ataaattcac catgtcgtcc tggggtttga atatgaagct
    10801 tcacaaccgc agtgacgcat cctctggggt ggtattcggt gacgatgcac agacaggtga
    10861 ccagctagat gggtatatat cgtcaggaag tgcagtacaa ctctcaattt atcaaaactc
    10921 acatctacat ctctatgctt gcatccagct cctcatcgca tgttttgaga gcaccaaagt
    10981 gaattcgatg cggtctttca acatttagaa agatgtgaat ggagtactaa acctgtatac
    11041 tttatcaacg aacgagcagc gagtaaaagc caaggggaac cgacaattca cgccttggct
    11101 cctagaacgg catctctcca tcctatggcg gtgacacgga agcatggata aggtgacatg
    11161 aagggatcgg gtggcttcaa tacaggatat gccgtgtttg gatacaatgg gatccggcat
    11221 gtacagtaat acagtactcg tactgtcgtc ccggtaagcg ggatatgatg gttagctaac
    11281 atgccaaaac gaacgacgca atgaagcaat gaagcgctca ggccaaaagt aatcttgcag
    11341 ccttaggtgt aataaatagg cgatttgaaa agcccaaagg tcatctatgc gtactgggaa
    11401 ggtatctttc gcattccaga taggttaaaa tctttttgta gaagatggac cccttaatcc
    11461 agcgtagggt acgagaaaca cttgactagt cacctacgac agacaggata ggaactcaga
    11521 aatacacagt gatatccagc cgcatagccc aaatcccggc cacaggacta attcccacag
    11581 tgcggatcaa attggccatc aatattcatg cgttatatgt gctaacggca gtcatccctc
    11641 catcctatcc acctttccgc acacagatgt acagatgtcc agcgcagcgt taatcctaat
    11701 tgggcattac gatcttgatt ctttcctcca ggtgttagtc aaggctcact ataaagtaca
    11761 gtatgagagc ggaggtcagc atcatagata ttcgccaatc tgcacaccta ttctccattc
    11821 tcatcgtctt ttcatacttg ttcttcgatt tcgtcttctc gtcccgatac gtcttgtttt
    11881 gtcatgcctt cgaggccaat cgcaccaaga acaaaacatt gaactctgct aagatcgtga
    11941 tttgcacagc gcatgcaggt atgtttcatt ttgagtaaga gagaggtgta acaacgtttt
    12001 tttagtcaaa aggaaaaatc atatgctgaa tccacctcgc tcttcccact tccacaaact
    12061 tgttcctcct ccacttctta tacttcccac tttccgattc ctaaccctcc tcctctaaga
    12121 ccttcggtag gttttctttt catccttccc ctcctttcct gcatactcgc tctctacaac
    12181 gacgcacact ctccccacca gcccacctta tacacatacc atcccctacc ctcagacgta
    12241 ccattcccaa aaacagcgct gagtccaaaa gctcgactaa acttgaagaa cgaaagacgc
    12301 tgtttctaag aatgggaaat ccgcaggaac tggagttgaa tggagagtgg ataacttaga
    12361 agactgtagt tgacgtcagc tcagtccgag gtcaatgaga gggaggggag gggccttgaa
    12421 atactcacgg aggtcaccga gaccagtggc atcgatacca gagttctcct tgatacccaa
    12481 ctcaaagtct acgtagaaaa cgtctggtca gcaagccagc aacacaaaga aagtaagcga
    12541 tgtgaaaaaa tcaaagactc acatccgtag ataatagtag tggccatcaa aataccagtt
    12601 ccacttccca aagcacccat catatccgcc accacactca acaagccaag agtcgcacct
    12661 ccaaacgccg cagcagtcgg gataatcctc ttcaactcct tgtaaataga cgcatctctg
    12721 tgtcctgcaa gagtcatatt ctggtccttc aactgcttgg ccacatctcg agggccggag
    12781 ccggagactt cgatccaggt cttagagaaa agggcgcacg cggtgacgat gaaggcgatg
    12841 tagatgacgg tgtggaaggg gtccttgagg gcagaggtga gagagtgagg agcggacatg
    12901 tagtaggcga tcccggagac ggcgcccagt tgagtagggt tgttctccat gggctaattt
    12961 gttgggatga ttagtacaaa tcgtacgcga accacaagaa gaacaaaaaa gtaaacctac
    13021 ctcccaaacg cccaaaagac ggacaagcaa gttgtcaggg aatcgaccgg caagcatctg
    13081 actaacgagg aagacattgc tggttaaagc gctctggagc atgataggca tgttggaagt
    13141 gtagaaaagc ttgacgggat aagtgcccct ctggcccctc atcttggagc tcttgatggg
    13201 gatctcgatt cggaaacctt gaaggtaaat cacggcagca aagacagcga cggtcgcgag
    13261 gagattcata atgttcggaa gacgatcgcg gtagaaggct tccttgaggg cgcgagtctt
    13321 gtcgttccat gtgaacaaaa ggtggatgag ggcgatgatg gcaccttcga attccggtcc
    13381 acgaccggtg ttgacagtgt tgggagaaaa ggccttccaa acgatagact cgcaaatgtt
    13441 ggtagcgatg aaaagagaga taccggaacc aagaccgtag cccttggtga ggagctcatc
    13501 gaggaggatg acgatgaggg aggcagaaac gagctgaagg ataaggagaa gacagacacc
    13561 cgcgccgaga gaggaggggg agccgtaaag accagtcaag acgtaaacgg tagcctgtcc
    13621 aagggagata atcatggcga acactgcgtc gcgttagttg ctggactggt taggaaaacg
    13681 acaaagtgct tacacttttg ggcagcaccg aacaaggcac ggtcgtcctt gaggctaaag
    13741 tcgacatcaa tcaactgagc acccgcgagg agctgcatga tcatgccaga agtaacaata
    13801 ggagtgatac cgagctccat caaggtaccc ctgttggaag cgaggatagc acggagccag
    13861 taaagaggat cggaggagtc ggaggacatg atgccgtaga gcggaacttg tgagcagacg
    13921 aggaagatga ggagggtgac ggctgtccag gcgatcttgt ggttgaaaac gacctaggga
    13981 cgcgtcaagt ttgtgagcag agaacagaga tgggatggag aggttgaaag acgcgtacct
    1