GenomeNet

Database: RefSeq
Entry: NC_007624
LinkDB: NC_007624
Original site: NC_007624 
LOCUS       NC_007624            1156948 bp    DNA     circular CON 18-DEC-2014
DEFINITION  Brucella melitensis biovar Abortus 2308 chromosome II, complete
            sequence.
ACCESSION   NC_007624
VERSION     NC_007624.1  GI:83268957
DBLINK      BioProject: PRJNA62937
KEYWORDS    RefSeq; complete genome.
SOURCE      Brucella abortus 2308
  ORGANISM  Brucella abortus 2308
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Brucellaceae; Brucella.
REFERENCE   1  (bases 1 to 1156948)
  AUTHORS   Chain,P.S., Comerci,D.J., Tolmasky,M.E., Larimer,F.W.,
            Malfatti,S.A., Vergez,L.M., Aguero,F., Land,M.L., Ugalde,R.A. and
            Garcia,E.
  CONSRTM   Microbial Genomics Group, Lawrence Livermore National Laboratory,
            and the Genome Analysis Group, Oak Ridge National Laboratory
  TITLE     Whole-genome analyses of speciation events in pathogenic brucellae
  JOURNAL   Infect. Immun. 73 (12), 8353-8361 (2005)
   PUBMED   16299333
REFERENCE   2  (bases 1 to 1156948)
  AUTHORS   Larimer,F.
  CONSRTM   Microbial Genomics Group, Lawrence Livermore National Laboratory,
            and the Genome Analysis Group
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2005) Oak Ridge National Laboratory, 1 Bethel
            Valley Road, Bldg 5700 A201 Oak Ridge, TN 37831, USA
REFERENCE   3  (bases 1 to 1156948)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AM040265.
            Submitted on behalf of the Microbial Genomics Group, Lawrence
            Livermore National Laboratory, and the Genome Analysis Group, Oak
            Ridge National Laboratory;
            chain2@llnl.gov, larimerfw@ornl.gov.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1156948
                     /organism="Brucella abortus 2308"
                     /mol_type="genomic DNA"
                     /strain="2308"
                     /db_xref="taxon:359391"
                     /chromosome="II"
     gene            complement(1..60)
                     /gene="ctRNA"
                     /locus_tag="BAB2_1165"
                     /db_xref="GeneID:3828139"
     misc_RNA        complement(1..60)
                     /gene="ctRNA"
                     /locus_tag="BAB2_1165"
                     /product="antisense RNA, repressor of repC"
                     /db_xref="GeneID:3828139"
     gene            89..1348
                     /gene="repC"
                     /locus_tag="BAB2_0001"
                     /db_xref="GeneID:3827833"
     misc_signal     89..156
                     /gene="repC"
                     /locus_tag="BAB2_0001"
                     /note="S-element"
     CDS             155..1348
                     /gene="repC"
                     /locus_tag="BAB2_0001"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepC"
                     /protein_id="YP_418249.1"
                     /db_xref="GI:83268958"
                     /db_xref="GeneID:3827833"
                     /translation="MEIQLASTPFGSRRMSFALLAAQKKARQIPQGAAADKWQLHRWL
                     CEAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLALRAHGMADATLRR
                     HLAALVEAGLIARQDSPNGKRYARRAKGGELQIAFGFSLAPLLARAPEFEAAAEEIKT
                     AKAQLREMREQLTLLRRDIAKLIEFALIEGLEGPWAHLNQRFRDIVEAIPRRADVQEL
                     AMLVEQMREIRENVDKLLKTNKKAENLSGNESQNERQLNESKPDSHFDETALSHEDQR
                     VFENSQVQKEPSISLDMVLRACPEIETYASGSIRIWQDLIETAGKVRIFLGIDNKLYD
                     MATKTLGIHNAAITIAYILQRYDHIRSAGGYLRILSEKAASGAFSIKPLMMSAMCNRK
                     QPARC"
     misc_feature    155..1345
                     /gene="repC"
                     /locus_tag="BAB2_0001"
                     /note="replication initiation protein RepC; Provisional;
                     Region: PRK13824"
                     /db_xref="CDD:184349"
     misc_feature    191..721
                     /gene="repC"
                     /locus_tag="BAB2_0001"
                     /note="Replication protein C N-terminal domain; Region:
                     RP-C; pfam03428"
                     /db_xref="CDD:251945"
     misc_feature    731..1336
                     /gene="repC"
                     /locus_tag="BAB2_0001"
                     /note="Replication protein C C-terminal region; Region:
                     RP-C_C; pfam11800"
                     /db_xref="CDD:256631"
     gene            1551..1814
                     /locus_tag="BAB2_0002"
                     /db_xref="GeneID:3827437"
     CDS             1551..1814
                     /locus_tag="BAB2_0002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418250.1"
                     /db_xref="GI:83268959"
                     /db_xref="GeneID:3827437"
                     /translation="MRRQIACAKSLFHFEPAACMQPALESAAAKTAARLWNVAGLQLK
                     FLCSGRGEQAQEKQDATPDGEHPEYLIGQVVNHVCDPKIDESA"
     gene            1963..2076
                     /locus_tag="BAB2_0003"
                     /db_xref="GeneID:3827438"
     CDS             1963..2076
                     /locus_tag="BAB2_0003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418251.1"
                     /db_xref="GI:83268960"
                     /db_xref="GeneID:3827438"
                     /translation="MRAGLLWQGFLSGFSWVVYENGLAWKFFPFAAMVRQY"
     gene            2092..3033
                     /locus_tag="BAB2_0004"
                     /db_xref="GeneID:3827439"
     CDS             2092..3033
                     /locus_tag="BAB2_0004"
                     /EC_number="2.7.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase:carbohydrate kinase"
                     /protein_id="YP_418252.1"
                     /db_xref="GI:83268961"
                     /db_xref="GeneID:3827439"
                     /translation="MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLG
                     GKGANQAVAVAKLGGAIRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAI
                     IQVEETGQNTIAVCAGANARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVR
                     AAGGTVLLDPAPVGDASQMADLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLL
                     ERGPKIVILKLGSRGALLITADEVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPL
                     HDCVRYSSAAGAIAVTRVGAGAAAPTAREVEELIGRA"
     misc_feature    2116..2997
                     /locus_tag="BAB2_0004"
                     /note="Ribokinase catalyses the phosphorylation of ribose
                     to ribose-5-phosphate using ATP. This reaction is the
                     first step in the ribose metabolism. It traps ribose
                     within the cell after uptake and also prepares the sugar
                     for use in the synthesis of nucleotides...; Region:
                     ribokinase; cd01174"
                     /db_xref="CDD:238579"
     misc_feature    order(2140..2142,2146..2148,2221..2229,2236..2238,
                     2392..2394,2398..2400,2428..2430,2434..2436,2527..2529,
                     2857..2862,2869..2871,2977..2979)
                     /locus_tag="BAB2_0004"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238579"
     misc_feature    order(2149..2151,2155..2157,2170..2190,2227..2229,
                     2389..2391,2395..2403,2419..2442,2605..2607)
                     /locus_tag="BAB2_0004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238579"
     misc_feature    order(2665..2667,2773..2781,2788..2790,2827..2829,
                     2845..2847,2854..2856,2863..2868,2875..2877,2941..2943,
                     2950..2955,2962..2964)
                     /locus_tag="BAB2_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238579"
     gene            complement(3110..4108)
                     /locus_tag="BAB2_0005"
                     /db_xref="GeneID:3827440"
     CDS             complement(3110..4108)
                     /locus_tag="BAB2_0005"
                     /EC_number="3.2.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine/uridine-preferring nucleoside hydrolase"
                     /protein_id="YP_418253.1"
                     /db_xref="GI:83268962"
                     /db_xref="GeneID:3827440"
                     /translation="MLSKHAVSCAIPSQRTHQETTMARKIIIDTDPGQDDAVAILLAL
                     ASPELDILGITAVAGNGPLARTEVNARTVCEVAKKPDTKVFAGSIRPLVRPLVTAENV
                     HGKTGLDGYDLPAPTMPLQAQHGVDFIIETLMKEEPGTVTLCPIGPLTNIASALIRES
                     KIAGRVKEIVLMGGGYFEGGNITPSAEFNIYVDPHAASVVFSSGIKITMLPLDVTHKV
                     LTTEKRIAAIRNIGSHVGEVVAAWLEFFERYDEAKYGTDGAPLHDPNVIAYLIKPELY
                     SGRACNVEIEINSELTIGETVVDWWEVTDRPKNAFFIKDVDADGFFSLLTERLATL"
     misc_feature    complement(3122..4036)
                     /locus_tag="BAB2_0005"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(3320..3322,3542..3544,3548..3550,
                     3566..3568,3671..3673,3803..3805,3929..3931,4001..4006,
                     4016..4018))
                     /locus_tag="BAB2_0005"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    complement(order(3233..3235,3242..3247,3251..3253,
                     3512..3514,3638..3640,3833..3835))
                     /locus_tag="BAB2_0005"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            complement(4131..4910)
                     /locus_tag="BAB2_0006"
                     /pseudo
                     /db_xref="GeneID:3827441"
     misc_feature    complement(4131..4910)
                     /locus_tag="BAB2_0006"
                     /note="Cl-channel, voltage gated:Bacterial inner-membrane
                     translocator"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12172.1"
     gene            complement(4907..5986)
                     /locus_tag="BAB2_0007"
                     /db_xref="GeneID:3827442"
     CDS             complement(4907..5986)
                     /locus_tag="BAB2_0007"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418254.1"
                     /db_xref="GI:83268963"
                     /db_xref="GeneID:3827442"
                     /translation="MRRFIAYLIPFFLTVLVIGVIMAVLLVPLALMQDNPAAILKTFF
                     LGPFGSIRHMGNVVEAATPIMLTGLAITILFRSGLFNLGAESGFFLGALGAVAGAVLL
                     PSLGWFSLPVAILCGAVAGSFACTIPAALRLRFGASEMVTSLVLNYAFLFLGLFVLNY
                     VIRDPNAGGMMSLRIPADAKLDRLLAGTRLNSGSIIAVLACIAGGIWLYWTRSGLNIR
                     IAGSSPGFANHLGLPLKGIIMRAQIVGGLVAGMAGALEVLGLHARFAWLDLPGYGWTG
                     LVVAILARENPFLLIPSALFLGFVQVGGDLLARNMNIPTEVVGLVTAAIMVGATASVI
                     HNHPTVLRLIRSLRNRDGEQAGVQA"
     misc_feature    complement(5006..5806)
                     /locus_tag="BAB2_0007"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(5258..5314)
                     /locus_tag="BAB2_0007"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(6048..7619)
                     /locus_tag="BAB2_0008"
                     /db_xref="GeneID:3827443"
     CDS             complement(6048..7619)
                     /locus_tag="BAB2_0008"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418255.1"
                     /db_xref="GI:83268964"
                     /db_xref="GeneID:3827443"
                     /translation="MEKQAETSEGGDAIVAFRPIVAFRDVSKIYPNGTVALRDVSFSI
                     RAGSIHAICGENGAGKSTLMKILFGIENATAGEIVVDGKHIASWSPEDAAAQGIGMVH
                     QHFSLVPTLTVTENIILGHEPVKAGLIDRAGARKMVETLMQQYDLHADPDAITGTLSV
                     AAQQKVEILKALARRTRLLILDEPTAVLSPPEIEELMRRLKSLRDDGITILFISHKLN
                     EVRELAESVTVLRAGAVAGTEKLADVPDDAIMQMVMGHAVDIPKRAHQRGPGRTVLEM
                     KDVTTAAPDPADRIRSVSLTIGAGEIIGVAGVDGSGQRGLVSVLSGLAVAASGTISLN
                     GVDMLRADTASWRKKGLAYLPADRFSQGGAPGLSLTENAIAGAGSVTADRQIFRGPFL
                     RWSAIKARVSGMIRQYSVRAGAITERLDSLSGGNAQKLIAARELATNPKFLIADQPTR
                     GIDVSAAAFLHRRIDEVAQGGCAVLLVSADLDELLRLSDRIVVLFNGRIATILDNGPE
                     ITPAVLGPYMLGTRA"
     misc_feature    complement(6060..7568)
                     /locus_tag="BAB2_0008"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    complement(6906..7559)
                     /locus_tag="BAB2_0008"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(7437..7460)
                     /locus_tag="BAB2_0008"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(6975..6977,7071..7076,7311..7313,
                     7434..7442,7446..7451))
                     /locus_tag="BAB2_0008"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7311..7322)
                     /locus_tag="BAB2_0008"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7119..7148)
                     /locus_tag="BAB2_0008"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7071..7088)
                     /locus_tag="BAB2_0008"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(7053..7064)
                     /locus_tag="BAB2_0008"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(6969..6989)
                     /locus_tag="BAB2_0008"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(6123..6812)
                     /locus_tag="BAB2_0008"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(7622..8728)
                     /locus_tag="BAB2_0009"
                     /db_xref="GeneID:3827444"
     CDS             complement(7622..8728)
                     /locus_tag="BAB2_0009"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine nucleotide translocator 1:basic membrane
                     lipoprotein"
                     /protein_id="YP_418256.1"
                     /db_xref="GI:83268965"
                     /db_xref="GeneID:3827444"
                     /translation="MIKSTRRGIIHLAFALAASTAIGTFATSAAEAKDKIMLIVNGTL
                     GDKSFFDSAANGMKMIKDKYGDEVETRILEIGDDPTKWEPVLLDASEQDWDLIIAGTY
                     QMAETVGSVAQQYPDKKYILYDASVPYEEGGYDNVYSIQYKQNEGSYLGGLLAASLLK
                     EGKLGDGAKNLGFLGGMDIPVINDFLVGYIAGAQSVIPDAKIAVSYAGSFMDAAKGKE
                     LGLAQYRSGVSLGFVVASQTGLGQLSAAKETGKYVLGVDSDQEAIFKDSDPAIAKQVV
                     SSVLKNIDVSLLQAYERYKAGNLPFGKAEALGLKEGAVGIVQDGNMATMATPDIKDAI
                     KKASDEISEGKITVPTTFGMSTEDLNAIRNKVRP"
     misc_feature    complement(7781..8626)
                     /locus_tag="BAB2_0009"
                     /note="Periplasmic binding domain of basic membrane
                     lipoprotein, PnrA, in Treponema pallidum and its homologs
                     from other bacteria and Archaea; Region:
                     PBP1_BmpA_PnrA_like; cd06354"
                     /db_xref="CDD:107349"
     misc_feature    complement(order(7886..7888,7958..7960,8021..8023,
                     8099..8101,8183..8185,8357..8359,8579..8581,8606..8608))
                     /locus_tag="BAB2_0009"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107349"
     gene            8972..9580
                     /locus_tag="BAB2_0010"
                     /db_xref="GeneID:3827445"
     CDS             8972..9580
                     /locus_tag="BAB2_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418257.1"
                     /db_xref="GI:83268966"
                     /db_xref="GeneID:3827445"
                     /translation="MRKAAVLSVLGFLAASQVMVENGWAEDGWKAVEIVKPYAIAGTT
                     PPELYESIGARGPKIGERRVIAHTSYVLTWDREFDRSNGACTVVSATPRLRITYMLPN
                     PSQTLAPPVKERWDRFYDGIRRHELVHGDHAKAMTREIVRRTVGLSVPNDPKCRKIRK
                     VLAKEITDMVQVQRAQGRDFDHVEMGNGGNVQQLILTFLNGN"
     misc_feature    8972..9577
                     /locus_tag="BAB2_0010"
                     /note="Predicted secreted Zn-dependent protease
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG5664"
                     /db_xref="CDD:227951"
     gene            complement(9552..10184)
                     /locus_tag="BAB2_0011"
                     /db_xref="GeneID:3827446"
     CDS             complement(9552..10184)
                     /locus_tag="BAB2_0011"
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthetase component D"
                     /protein_id="YP_418258.1"
                     /db_xref="GI:83268967"
                     /db_xref="GeneID:3827446"
                     /translation="MARYSASKPLIDPSIPAPARAAPRRKAEFVAGQACAREALRLAG
                     GPAVMPGRGDDHAPIWPPGMVGSISHSKGCAIAVAARQSRYLGLGIDIERLQTESSAR
                     KIAPQILGESELRQLPEAGRAFLVSLAFSAKESLFKALYPAVQQFQSFHAAAFSFDGD
                     RQQACLELAVDWSAQWRRGQRFPIRFFCRDGFILTCTAIAAISCRSEMSG"
     misc_feature    complement(9588..>10109)
                     /locus_tag="BAB2_0011"
                     /note="Phosphopantetheinyl transferase component of
                     siderophore synthetase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: EntD;
                     COG2977"
                     /db_xref="CDD:225524"
     misc_feature    complement(<9762..9926)
                     /locus_tag="BAB2_0011"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; pfam01648"
                     /db_xref="CDD:250768"
     gene            complement(10267..11043)
                     /locus_tag="BAB2_0012"
                     /db_xref="GeneID:3827447"
     CDS             complement(10267..11043)
                     /locus_tag="BAB2_0012"
                     /EC_number="1.3.1.28"
                     /note="catalyzes the formation of 2,3-dihydroxybenzoate
                     from 2,3-dihydro-2,3-dihydroxybenzoate; involved in the
                     biosynthesis of siderophores, enterobactin, bacillibactin
                     or vibriobactin"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
                     /protein_id="YP_418259.1"
                     /db_xref="GI:83268968"
                     /db_xref="GeneID:3827447"
                     /translation="MVEAKSYPASWRFAGKRVIVTGAAQGIGRRVAEHFLAEGATVIG
                     LDRQAGEADAPFRLIRLDITDAAEVRAVSDGLKAEGKPLDILVNVAGVLKLGNSDRLS
                     AEDWKTCMDVNASGPFHLLSQWVPVFRDQRHGAIVNVASNAAHVPRLNMAAYCASKAA
                     LASFSHCVALELAPYGVRCNVVSPGSTRTAMLGAMLNDPSGEAQLVRGLPEQFKLGIP
                     LGKIAMPDDIANVILFLASDQAGHVTMQDIVVDGGATLGA"
     misc_feature    complement(10270..11022)
                     /locus_tag="BAB2_0012"
                     /note="2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated;
                     Region: PRK08220"
                     /db_xref="CDD:236190"
     misc_feature    complement(10270..10992)
                     /locus_tag="BAB2_0012"
                     /note="2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases,
                     classical (c) SDRs; Region: DH-DHB-DH_SDR_c; cd05331"
                     /db_xref="CDD:187592"
     misc_feature    complement(order(10474..10479,10483..10494,10570..10572,
                     10582..10584,10621..10629,10708..10710,10771..10779,
                     10855..10863,10900..10908,10963..10974,10978..10980))
                     /locus_tag="BAB2_0012"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187592"
     misc_feature    complement(order(10570..10572,10582..10584,10621..10623,
                     10705..10707))
                     /locus_tag="BAB2_0012"
                     /note="active site"
                     /db_xref="CDD:187592"
     gene            complement(11043..11915)
                     /locus_tag="BAB2_0013"
                     /db_xref="GeneID:3827448"
     CDS             complement(11043..11915)
                     /locus_tag="BAB2_0013"
                     /EC_number="3.3.2.1"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase family protein"
                     /protein_id="YP_418260.1"
                     /db_xref="GI:83268969"
                     /db_xref="GeneID:3827448"
                     /translation="MAIPKIADYPMPQKAGFPANKTNWQPDPARAVLLIHDMQRYFLR
                     FYDANGPLMGDLIGNLVRLRNWAHENGVPVVYTAQPHEQPAGDRALLNDMWGPGLPAA
                     APEQQLIVDKLTPGATDTVLAKWRYSAFQRSDLLQRMKDWNRDQLIIGGIYAHIGCMV
                     TAIDAFMNDIQPFMVGDAVADFSEEEHRLALKYVATRCGAVIDTASLIRKPATETTRD
                     WLQKRVLELIEDETELDPQENLILYGLDSLQVMKLSAELKERGVAVGFDDLARVPTLA
                     AWWDLIETKQKAAA"
     misc_feature    complement(11301..11912)
                     /locus_tag="BAB2_0013"
                     /note="Isochorismatase, also known as 2,3 dihydro-2,3
                     dihydroxybenzoate synthase, catalyses the conversion of
                     isochorismate, in the presence of water, to
                     2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of
                     a vinyl ether, an uncommon reaction in biological...;
                     Region: isochorismatase; cd01013"
                     /db_xref="CDD:238495"
     misc_feature    complement(order(11370..11372,11448..11450,11457..11459,
                     11535..11537,11631..11633,11790..11792,11907..11909))
                     /locus_tag="BAB2_0013"
                     /note="hydrophobic substrate binding pocket; other site"
                     /db_xref="CDD:238495"
     misc_feature    complement(order(11445..11447,11457..11459,11544..11546,
                     11652..11654,11679..11681,11805..11807))
                     /locus_tag="BAB2_0013"
                     /note="active site"
                     /db_xref="CDD:238495"
     misc_feature    complement(11457..11462)
                     /locus_tag="BAB2_0013"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238495"
     misc_feature    complement(11046..11258)
                     /locus_tag="BAB2_0013"
                     /note="Aryl carrier domain [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG3433"
                     /db_xref="CDD:225967"
     gene            complement(11967..13586)
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /db_xref="GeneID:3827449"
     CDS             complement(11967..13586)
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /EC_number="2.7.7.58"
                     /note="bifunctional 2,3-dihydroxybenzoate-AMP
                     ligase/S-dihydroxybenzoyltransferase; activates the
                     carboxylate group of 2,3-dihydroxy-benzoate forming
                     (2,3-dihydroxybenzoyl)adenylate then catalyzes the
                     acylation of holo-entB with 2,3-dihydroxy-benzoate
                     adenylate"
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthase subunit E"
                     /protein_id="YP_418261.1"
                     /db_xref="GI:83268970"
                     /db_xref="GeneID:3827449"
                     /translation="MTIEFTHWPPARERLYREKGYWIDKPLTRALEEQAAMRPDAPAI
                     LYGERRFTYAELDRLSSNLASRLAAAGIGKGDTALVQLPNIAEFYIVFFALMKAGIAP
                     VNALFSHRKLELGAYASQIEPRLLIGSRQHELFMDDAFARDLGKNLSAPLLTLFAGEA
                     DPASSLDHWIATPADKAVPFSPTGAGEVAFFQLSGGSTGTPKLIPRTHNDYDYSVRAS
                     AEICALTPQTRFLCALPTAHNYPMSSPGALGVFHAGGCVVMAPNPEPLNCFSIIERHG
                     VNMVALVPPAVALWLQAAPDHLAALSSLKLVQVGGASFAEALARQVPQVLGCKLQQVF
                     GMAEGLVNYTRLDDPDEIVFTTQGRPISPDDEIRIVDEDGEPVAEGQPGMLATRGPYT
                     FCGYYRSPEHNAQVFDSEGFYYSGDVVQRTPEGYLRVVGRVKDQINRGGEKVAAEEIE
                     NLILLHPDVTHAALVAMQDELLGEKSCAFIVSRNPDLKPPVLRRHLLALGVAEYKLPD
                     RIRLIETMPLTAVGKIDKKHLRKLSSPSSPG"
     misc_feature    complement(11970..13586)
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /note="enterobactin synthase subunit E; Provisional;
                     Region: entE; PRK10946"
                     /db_xref="CDD:236803"
     misc_feature    complement(12000..13541)
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /note="2,3-dihydroxybenzoate-AMP ligase; Region:
                     23DHB-AMP_lg; cd05920"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12981..12986,12990..13007,13014..13016))
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12018..12020,12291..12293,12300..12302,
                     12336..12338,12342..12344,12564..12566,12576..12590,
                     12648..12656,12855..12857,12867..12875,12999..13007))
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /note="active site"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12018..12020,12291..12293,12300..12302,
                     12336..12338,12342..12344,12579..12590,12651..12656,
                     12999..13007))
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213287"
     misc_feature    complement(order(12018..12020,12564..12566,12576..12584,
                     12588..12590,12654..12656,12855..12857,12867..12875))
                     /gene="entE"
                     /locus_tag="BAB2_0014"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213287"
     gene            complement(13693..14868)
                     /locus_tag="BAB2_0015"
                     /db_xref="GeneID:3827450"
     CDS             complement(13693..14868)
                     /locus_tag="BAB2_0015"
                     /EC_number="5.4.4.2"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="YP_418262.1"
                     /db_xref="GI:83268971"
                     /db_xref="GeneID:3827450"
                     /translation="MRTSALKYPTSDADHLIENNTYFSFSSGNLKLAASGMREVIATP
                     AIGGSNPDSTFQRAIAQAFERAARAGQRNPIVVGAIPFDPGEPSCLYVPEEMDWQERE
                     PASGASAAAMPQLAGQRSVPDEAGFKHAVEHAIINFRLSDVRKAVLSVMRELTFADDI
                     DVDAMLANLRAQNHDGYQFRVPLPGGGALVGVSPELLIHKDKGKIVSNPLAGSAKRMA
                     DPEADRKNADRLAKSEKDHYEHRLVIEDIRARLQPICTELDIPERPSLIHTAALWHLS
                     TRIEGRLHDPDMTALQLACLIHPTPAVCGFPTERARRLIRFVEPFERGLFTGMVGWSD
                     AEGNGEWVVTIRCGTVKGNLVRLFAGAGIVEASSPDSEWAEVQTKLGTMLRACGLSA"
     misc_feature    complement(13696..14868)
                     /locus_tag="BAB2_0015"
                     /note="Isochorismate synthase [Coenzyme metabolism /
                     Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: MenF; COG1169"
                     /db_xref="CDD:224091"
     misc_feature    complement(13708..14649)
                     /locus_tag="BAB2_0015"
                     /note="isochorismate synthases; Region: isochor_syn;
                     TIGR00543"
                     /db_xref="CDD:233014"
     gene            14940..16349
                     /locus_tag="BAB2_0016"
                     /db_xref="GeneID:3827451"
     CDS             14940..16349
                     /locus_tag="BAB2_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="condensation domain-containing protein"
                     /protein_id="YP_418263.1"
                     /db_xref="GI:83268972"
                     /db_xref="GeneID:3827451"
                     /translation="MVPICQPGDWPTLNEACRAERNEMARIDFADGWMPLTLPQLDFW
                     EEFSFHPDQPVSTVAHCVEIEGDVDVEKLLRAISQTVREAEVLSIRFSDEKEQGRPVQ
                     LCDPAHMPDVDFVDLSAFPDPRAEAGRRMETDLSAPLDLRRDRMSAHALYRIGARQYI
                     WYIRAHHIIIDGYGLALIEQRCGQLYSHFCGQGESGHPFHPFASFIHEEDAYRASPRW
                     EADRKFWQDYLDGPVRLPILDRGAEDYGEAGYHHDVAFRDDISIGLRAMAKATDIGWP
                     DLLVLLSGLYLSRMLPMQGEDEGLTLWLPFMSRWGSVGAHMPGLLVNILPFHLEFDSG
                     ETLFSALRRNMDMLKKHRLHGRYRIEQISADRGLVSGSRFFFSPLINVLPFSTPQFAG
                     CRVAREVLANGPGDGFNLTYRADVDGAGLTLKIEAASNMMDAQTFARIAAGLPAFLKA
                     SLAPHLIERPVSDLRRRLP"
     misc_feature    15042..15935
                     /locus_tag="BAB2_0016"
                     /note="Condensation domain; Region: Condensation; cl19241"
                     /db_xref="CDD:267594"
     gene            complement(16397..17185)
                     /locus_tag="BAB2_0017"
                     /db_xref="GeneID:3827452"
     CDS             complement(16397..17185)
                     /locus_tag="BAB2_0017"
                     /EC_number="1.7.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="YP_418264.1"
                     /db_xref="GI:83268973"
                     /db_xref="GeneID:3827452"
                     /translation="MTGPRLSRRRFLTFTGMAGSAVLLSGCDAFDYLGSDDNAVRQVL
                     EKANDLSYTVQHKLEGPGALAREYGESEIRQGQKPNGETNPSTEEYDRLRENAFADYR
                     LEVHGLVEKPLSFSLNELHNMPARTQITRHDCVEGWSTIAKWTGVPLGHILALAKPKA
                     GAHYVVFHCFDEVDTPQGPDLFYGSIDLIDAQHPQTILAYGLNGSALPVANGAPLRVR
                     VERQLGYKMSKYVKSIELVSSFAAIQGGRGGYWEDQGYDWYGGI"
     misc_feature    complement(16400..17173)
                     /locus_tag="BAB2_0017"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(16406..16951)
                     /locus_tag="BAB2_0017"
                     /note="Sulfite oxidase (SO) family, molybdopterin binding
                     domain. This molybdopterin cofactor (Moco) binding domain
                     is found in a variety of oxidoreductases, main members of
                     this family are nitrate reductase (NR) and sulfite oxidase
                     (SO). SO catalyzes the...; Region: SO_family_Moco;
                     cl00199"
                     /db_xref="CDD:260254"
     misc_feature    complement(order(16496..16501,16505..16507,16514..16516,
                     16538..16540,16553..16555,16640..16642,16784..16786,
                     16907..16909,16913..16915,16919..16921))
                     /locus_tag="BAB2_0017"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:238198"
     misc_feature    complement(16784..16786)
                     /locus_tag="BAB2_0017"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:238198"
     gene            complement(17182..17991)
                     /locus_tag="BAB2_0018"
                     /db_xref="GeneID:3827453"
     CDS             complement(17182..17991)
                     /locus_tag="BAB2_0018"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-dependent hydrogenase b-type cytochrome
                     subunit"
                     /protein_id="YP_418265.1"
                     /db_xref="GI:83268974"
                     /db_xref="GeneID:3827453"
                     /translation="MGQLIYRQRLLTRLTHWIWAASIFFLLLSGLQIFNAHPTLYLGN
                     ESGFEYENAVLSIYAVPGDNGPQGRLDILGKTFDTTGVLGVSGTMETPRRQAFPPALT
                     IPSYRDLATGRVVHFFFAWVLVATLLLWFTSSLFNGHLKDISPSFTDIRSLPRDFVEH
                     LKFRFQHGKSYNPLQKLSYFLVLFGLFPLIVATGLAMSPGADSILPLSEWLGGRQTAR
                     TLHFVAMLLLVAFFIVHIAMVLAAGPFNELRSMISGWYRIDRTDEKTEKQS"
     misc_feature    complement(17218..17874)
                     /locus_tag="BAB2_0018"
                     /note="Thiosulfate reductase cytochrome B subunit
                     (membrane anchoring protein) [Energy production and
                     conversion]; Region: COG4117"
                     /db_xref="CDD:226602"
     misc_feature    complement(17230..>17670)
                     /locus_tag="BAB2_0018"
                     /note="Cytochrome b(N-terminal)/b6/petB; Region:
                     Cytochrom_B_N; pfam00033"
                     /db_xref="CDD:249526"
     gene            complement(18052..18321)
                     /locus_tag="BAB2_0019"
                     /db_xref="GeneID:3827454"
     CDS             complement(18052..18321)
                     /locus_tag="BAB2_0019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418266.1"
                     /db_xref="GI:83268975"
                     /db_xref="GeneID:3827454"
                     /translation="MTIKHNIIAFSALALIAGFSLTPAAFAEDAMKTDHMKSDAMKSD
                     NMSKDAMGKEDAMKGDAMHKDSKKMKKHDAMKGDAMKGDAMKSGQ"
     misc_feature    complement(18067..18294)
                     /locus_tag="BAB2_0019"
                     /note="pentapeptide MXKDX repeat protein; Region:
                     penta_MxKDx; TIGR02953"
                     /db_xref="CDD:131998"
     gene            18506..19030
                     /locus_tag="BAB2_0020"
                     /db_xref="GeneID:3827455"
     CDS             18506..19030
                     /locus_tag="BAB2_0020"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 region 2"
                     /protein_id="YP_418267.1"
                     /db_xref="GI:83268976"
                     /db_xref="GeneID:3827455"
                     /translation="MKALMLLALDGNSAAYRTLLEELSRLLKAYFVRRLFGGRVSEAE
                     DLVQETLLAIHTRRMTYDREMTFLPWVNAIARHKLVDHLRRQGRHDTDVLDEDIAIPG
                     EAANVEARMDVDRMLGGVSERTAGLIRKVKIEGQSIDEAARAGDMSQSAVKVAIHRGL
                     ATLAQRFGGKKDDR"
     misc_feature    18506..19018
                     /locus_tag="BAB2_0020"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK12539"
                     /db_xref="CDD:237132"
     misc_feature    18560..18769
                     /locus_tag="BAB2_0020"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    18833..18994
                     /locus_tag="BAB2_0020"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     gene            19020..19655
                     /locus_tag="BAB2_0021"
                     /db_xref="GeneID:3827743"
     CDS             19020..19655
                     /locus_tag="BAB2_0021"
                     /codon_start=1
                     /transl_table=11
                     /product="extracytoplasmic function alternative sigma
                     factor"
                     /protein_id="YP_418268.1"
                     /db_xref="GI:83268977"
                     /db_xref="GeneID:3827743"
                     /translation="MTDDLINRLTGELKPVSRHAMQRLLLGHALLGMVAGVVIMLAFL
                     GARHDLAAAMATPAFWSKLCYAALLLAVLLPALFALSRPLRQNLPWPALLLIFSCLGA
                     AAIYQWEEASPEVRPVLVWGYTALVCPWLIGLISLPTLASLLLAIRKLAPARPTLAGF
                     AAGLVSGGIGVLVYAFHCPESGLPFIALWYTLGIVGTGVLGALGGRFCLRW"
     misc_feature    19023..19652
                     /locus_tag="BAB2_0021"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4944"
                     /db_xref="CDD:227280"
     gene            complement(19701..20441)
                     /locus_tag="BAB2_0022"
                     /db_xref="GeneID:3827744"
     CDS             complement(19701..20441)
                     /locus_tag="BAB2_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418269.1"
                     /db_xref="GI:83268978"
                     /db_xref="GeneID:3827744"
                     /translation="MKEIATRAAGRATGHLPEEIARQIEKRILDGEFSVGSKLPSERE
                     LSVEYGVSRPVVREALSQLKLDGLVEARAGSGVFVIDESNQKAFRIQPLVVEEAQSLE
                     QLMELLVAIEVAATRIAAVNRTPEDLKQIKRALIGLEYAIISDKLRDEEDYAFHDAIV
                     IATHNPHFIALCKHLEYGARHVIRQARTNTRSNLKDMLDAVQDEHKAIYEAIELGDPE
                     QAGIAAERHLRNATQRMKVYLSADNRTN"
     misc_feature    complement(19707..20423)
                     /locus_tag="BAB2_0022"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(20205..20396)
                     /locus_tag="BAB2_0022"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(20211..20222,20226..20231,20259..20261,
                     20268..20273,20277..20291,20313..20318,20322..20324,
                     20391..20393))
                     /locus_tag="BAB2_0022"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(19752..20135)
                     /locus_tag="BAB2_0022"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            20559..21974
                     /locus_tag="BAB2_0023"
                     /db_xref="GeneID:3827745"
     CDS             20559..21974
                     /locus_tag="BAB2_0023"
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding family protein"
                     /protein_id="YP_418270.1"
                     /db_xref="GI:83268979"
                     /db_xref="GeneID:3827745"
                     /translation="MGNTGDKYRILAFNINDISRYQDWSYFSIDWSYQYGVEILSTGR
                     HGKPSKSSGGKMSLKVFLQAGVACAALSLAGAAGASAEPLKIALVETLSGPQASTGLL
                     YRAAVLYQLGKINEAGGFNGEKIQILEYDNQGGPVGAADRVKAAIADGAQIIVQGSSS
                     AVAGQITEDVRKYNLRNKGKEVLYLNLGAEALELTGSKCHFYHFRFSPNAAIRFKTVA
                     QGMKDKGILGERAYSINQNYSWGVDVENTVVANAKEIGYEVVDKTLHEVNKIQDFSPY
                     VAKIQAANVDTVFTGNWSNDLLLLMKAASGAGLKAKFATSFLDQPGNIGNAGAIAEGH
                     IVSTPFNPEANGEASMAFAEDYKKVTGHYPSYVEPAAVFGLQLFGEALKNVKPGEGKI
                     NTTDIALAIENASVKTPMGDYSMRSDDHQAKFPMVVQEVSKKARIKADGTEYGFLPFK
                     TFTGDESIDPVQESCSMKRPG"
     misc_feature    20811..21842
                     /locus_tag="BAB2_0023"
                     /note="Periplasmic solute-binding domain of active
                     transport proteins; Region: PBP1_SBP_like_3; cd06329"
                     /db_xref="CDD:107324"
     misc_feature    order(21030..21038,21120..21128,21276..21278,21435..21437,
                     21507..21509)
                     /locus_tag="BAB2_0023"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107324"
     gene            22016..23005
                     /locus_tag="BAB2_0024"
                     /db_xref="GeneID:3827746"
     CDS             22016..23005
                     /locus_tag="BAB2_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418271.1"
                     /db_xref="GI:83268980"
                     /db_xref="GeneID:3827746"
                     /translation="MDRSPVRAELPITDQTMDQILFAVLNGAIYGLLLFMVSAGLTLI
                     FGMMGVLNFAHASFYMMGAYFAYTLQPLTGFWLAILIAPVIVGIVGVLVERFILRRVH
                     AFGHAHELLVTFGLSVVIAEVIKIFYGNFAVEYRIPAALQFSAFDLGGVSYPFYRLFI
                     GAVALVMFLLIYLLLTRTRIGIVVRSAIYRPRMVEALGHNVPLVFMGVFGVGAFLAGL
                     AGSVAGAFYTTNPNMALELGVMVFVVVVVGGLGSLGGAMFASLLIGILSSVAVGVKVS
                     IASLLDYVGLGDYAREIGGVLTLEVSSIAATLPFFLMLIVLLVRPSGLFGAKE"
     misc_feature    22094..22990
                     /locus_tag="BAB2_0024"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    22589..22645
                     /locus_tag="BAB2_0024"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            23009..24229
                     /locus_tag="BAB2_0025"
                     /db_xref="GeneID:3827747"
     CDS             23009..24229
                     /locus_tag="BAB2_0025"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418272.1"
                     /db_xref="GI:83268981"
                     /db_xref="GeneID:3827747"
                     /translation="MTIKQSVVALLVVALLVALPYLVSESMTNAAIQMLIAALFATAF
                     SLLCGQAGMLSFGHAAYFGLGSFAAVHVMNAFGGEGLLPTPLLPLAGAGVGLLSGLVA
                     GWFSTKRTGVYFAMITLALAELLHALAPHLKGTFGGEAGVSSFRMPAWGFDFGSTTEV
                     YYLALAWVVGSILLLFLLTLTPFGRVTVGLRENTHRLRFLGYNVHVLGTLVFAISAMF
                     AGIAGALQAINIEAANYVVFEAGISTAVVLNSFIGGVGTFFGPAIGAAAMTFFGHVTS
                     DVTRSWLLYQGLIFVLVMMFLPRGLVGEAVERFRNPKGTGISLGHALGRLVALLVTAA
                     GTIMIVELVQRFFSSDYKALASAGNWPPVTFLGREWLPFAVSTWLIPLALFAAGIALL
                     TIVNRHRAKAKGEA"
     misc_feature    23108..23917
                     /locus_tag="BAB2_0025"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    23591..23647
                     /locus_tag="BAB2_0025"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            24229..24981
                     /locus_tag="BAB2_0026"
                     /db_xref="GeneID:3827748"
     CDS             24229..24981
                     /locus_tag="BAB2_0026"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418273.1"
                     /db_xref="GI:83268982"
                     /db_xref="GeneID:3827748"
                     /translation="MTKDILVLDQLNKSFGPAHIIRGVNLAVRDGERHAVIGPNGAGK
                     STLFHLISGNFTPSSGSIRFQGEEIGGLTPAAVNRKGLARSFQITNIFPGLTVFENIR
                     LAVMRRYKVQFTFWRPVSSMRKVTAEVESLLEQVRLTARAYTLASQLSYSEQRSLEIG
                     MTLASDPRLIILDEPMAGMSQEETDYTVGLIREITQNRTLMIVEHDMYVVFTLADRIS
                     VLVYGEIIATGTPKEIRENARVREAYLGEEAH"
     misc_feature    24232..24969
                     /locus_tag="BAB2_0026"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    24244..24948
                     /locus_tag="BAB2_0026"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    24340..24363
                     /locus_tag="BAB2_0026"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(24349..24354,24358..24366,24487..24489,24745..24750,
                     24841..24843)
                     /locus_tag="BAB2_0026"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    24478..24489
                     /locus_tag="BAB2_0026"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    24673..24702
                     /locus_tag="BAB2_0026"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    24733..24750
                     /locus_tag="BAB2_0026"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    24757..24768
                     /locus_tag="BAB2_0026"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    24829..24849
                     /locus_tag="BAB2_0026"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            24981..25697
                     /locus_tag="BAB2_0027"
                     /db_xref="GeneID:3827749"
     CDS             24981..25697
                     /locus_tag="BAB2_0027"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter:AAA ATPase"
                     /protein_id="YP_418274.1"
                     /db_xref="GI:83268983"
                     /db_xref="GeneID:3827749"
                     /translation="MAAENILDVRELHAHYGKSHILQGVTFDLKKGEAISLLGRNGSG
                     RSTTMKAIMGLVPPTSGEVLLNGKNLAGERSFKICRAGIGFVPEERETFLNLTVDENL
                     QMGIQRGAEGATRWTVEQMFDYFPRLKERRNTRAGSLSGGEQQMLTMCRTLLGNPLVM
                     LIDEPTEGLAPKIVSVVGEMIKDINRQGVSVVLVEQKLTIVLKVSSRVCVMGHGRIVF
                     EGTPDELTADEKLMEEWLAV"
     misc_feature    24990..25694
                     /locus_tag="BAB2_0027"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    24999..25664
                     /locus_tag="BAB2_0027"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    25095..25118
                     /locus_tag="BAB2_0027"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(25104..25109,25113..25121,25242..25244,25467..25472,
                     25566..25568)
                     /locus_tag="BAB2_0027"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    25233..25244
                     /locus_tag="BAB2_0027"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    25395..25424
                     /locus_tag="BAB2_0027"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    25455..25472
                     /locus_tag="BAB2_0027"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    25479..25490
                     /locus_tag="BAB2_0027"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    25554..25574
                     /locus_tag="BAB2_0027"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            25749..26231
                     /locus_tag="BAB2_0028"
                     /db_xref="GeneID:3827750"
     CDS             25749..26231
                     /locus_tag="BAB2_0028"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_418275.1"
                     /db_xref="GI:83268984"
                     /db_xref="GeneID:3827750"
                     /translation="MTQMTAPLEVGLAVRDLKRMRAFYEGALGLPFVSEIHVGGEKAK
                     VAAMSPDGYTVVRLQTAKGERIKLLQPDRLPQAGQAETGLILERAGASYLTFIVDDLK
                     ALVERLIEHGAQPLTGRDPIEVRPGTWLAFLHDPEGHIVEIVQYDDIAAYRPDLAEEK
                     "
     misc_feature    25776..26177
                     /locus_tag="BAB2_0028"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(25785..25787,25881..25883,25914..25916,25953..25955,
                     26025..26027,26142..26144,26166..26168,26172..26174)
                     /locus_tag="BAB2_0028"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            26235..26972
                     /locus_tag="BAB2_0029"
                     /db_xref="GeneID:3827751"
     CDS             26235..26972
                     /locus_tag="BAB2_0029"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="Short-chain dehydrogenase/reductase
                     SDR:glucose/ribitol dehydrogenase"
                     /protein_id="YP_418276.1"
                     /db_xref="GI:83268985"
                     /db_xref="GeneID:3827751"
                     /translation="MKFEFENRTLVLTGANGGIGRAIAELFHASGANLVLTDLDREGL
                     DAFAASLGSPERIATIKADASSADDAEKTVALAMERFGGIDFLVPSAGIYQAKPFAEM
                     SDADWHRTISINLDGVFYLCKRALPALKEDSSIVTLASLAAYRGAYVNAHYGATKGAM
                     VSMTRALSRELAPKTRVNGVSPGIIETPMTSELLKTRMDETMTQTPLKRLGKPSEIAS
                     VIAFLCSPAASFVTGETIQVNGGIYMA"
     misc_feature    26247..26966
                     /locus_tag="BAB2_0029"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    26265..26951
                     /locus_tag="BAB2_0029"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(26274..26276,26280..26291,26346..26354,26418..26426,
                     26502..26510,26571..26573,26646..26654,26691..26693,
                     26703..26705,26778..26789,26793..26798)
                     /locus_tag="BAB2_0029"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(26574..26576,26652..26654,26691..26693,26703..26705)
                     /locus_tag="BAB2_0029"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            27221..27742
                     /locus_tag="BAB2_0030"
                     /pseudo
                     /db_xref="GeneID:3827752"
     misc_feature    27221..27742
                     /locus_tag="BAB2_0030"
                     /note="Short-chain dehydrogenase/reductase
                     SDR:Glucose/ribitol dehydrogenase"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12196.1"
     gene            27852..30041
                     /locus_tag="BAB2_0031"
                     /db_xref="GeneID:3827753"
     CDS             27852..30041
                     /locus_tag="BAB2_0031"
                     /EC_number="1.2.4.4"
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="YP_418277.1"
                     /db_xref="GI:83268986"
                     /db_xref="GeneID:3827753"
                     /translation="MPEYKDLVPHSFWREIVPTTEDRAAFDLALGGTMLSQMHLIRAF
                     EAKVLELAGQGLVHGPAHSAIGQEGGAVGSAVSMRPSDQINGSHRAHHQFLAKALGYV
                     AQKGIDPKAAFDQDIRTLAQRTLAEILGLSQGFCRGRGGSMHLRWAESGNLGTNAIVG
                     GGVPMAAGAAWAHRRAGKGDVVYTYFGDGATNIGSVLETMNLAAAWKLPICFFIENNR
                     YAVSTHVEEVTAEPRLSSRGLAFGIPSFKVDGMDPIAVWLASEEANAIMRAGNGPTII
                     EADVYRYFHQNGPLPGSAFGYRSKDEEAEWRGRDPLDALAKTLLERQALGEDAIKALR
                     ERCVSLMDEVAGQLIEMRDGKRRIIPSLWPEESFRDFGLRGDLSEFDGVRFEEQESFS
                     GKLVEDARFIDTVADVMARRMETDERVVVLGEDVHRLKGGTNGATRGLSADYPDRVLG
                     TPISENAFTGIAGGMAADGRVLPVIEFMYPDFMWVAADQVFNQIGKARHMFGGDSDMP
                     VVLRTKVAMGTGYGSQHSMDPAGIFATAPGWRIVAPSTPFDYVGLMNSALLCRDPVLV
                     LEHVDLYASKGAAPAEDFDYFIPLGKAKVVRPGSRVTVLTYLAMVAKTQAVVEALGVD
                     AEIIDLRSLDRAGVDWETIEASVRKTGNVLIVEQGASGTSYGGWLADELQRRCFDWLD
                     QPIARVHGAEASPSISKVLEAAAAARPQDIEAGLRAVMAAQGLPIEN"
     misc_feature    27951..28880
                     /locus_tag="BAB2_0031"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of
                     PDC_ADC_BCADC subfamily, TPP-binding module; composed of
                     proteins similar to the E1 components of the human
                     pyruvate dehydrogenase complex (PDC), the acetoin
                     dehydrogenase complex (ADC) and the branched chain...;
                     Region: TPP_E1_PDC_ADC_BCADC; cd02000"
                     /db_xref="CDD:238958"
     misc_feature    order(28023..28025,28239..28241,28320..28325,28416..28418,
                     28422..28433,28440..28442,28452..28454,28464..28466,
                     28509..28520,28560..28562,28575..28577,28725..28727,
                     28737..28739)
                     /locus_tag="BAB2_0031"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(28113..28118,28320..28322,28326..28328,28410..28421,
                     28500..28502,28506..28508,28707..28709)
                     /locus_tag="BAB2_0031"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238958"
     misc_feature    order(28305..28307,28311..28313,28317..28319,28332..28334,
                     28341..28346,28353..28358,28362..28367,28374..28376,
                     28431..28436,28452..28457,28464..28466)
                     /locus_tag="BAB2_0031"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(28692..28712,28722..28754,28776..28784)
                     /locus_tag="BAB2_0031"
                     /note="phosphorylation loop region [posttranslational
                     modification]"
                     /db_xref="CDD:238958"
     misc_feature    29052..30017
                     /locus_tag="BAB2_0031"
                     /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
                     dehydrogenase (E1) component, eukaryotic type, beta
                     subunit [Energy production and conversion]; Region: AcoB;
                     COG0022"
                     /db_xref="CDD:223101"
     misc_feature    29058..29561
                     /locus_tag="BAB2_0031"
                     /note="Pyrimidine (PYR) binding domain of the beta
                     subunits of the E1 components of human pyruvate
                     dehydrogenase complex (E1- PDHc) and related proteins;
                     Region: TPP_PYR_E1-PDHc-beta_like; cd07036"
                     /db_xref="CDD:132919"
     misc_feature    order(29100..29102,29106..29108,29124..29126,29190..29192,
                     29199..29201,29205..29222,29229..29234,29238..29246,
                     29304..29306,29313..29318,29343..29348,29412..29414,
                     29421..29423,29466..29471,29532..29537)
                     /locus_tag="BAB2_0031"
                     /note="alpha subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132919"
     misc_feature    order(29121..29123,29208..29210,29214..29216,29295..29297,
                     29304..29306)
                     /locus_tag="BAB2_0031"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132919"
     misc_feature    order(29124..29126,29199..29201,29205..29216,29301..29306,
                     29310..29312,29325..29327,29337..29339,29346..29348,
                     29412..29414,29418..29423,29445..29447,29451..29456,
                     29460..29462)
                     /locus_tag="BAB2_0031"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132919"
     misc_feature    29622..29969
                     /locus_tag="BAB2_0031"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            30060..31325
                     /locus_tag="BAB2_0032"
                     /db_xref="GeneID:3827754"
     CDS             30060..31325
                     /locus_tag="BAB2_0032"
                     /EC_number="2.3.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="YP_418278.1"
                     /db_xref="GI:83268987"
                     /db_xref="GeneID:3827754"
                     /translation="MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKA
                     TMELEAEVDGRIGQLLVKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAE
                     TPVAASPVPAAPAVSAPASGEVRHKASPLARRLAAELGVSLDGRAGSGARGRIVRIDV
                     ERAAASKPVPVAAAAAPVAAPAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTT
                     VPHFYLNVDCEIDALLALRSQINEKREGSARISVNDFVIKASAAALRRVPDANVIWTD
                     EALLKLKDVDIAVAVATEGGLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEF
                     QGGGFSISNLGMYGVKSFSAIINPPQSAILAVGAGERRPIERNGELAFATMMSVTLSV
                     DHRAVDGALGAQLLAAFKAGIEDPMSLLV"
     misc_feature    30060..31322
                     /locus_tag="BAB2_0032"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Reviewed; Region: PRK11856"
                     /db_xref="CDD:237001"
     misc_feature    30066..30287
                     /locus_tag="BAB2_0032"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(30156..30158,30177..30194,30204..30206)
                     /locus_tag="BAB2_0032"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    30186..30188
                     /locus_tag="BAB2_0032"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    30438..30545
                     /locus_tag="BAB2_0032"
                     /note="e3 binding domain; Region: E3_binding; pfam02817"
                     /db_xref="CDD:251550"
     misc_feature    30693..31322
                     /locus_tag="BAB2_0032"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            31426..32211
                     /locus_tag="BAB2_0033"
                     /db_xref="GeneID:3827755"
     CDS             31426..32211
                     /locus_tag="BAB2_0033"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate/quinate 5-dehydrogenase"
                     /protein_id="YP_418279.1"
                     /db_xref="GI:83268988"
                     /db_xref="GeneID:3827755"
                     /translation="MTVTGHTRVFAIIADPVHHVRTPQALNALFAARGYDGIVVPAAV
                     PASGLKYAAAALRAFGNWGGFIVTVPHKTEMPAFCDRLTPRAQAAGAVNVIRREADGS
                     LTGELLDGVGFVRGLANAGHDVKGRSVYLAGAGGAASAIAFALAEAGVVRLTVVNRSS
                     EKAGQLVARLKEHFPAGMFVSQGTPAGHDIIVNGTSLGLKEGDALPVDPQYLRPEMLV
                     AEVIMSPEVTPLLQIAKDSGCSIHPGKAMLDGQLAEMFDFFTR"
     misc_feature    31432..32205
                     /locus_tag="BAB2_0033"
                     /note="Shikimate 5-dehydrogenase [Amino acid transport and
                     metabolism]; Region: AroE; COG0169"
                     /db_xref="CDD:223247"
     misc_feature    31459..31710
                     /locus_tag="BAB2_0033"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    31750..32205
                     /locus_tag="BAB2_0033"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(31750..31752,32092..32094,32167..32169,32176..32178)
                     /locus_tag="BAB2_0033"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(31825..31827,31834..31836,31894..31899,32005..32013,
                     32086..32088,32155..32157,32164..32169)
                     /locus_tag="BAB2_0033"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            32469..32741
                     /locus_tag="BAB2_0034"
                     /pseudo
                     /db_xref="GeneID:3827756"
     misc_feature    32469..32741
                     /locus_tag="BAB2_0034"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12200.1"
     gene            complement(32695..32976)
                     /locus_tag="BAB2_0035"
                     /db_xref="GeneID:3827757"
     CDS             complement(32695..32976)
                     /locus_tag="BAB2_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418280.1"
                     /db_xref="GI:83268989"
                     /db_xref="GeneID:3827757"
                     /translation="MLKGSPLMPRCWETLADHLERLRVGHPFSAHFRCLHPSSGLWGG
                     VRGRIWQLRRERAMLAQISSVTAPPMMRTCAKNHISAQACQSGPAARQP"
     gene            33090..35807
                     /locus_tag="BAB2_0036"
                     /db_xref="GeneID:3827758"
     CDS             33090..35807
                     /locus_tag="BAB2_0036"
                     /EC_number="3.6.3.2"
                     /codon_start=1
                     /transl_table=11
                     /product="H+ transporting ATPase"
                     /protein_id="YP_418281.1"
                     /db_xref="GI:83268990"
                     /db_xref="GeneID:3827758"
                     /translation="MNVAVRTANNKNFKKDERRLSMRAVREASNEIELTLANVGSRRD
                     GLTEGDAITRLYRDGPNEVARERRIPALVQFALAFKNPFIMVLVVLGAISAFTDIWLP
                     LETGEEADPTKVIIIAVMVLASALMRFIQEYRSGRAAEALKAMVRTTATVWRRVSAGT
                     SSAPREIPMRELVVGDIVQLSAGDMIPADLRLIESRDLFISQAVLTGEALPVEKYDTL
                     GAISEKSAMATASQDADMLDLPSICFMGTNVVSGTATAVVVATGQRTYFGSLAKAIVG
                     SRAQTSFDRGINSVSWLLIRFMLIMVPVVFLINGFTKGNWVEAMLFGLAVAVGLTPEM
                     LPMIVSSNLAKGAVAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDKIILEHHID
                     VSGKADDKVLRLAWLNSYHQSGVKNLMDQAVVSFANRVPEEVMRTARLYRKVDELPFD
                     FIRRRLSVVVEGVGGEHLLVCKGAVEEMLAICTTVRDGETVRALDAVTREKLIATARA
                     YNADGFRVLVVATREIPGAETSAQYRIADEAGLTVQGFLTFLDPPKETAGPAIAALAE
                     HGVCVKVLTGDNEIVTRKICREVGLEAGIPILGSEIEKLDDEALRVVAEERTVFAKLT
                     PLQKSRVLQALQANGHTVGFLGDGINDAPALRDADVGISVDSGADIAKESADIILLEK
                     SLIVLEEGVVTGRETFGNILKYLNMCASSNFGNVFSVLVASAFIPFLPMLAIHLLIQN
                     LMYDISQLALPWDKMDKEFLAKPRKWDARNIGRFMIWIGPTSSIFDITTFALMWYVFS
                     ANSPQMQSLFQSGWFIEGLLSQTLVVHMLRTQKIPFFQSTAALPVMLMSALIIALGIY
                     IPFSPIGEMVGLVPLPWAYFPWLAATLVSYCLVAQGMKVIYVRRFGQWF"
     misc_feature    33090..35804
                     /locus_tag="BAB2_0036"
                     /note="magnesium-transporting ATPase; Provisional; Region:
                     PRK15122"
                     /db_xref="CDD:237914"
     misc_feature    <33210..33380
                     /locus_tag="BAB2_0036"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; smart00831"
                     /db_xref="CDD:214842"
     misc_feature    33435..34181
                     /locus_tag="BAB2_0036"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    <34338..34544
                     /locus_tag="BAB2_0036"
                     /note="Putative hydrolase of sodium-potassium ATPase alpha
                     subunit; Region: Hydrolase_like2; pfam13246"
                     /db_xref="CDD:257602"
     misc_feature    <34734..35057
                     /locus_tag="BAB2_0036"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     pfam12710"
                     /db_xref="CDD:257240"
     misc_feature    35271..35777
                     /locus_tag="BAB2_0036"
                     /note="Cation transporting ATPase, C-terminus; Region:
                     Cation_ATPase_C; pfam00689"
                     /db_xref="CDD:250058"
     gene            35905..36243
                     /locus_tag="BAB2_0037"
                     /db_xref="GeneID:3827759"
     CDS             35905..36243
                     /locus_tag="BAB2_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418282.1"
                     /db_xref="GI:83268991"
                     /db_xref="GeneID:3827759"
                     /translation="MRKEGKCPIPLFVFVDTTQGANPPGGRRPGSPRRRGEPPLPGGS
                     PQGLWQWMKGRMDRWICWAYTVLGTNLASITYWLSRQGLIGRRATFRLLRWTSALQAR
                     PVRRLRKASW"
     gene            36374..36577
                     /locus_tag="BAB2_0038"
                     /db_xref="GeneID:3827760"
     CDS             36374..36577
                     /locus_tag="BAB2_0038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418283.1"
                     /db_xref="GI:83268992"
                     /db_xref="GeneID:3827760"
                     /translation="MYHFRFSGGYKALPTAVPHRGTLVGSIAVATYLVLFALVVLFVV
                     PASQANGPLDGDTQWQGAQAGGK"
     gene            36579..37295
                     /locus_tag="BAB2_0039"
                     /db_xref="GeneID:3827761"
     CDS             36579..37295
                     /locus_tag="BAB2_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB transporter"
                     /protein_id="YP_418284.1"
                     /db_xref="GI:83268993"
                     /db_xref="GeneID:3827761"
                     /translation="MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAV
                     GAATFVVFSSLVSGDSSPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAA
                     VGVLCGAGLISHAAVATVFIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDA
                     EAQVRALLLRDIGDHLHIHELESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLE
                     PRITSARWRIEDDSGGLSGL"
     misc_feature    36579..37262
                     /locus_tag="BAB2_0039"
                     /note="Uncharacterized membrane protein [Function
                     unknown]; Region: SapB; COG1285"
                     /db_xref="CDD:224204"
     misc_feature    36624..37004
                     /locus_tag="BAB2_0039"
                     /note="MgtC family; Region: MgtC; pfam02308"
                     /db_xref="CDD:111223"
     gene            37370..38440
                     /locus_tag="BAB2_0040"
                     /db_xref="GeneID:3827762"
     CDS             37370..38440
                     /locus_tag="BAB2_0040"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase-like ATP-binding protein"
                     /protein_id="YP_418285.1"
                     /db_xref="GI:83268994"
                     /db_xref="GeneID:3827762"
                     /translation="MLKTIIRRNVTGSTPKILLLACLTAAIFIVDTVTDYAIAAAVFY
                     TVVILLSARLLTGKAVTGLASTCIALSVISFAFTSKGAFYEGLINTGISIIAIIATTY
                     LGLKLVSAEIDVRESRERLLRLARMTTLGQLTSSIAHEVSQPLVAIEISASAGRRWLA
                     QSPPNNERAAAAIERISADSHRAIEILDRVRRLSRGEKPHVAPFDINEVVRDIVELAH
                     NEITRHDIALDLDLTPGLPMALADRVQIQQVIGNLVLNAIEAIQEKDPPVRSLKINTA
                     LTEGARLQVAVRDSGGGIAPADQERLFDAFWTTKKGGFGLGLTISRTIVESSGGTIAL
                     GSTTPHGTTILFEVPTTQETEI"
     misc_feature    37409..38416
                     /locus_tag="BAB2_0040"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    37748..37954
                     /locus_tag="BAB2_0040"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(37766..37768,37778..37780,37790..37792,37799..37801,
                     37811..37813,37820..37822,37883..37885,37895..37897,
                     37904..37906,37916..37918,37925..37927,37937..37939)
                     /locus_tag="BAB2_0040"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    37784..37786
                     /locus_tag="BAB2_0040"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    38105..38413
                     /locus_tag="BAB2_0040"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(38123..38125,38135..38137,38144..38146,38228..38230,
                     38234..38236,38240..38242,38246..38251,38312..38323,
                     38369..38371,38375..38377,38390..38395,38399..38401)
                     /locus_tag="BAB2_0040"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    38135..38137
                     /locus_tag="BAB2_0040"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(38240..38242,38246..38248,38312..38314,38318..38320)
                     /locus_tag="BAB2_0040"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            38437..39075
                     /locus_tag="BAB2_0041"
                     /db_xref="GeneID:3827880"
     CDS             38437..39075
                     /locus_tag="BAB2_0041"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family regulatory protein"
                     /protein_id="YP_418286.1"
                     /db_xref="GI:83268995"
                     /db_xref="GeneID:3827880"
                     /translation="MNCAYERDPVVFIVDDDHSVRLGLVDLFASIGLKALCFASVNEF
                     LKHAREEVPACLILDVRMPGESGTEFHARMKGLDIRLPVIFITGHGDIAMGVKAIKDG
                     AIDFLAKPFRNQDLLDAVQQAIRTDRKRLREEHNQHRIIARYQTLNQGERAVFKLVVQ
                     GLMNKQIAAELDVAEVTVKVRRSHLMHKMRAKSLADLVRMATELNAQPVKEL"
     misc_feature    38449..39054
                     /locus_tag="BAB2_0041"
                     /note="Response regulator [Signal transduction
                     mechanisms]; Region: TtrR; COG4566"
                     /db_xref="CDD:226932"
     misc_feature    38470..38808
                     /locus_tag="BAB2_0041"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(38479..38484,38611..38613,38635..38637,38695..38697,
                     38752..38754,38761..38766)
                     /locus_tag="BAB2_0041"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    38611..38613
                     /locus_tag="BAB2_0041"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(38620..38625,38629..38637)
                     /locus_tag="BAB2_0041"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    38761..38769
                     /locus_tag="BAB2_0041"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    38887..39039
                     /locus_tag="BAB2_0041"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(38911..38913,38917..38919,38923..38925,39016..39024,
                     39031..39033)
                     /locus_tag="BAB2_0041"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     misc_feature    order(38923..38931,38953..38958,38962..38967,38971..38985,
                     39016..39018)
                     /locus_tag="BAB2_0041"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     gene            complement(39273..39347)
                     /gene="tRNA-Val1"
                     /locus_tag="BAB2_1166"
                     /db_xref="GeneID:3827797"
     tRNA            complement(39273..39347)
                     /gene="tRNA-Val1"
                     /locus_tag="BAB2_1166"
                     /product="tRNA-Val"
                     /note="anticodon GAC, Cove Score=86.72"
                     /db_xref="GeneID:3827797"
     gene            complement(39461..39823)
                     /locus_tag="BAB2_0042"
                     /db_xref="GeneID:3827881"
     CDS             complement(39461..39823)
                     /locus_tag="BAB2_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="YP_418287.1"
                     /db_xref="GI:83268996"
                     /db_xref="GeneID:3827881"
                     /translation="MKRILLAEDDNDMRRFLVKALEKAGYHVTHFDNGASAYERLQEE
                     PFSLLLTDIVMPEMDGIELARRATEIDPDLKIMFITGFAAVALNPDSDAPRDAKVLSK
                     PFHLRDLVNEIEKMLIAA"
     misc_feature    complement(39473..39811)
                     /locus_tag="BAB2_0042"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(39515..39520,39584..39586,39644..39646,
                     39668..39670,39797..39802))
                     /locus_tag="BAB2_0042"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(39668..39670)
                     /locus_tag="BAB2_0042"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(39644..39652,39656..39661))
                     /locus_tag="BAB2_0042"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(39512..39520)
                     /locus_tag="BAB2_0042"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            40142..41032
                     /locus_tag="BAB2_0043"
                     /db_xref="GeneID:3827882"
     CDS             40142..41032
                     /locus_tag="BAB2_0043"
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="YP_418288.1"
                     /db_xref="GI:83268997"
                     /db_xref="GeneID:3827882"
                     /translation="MSLERDFGSVPPFEVSAPAQQRIPFVFNSPHSGRHYPLSFVQAS
                     RLDAISIRNSEDCYVDELFASVMRLGAPLLKANFPRAFLDVNREPYELDPRMFAEPLP
                     PFANSHSARVAGGLGTVPRLVAEGQLIYPGRIPLAEALYRIEDLYKPYHAALDALLEA
                     TRQQFGYAVLIDCHSMPGGTSAGEIGSRPDFIVGDRFGRSCSERLTQAAIELLQDLGY
                     TVAHNKPYAGGFITEHYGRPAMACHALQIEVNRSLYVNEQNLHKLEGFEALCVALHHF
                     VSDLTSLPDDLFIAPPLAAE"
     misc_feature    40166..41020
                     /locus_tag="BAB2_0043"
                     /note="N-formylglutamate amidohydrolase [Amino acid
                     transport and metabolism]; Region: HutG; COG3741"
                     /db_xref="CDD:226264"
     gene            41194..41970
                     /locus_tag="BAB2_0044"
                     /db_xref="GeneID:3827883"
     CDS             41194..41970
                     /locus_tag="BAB2_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol
                     phosphatase/fructose-1,6-bisphosphatase"
                     /protein_id="YP_418289.1"
                     /db_xref="GI:83268998"
                     /db_xref="GeneID:3827883"
                     /translation="MLIDKAFFSEVAAAAAAQTLPRFRQLTEVDNKYSVGFDPVTEAD
                     RAAERAIRAVIGRTFPDHGILGEEYGAENTDRSHVWIIDPVHGTRAFISGLPVWGTLV
                     GLTVDGDARAGMMSQPFTGELFYSDGDGAYLQRGDGAPRRLCVRKNAVLEDATLFTTT
                     PALFKGDDRKAFDRLESAVRLSRYGVDCYAFAMLAGGFVDIVVEAGLQTYDIAALIPI
                     IEQAGGVVTRRDGGPAEQGGDIVAAATPALHQAALDLLHI"
     misc_feature    41248..41952
                     /locus_tag="BAB2_0044"
                     /note="Predominantly bacterial family of Mg++ dependend
                     phosphatases, related to inositol monophosphatases. These
                     enzymes may dephosphorylate fructose-1,6-bisphosphate,
                     inositol monophospate, 3'-phosphoadenosine-5'-phosphate,
                     or similar substrates; Region: Bacterial_IMPase_like_1;
                     cd01641"
                     /db_xref="CDD:238819"
     misc_feature    order(41323..41325,41392..41397,41440..41451,41455..41457,
                     41821..41826)
                     /locus_tag="BAB2_0044"
                     /note="active site"
                     /db_xref="CDD:238819"
     gene            complement(42021..43016)
                     /locus_tag="BAB2_0045"
                     /db_xref="GeneID:3827884"
     CDS             complement(42021..43016)
                     /locus_tag="BAB2_0045"
                     /EC_number="3.1.1.5"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="YP_418290.1"
                     /db_xref="GI:83268999"
                     /db_xref="GeneID:3827884"
                     /translation="MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRG
                     TVIVLQGRNEFIENYYETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDY
                     ADDLDHFLTGIVLPDCPPPFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQ
                     KISDDNVRRITAALRWIGLGRIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTY
                     TDLALGGPTVRWVWSALETAWRINQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVAR
                     TRNISLAVIDGARHEMLQEADFYREQVLAAFDAFIPGSSPVESMPQSLEPDLSQI"
     misc_feature    complement(42063..42989)
                     /locus_tag="BAB2_0045"
                     /note="Lysophospholipase [Lipid metabolism]; Region: PldB;
                     COG2267"
                     /db_xref="CDD:225176"
     misc_feature    complement(42687..42938)
                     /locus_tag="BAB2_0045"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     pfam12146"
                     /db_xref="CDD:256874"
     gene            complement(43056..43271)
                     /locus_tag="BAB2_0046"
                     /db_xref="GeneID:3827885"
     CDS             complement(43056..43271)
                     /locus_tag="BAB2_0046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418291.1"
                     /db_xref="GI:83269000"
                     /db_xref="GeneID:3827885"
                     /translation="MSTGTQINCSLQPGITKNATVVLTGLPKHSQRKQTSWRNGPCSG
                     CFLNRKFAHELPVTFYHDFAHYGGASK"
     gene            complement(43366..43764)
                     /locus_tag="BAB2_0047"
                     /db_xref="GeneID:3827886"
     CDS             complement(43366..43764)
                     /locus_tag="BAB2_0047"
                     /codon_start=1
                     /transl_table=11
                     /product="antifreeze protein, type I"
                     /protein_id="YP_418292.1"
                     /db_xref="GI:83269001"
                     /db_xref="GeneID:3827886"
                     /translation="MKKAALALAALATAATGIATPTLAADNGLRVQIQYYDDDGYRVP
                     RQGFDGPGRHDRRPNWGDGYIRREVMNPRRVARSLERRGYDVGDMRLERDTYFVRATR
                     PSGRRVVVMVDAYNGNIIGERRAGPRPSGY"
     misc_feature    complement(43396..>43563)
                     /locus_tag="BAB2_0047"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY_2; pfam13670"
                     /db_xref="CDD:257976"
     gene            43816..44025
                     /locus_tag="BAB2_0048"
                     /db_xref="GeneID:3827887"
     CDS             43816..44025
                     /locus_tag="BAB2_0048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418293.1"
                     /db_xref="GI:83269002"
                     /db_xref="GeneID:3827887"
                     /translation="MVPVKMATLDQSRYLFRSIYLTQNRCALLLEMLWPRAFERSPKM
                     MFILGYRAVRKAKYSSLWIRSCYAK"
     gene            43998..44249
                     /locus_tag="BAB2_0049"
                     /db_xref="GeneID:3827888"
     CDS             43998..44249
                     /locus_tag="BAB2_0049"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418294.1"
                     /db_xref="GI:83269003"
                     /db_xref="GeneID:3827888"
                     /translation="MDQELLRKVTWCVRARSKSRHAGLQMALLIQAPGPGIEYRVLSI
                     SAGLEMKSRHSQMSSAVATEGPPAQEIRHQGSFAAHVRS"
     gene            44328..44798
                     /locus_tag="BAB2_0050"
                     /db_xref="GeneID:3827889"
     CDS             44328..44798
                     /locus_tag="BAB2_0050"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="YP_418295.1"
                     /db_xref="GI:83269004"
                     /db_xref="GeneID:3827889"
                     /translation="MRHVDFSPLYRSTVGFDRLFTMLDSLASPEGNQSYPPYNIERTG
                     ENAYRITMAVAGFSENELEIEAHRNQLTVKGQKADETASDVGEVLYRGIASRAFERRF
                     QLADFVEVSGASLKNGLLHIDLKREIPEQMKPRKIEVTKAGSGTAQPIEAKTAH"
     misc_feature    44328..44744
                     /locus_tag="BAB2_0050"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    44433..44705
                     /locus_tag="BAB2_0050"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(44439..44453,44478..44480,44484..44486,44490..44495,
                     44625..44627,44679..44684)
                     /locus_tag="BAB2_0050"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            complement(44936..45985)
                     /locus_tag="BAB2_0051"
                     /db_xref="GeneID:3827890"
     CDS             complement(44936..45985)
                     /locus_tag="BAB2_0051"
                     /EC_number="4.1.2.5"
                     /codon_start=1
                     /transl_table=11
                     /product="low-specificity threonine aldolase"
                     /protein_id="YP_418296.1"
                     /db_xref="GI:83269005"
                     /db_xref="GeneID:3827890"
                     /translation="MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFN
                     ELFEREVAVFFVGTGTAANSLALASVNRPGGVSLVHREAHVIEDGCGAPEYFTGGARL
                     HPIDGALGRIDPELLKRELKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQI
                     CRDAGLPLHMDGARFANALVSLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDP
                     ARAKDLPFIRKRAAQLFSKTRFVAAQFDAYLRDDLWRDLARHSNALAARLANHIHASS
                     QMRLAWKPEANEVFAIMKQSVYDRLRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTSF
                     ANTEEEVDRFGDMIA"
     misc_feature    complement(44939..45985)
                     /locus_tag="BAB2_0051"
                     /note="Threonine aldolase [Amino acid transport and
                     metabolism]; Region: GLY1; COG2008"
                     /db_xref="CDD:224919"
     misc_feature    complement(45098..45874)
                     /locus_tag="BAB2_0051"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(45374..45376,45383..45385,45464..45466,
                     45473..45475,45566..45568,45797..45799,45806..45811))
                     /locus_tag="BAB2_0051"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(45374..45376)
                     /locus_tag="BAB2_0051"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(46254..46538)
                     /locus_tag="BAB2_0052"
                     /db_xref="GeneID:3827891"
     CDS             complement(46254..46538)
                     /locus_tag="BAB2_0052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418297.1"
                     /db_xref="GI:83269006"
                     /db_xref="GeneID:3827891"
                     /translation="MKSLIDKALDEVPQGRKAAGERCLAPILIRLLTDSTLRTATGAR
                     NSPCHSRSACHRQASGLPVRRLSLKLYEQRLIAFGSHQRLIGQHCCPNYV"
     gene            46628..51379
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /db_xref="GeneID:3828239"
     CDS             46628..51379
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /EC_number="1.4.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase glutamate synthase
                     amidotransferase subunit"
                     /protein_id="YP_418298.1"
                     /db_xref="GI:83269007"
                     /db_xref="GeneID:3828239"
                     /translation="MTHLTPSVSNVVSHNVQNEAVKAATTASTRTTRKTKAAGVPPAQ
                     GLYDPRNEHDACGVGFIAHMKGRKSHVVVENGLKMLENLTHRGAVGADPLMGDGAGIL
                     VQIPDRFFREEMARQGIDLPQPGHYGVGYIFMPRDPDLRAHAEEIVREVIAAEGQTFI
                     GFREVPVDNSSLSKAPHIAATEPFHMQVFIGRSPMLETDDDFERRLFVLRKVISNRIY
                     QENDGDDKGFYVVSMSARTVVYKGMFLAYQVGAYYLDLKDPRFESAVALVHQRFSTNT
                     FPSWRLAHPYRMVAHNGEINTLRGNVNRMAARQASVDSELFGNDISKLWPISYEGQSD
                     TACFDNALEFLHQGGYSLAHAMMMLIPEAWSGNKLMSDERRAFYEYHAALMEPWDGPA
                     AVAFTDGRQIGAMLDRNGLRPARYIVTEDDFVILASEAGVLPVDEKKIVRKWRLQPGR
                     MLLIDMEEGRIISDEEIKSQIAQKHPYKQWLANTQLILEDLNPVEPRALRKDVSLLDR
                     QQAFGYTQEDTKFLMAPMATTGQEAIGSMGTDTPISAMSDKSKLLYTYFKQNFAQVTN
                     PPIDPIREELVMSLVSFIGPRPNIFDLVGTSRRKRLEVRQPILTNGDLEKIRSIGHTE
                     DRFDTKTLDITYNTGEGATGMHGAIERLCDRAEAAVHGGYNIVILSDRQVGPDRIPIP
                     ALLATAAVHHHLIRKGLRTSVGLVVESGEPREVHHFACLAGYGAEAINPYLAFDTLLD
                     MHRRREFPPEVDEHEVVKRYIKSIGKGILKVMSKMGISTYQSYCGAQIFDAVGVRTDF
                     VDKFFFGTATTIEGVGLDEIAEETVRRHTDAFGNDPVLLNALEVGGEYAYRMRGEAHM
                     WSPDAVAKLQHAVRTSNPDTFTEYTRMLDAKSSQAKTIRGLFNIRFAEERGLKPVSID
                     EVEPATDIVKRFSTGAMSFGSISREAHTTLARAMNAIGGKSNTGEGGEEPDRFYPLPD
                     GTANPERSAIKQVASGRFGVTTEYLVNSDLIQIKVAQGAKPGEGGQLPGHKVDATIAK
                     TRHSTPGVGLISPPPHHDIYSIEDLAQLIYDLKNVNPAADISVKLVSEVGVGTVAAGV
                     AKARADHITVSGYDGGTGASPLTSLKHAGSPWEIGLAETHQTLVLNGLRSRVALQVDG
                     GLRTGRDVVIGALLGADEFGFSTAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRKRFK
                     GTPEHVINFFFYLAEEVRALLAQMGFTRLEQIIGETELLEKQAMIDHWKAKGLDFSRI
                     FYKPEAEKHEIYWTERQHHPIDDILDRKLIELAAPALEERQPVKIDVEIKNVDRSAGA
                     MLSGEVAKRFRHKGLPEDTISVTLRGTAGQSFGAFLARGISFELIGDGNDYIGKGLSG
                     GRIVVRPPEDTRIVAEDSIIVGNTVLYGALEGECYFRGVAGERFAVRNSGAVTVVEGV
                     GDHGCEYMTGGVVVVIGQTGRNFAAGMSGGVAYVLDEEGDFAQRCNMAMVELEPVPEE
                     DDILEKLHHHGGDLMHKGRVDVSANMTHHDEERLVQLIANHLHYTGSTRAKDILDNWE
                     SYRPKFVKVMPVEYRRALEEMERMQIGVAAE"
     misc_feature    46751..51316
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="glutamate synthase subunit alpha; Provisional;
                     Region: gltB; PRK11750"
                     /db_xref="CDD:236968"
     misc_feature    46793..48052
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="Glutamine amidotransferases class-II (Gn-AT),
                     glutamate synthase (GltS)-type. GltS is a homodimer that
                     synthesizes L-glutamate from 2-oxoglutarate and
                     L-glutamine, an important step in ammonia assimilation in
                     bacteria, cyanobacteria and plants. The...; Region: GltS;
                     cd00713"
                     /db_xref="CDD:238365"
     misc_feature    order(46793..46795,46883..46885,47438..47440,47501..47509,
                     47627..47629)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="active site"
                     /db_xref="CDD:238365"
     misc_feature    order(47051..47053,47060..47062,47072..47074,47111..47113,
                     47117..47119,47132..47134,47171..47173,47183..47185,
                     47456..47458)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238365"
     misc_feature    48140..49009
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="Glutamate synthase central domain; Region:
                     Glu_syn_central; pfam04898"
                     /db_xref="CDD:252865"
     misc_feature    49199..50335
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="Glutamate synthase (GltS) FMN-binding domain.  GltS
                     is a complex iron-sulfur flavoprotein that catalyzes the
                     reductive synthesis of L-glutamate from 2-oxoglutarate and
                     L-glutamine via intramolecular channelling of ammonia, a
                     reaction in the plant, yeast...; Region: GltS_FMN;
                     cd02808"
                     /db_xref="CDD:239202"
     misc_feature    order(49412..49423,49502..49504,49577..49579,49643..49645,
                     49661..49663,49721..49723,49847..49849,49937..49945,
                     50060..50062,50066..50068,50129..50134,50156..50158,
                     50174..50176,50189..50191)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="active site"
                     /db_xref="CDD:239202"
     misc_feature    order(49412..49423,49502..49504,49577..49579,49643..49645,
                     49847..49849,49937..49942,50060..50062,50066..50068,
                     50129..50134)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239202"
     misc_feature    order(49661..49663,49721..49723,49940..49945)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    order(50156..50158,50174..50176,50189..50191)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="3Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    50486..51316
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="gltb_C. This domain is found at the C-terminus of
                     the large subunit (gltB) of glutamate synthase (GltS).
                     GltS encodes a complex iron-sulfur flavoprotein that
                     catalyzes the synthesis of L-glutamate from L-glutamine
                     and 2-oxoglutarate. It requires the...; Region: gltB_C;
                     cd00982"
                     /db_xref="CDD:238482"
     misc_feature    order(50585..50590,50597..50599,50606..50611,50666..50668,
                     50675..50680,50690..50692,50726..50734,50747..50749,
                     50756..50758,50813..50824,50831..50833,50840..50842,
                     50849..50851,50876..50890,50897..50902,50906..50908,
                     50933..50944,50951..50956,50960..50962,50999..51001,
                     51008..51010,51017..51019,51062..51073)
                     /gene="gltB"
                     /locus_tag="BAB2_0053"
                     /note="domain interface; other site"
                     /db_xref="CDD:238482"
     gene            51461..52915
                     /gene="gltD"
                     /locus_tag="BAB2_0054"
                     /db_xref="GeneID:3828240"
     CDS             51461..52915
                     /gene="gltD"
                     /locus_tag="BAB2_0054"
                     /EC_number="1.4.1.13"
                     /note="glutamate synthase is composed of subunits alpha
                     and beta; beta subunit is a flavin adenine
                     dinucleotide-NADPH dependent oxidoreductase; provides
                     electrons to the alpha subunit, which binds L-glutamine
                     and 2-oxoglutarate and forms L-glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit beta"
                     /protein_id="YP_418299.1"
                     /db_xref="GI:83269008"
                     /db_xref="GeneID:3828240"
                     /translation="MGKVTGFLEIDRQVAKYQPASDRIRHFREFTIPMTDGEVQKQAA
                     RCMDCGIPYCHGPTGCPVHNQIPDWNDLVYNNNWDQAIRNLHLTNNFPEFTGRICPAP
                     CEEACTLNLEDMPVAIKTVEQALGDKAYELGYIVPQPAASKTGKLVAIIGSGPAGLAA
                     AQQLARAGHMVDVYERESRPGGLLRYGIPDFKMEKHLIDRRVAQMEGEGVRFHCGVNI
                     GVDKPLRGLLDTYDAVLYCGGSETPRPAGIPGADLDGVHDAMPYLVQQNRRVGRENIE
                     SVAWASVPILAGGKHVVVVGGGDTASDCVGTAFRQGAVNVTQLDIRPQPPEKEDKLSV
                     WPYWATKMRTSSSQAEGASREFQVATLEFIGEDGRLTHVKCCQVDEKRRPIAGTEFFI
                     KADLAFIAIGFAGPVEDSVVKEMDGKLEIATDRRGSKSVKANDRDYRTNVDKLYAAGD
                     IRRGQSLVVWAIREGRQAAHAIDADLMGSSVLPR"
     misc_feature    51461..52909
                     /gene="gltD"
                     /locus_tag="BAB2_0054"
                     /note="glutamate synthase subunit beta; Reviewed; Region:
                     gltD; PRK12810"
                     /db_xref="CDD:237213"
     misc_feature    51527..51862
                     /gene="gltD"
                     /locus_tag="BAB2_0054"
                     /note="Dihydroprymidine dehydrogenase domain II, 4Fe-4S
                     cluster; Region: Fer4_20; pfam14691"
                     /db_xref="CDD:258829"
     gene            complement(52960..54363)
                     /locus_tag="BAB2_0055"
                     /db_xref="GeneID:3827892"
     CDS             complement(52960..54363)
                     /locus_tag="BAB2_0055"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="YP_418300.1"
                     /db_xref="GI:83269009"
                     /db_xref="GeneID:3827892"
                     /translation="MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMG
                     SGKAVSLAGPSILLIYAITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFF
                     TGWTYWLCWIVTAVAEVVAVPGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEI
                     EFWFALIKIITIIGLIITGIYMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGF
                     QISVFAFVGIELVGTAAAEAENPMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQV
                     DPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKA
                     FSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTLVTTISALLFIFIWSIILV
                     SYLQYRRKHPERHEKSTFKMPGGRASVVMVFIFFAFVLWALTQEPDTLAAMKVTPLWF
                     VLLGIAYWVMKLKQKQS"
     misc_feature    complement(52972..54351)
                     /locus_tag="BAB2_0055"
                     /note="D-alanine/D-serine/glycine permease; Provisional;
                     Region: PRK11049"
                     /db_xref="CDD:236830"
     misc_feature    complement(53182..>53760)
                     /locus_tag="BAB2_0055"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(54581..55732)
                     /locus_tag="BAB2_0056"
                     /db_xref="GeneID:3827893"
     CDS             complement(54581..55732)
                     /locus_tag="BAB2_0056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418301.1"
                     /db_xref="GI:83269010"
                     /db_xref="GeneID:3827893"
                     /translation="MREALTSGKFLKLAGMMLAAAALLLTSLAAATAQERPRTLFDLL
                     FGSRQAQPQRQYERPAPQRVKPKPKRPRASSPAAHAAAPSAAAPAVEIATKKPDAKKI
                     LVVGDFIGNGLAEGLDAAFATDPDLTVATRVNGSSGFVRDDYFNWPDNIGKILDEEKP
                     AAVVVMIGANDRQAITANGNSLQPRSPEWNAEYQKRVAAFTKVISDRHYPLVWVGQPP
                     FRPKGMSQDMLALNEIYRNAAEKAGGKFADVWDGFVDEEGNFTQTGFDINGQTARLRA
                     NDGINITSTGKRKLAFYAEKPLHAYLGVSREEGNSLPATHSLDPSKPVDRVAPVSLRD
                     INKDDSGILLGGTPAMQAKPLKTEQKKANPSPGRADDFSWPRNGKAPRK"
     misc_feature    complement(54833..55432)
                     /locus_tag="BAB2_0056"
                     /note="SGNH_peri2; putative periplasmic member of the
                     SGNH-family of hydrolases, a diverse family of lipases and
                     esterases. The tertiary fold of the enzyme is
                     substantially different from that of the alpha/beta
                     hydrolase family and unique among all known...; Region:
                     SGNH_hydrolase_peri2; cd01829"
                     /db_xref="CDD:238867"
     misc_feature    complement(order(54890..54892,54899..54901,55223..55225,
                     55325..55327,55409..55411))
                     /locus_tag="BAB2_0056"
                     /note="active site"
                     /db_xref="CDD:238867"
     misc_feature    complement(order(54890..54892,54899..54901,55409..55411))
                     /locus_tag="BAB2_0056"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238867"
     misc_feature    complement(order(55223..55225,55325..55327,55409..55411))
                     /locus_tag="BAB2_0056"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238867"
     gene            complement(55983..56501)
                     /locus_tag="BAB2_0057"
                     /db_xref="GeneID:3827894"
     CDS             complement(55983..56501)
                     /locus_tag="BAB2_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein OprF"
                     /protein_id="YP_418302.1"
                     /db_xref="GI:83269011"
                     /db_xref="GeneID:3827894"
                     /translation="MRTLVMVACAVSLAACSSPPKPPTVSGRHRIPINSPAAQEELRL
                     QVFPQEPTAQATMWPARPPKQTVNVYFPQDVTVFRPTSAQINQLHTLLWPVPKHINVR
                     GLTDNNCPPPGDTQVARVRALAIYNWLINQGVPASRITISYAPVKDYASNAPLSPGRV
                     LNRRVDIEILRK"
     misc_feature    complement(55986..56501)
                     /locus_tag="BAB2_0057"
                     /note="Outer membrane protein and related
                     peptidoglycan-associated (lipo)proteins [Cell envelope
                     biogenesis, outer membrane]; Region: OmpA; COG2885"
                     /db_xref="CDD:225439"
     misc_feature    complement(<56400..56483)
                     /locus_tag="BAB2_0057"
                     /note="Cag pathogenicity island protein Cag12; Region:
                     Cag12; pfam13117"
                     /db_xref="CDD:257508"
     misc_feature    complement(55995..56306)
                     /locus_tag="BAB2_0057"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cl02931"
                     /db_xref="CDD:261518"
     misc_feature    complement(order(56013..56015,56025..56027,56151..56153,
                     56160..56165,56175..56177,56184..56189,56280..56285))
                     /locus_tag="BAB2_0057"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(56647..57735)
                     /locus_tag="BAB2_0058"
                     /db_xref="GeneID:3827895"
     CDS             complement(56647..57735)
                     /locus_tag="BAB2_0058"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein E"
                     /protein_id="YP_418303.1"
                     /db_xref="GI:83269012"
                     /db_xref="GeneID:3827895"
                     /translation="MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVN
                     RPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERI
                     QIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKE
                     AGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPD
                     HPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASG
                     HGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHD
                     GTGRHISEVWYDPNTKRALSLQHSEKTQ"
     misc_feature    complement(56794..57351)
                     /locus_tag="BAB2_0058"
                     /note="Type IV secretory pathway component VirB11, and
                     related ATPases. The homohexamer, VirB11 is one of eleven
                     Vir proteins, which are required for T-pilus biogenesis
                     and virulence in the transfer of T-DNA from the Ti
                     (tumor-inducing) plasmid of bacterial to...; Region:
                     VirB11-like_ATPase; cd01130"
                     /db_xref="CDD:238550"
     misc_feature    complement(order(57166..57183,57340..57342))
                     /locus_tag="BAB2_0058"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238550"
     misc_feature    complement(order(57169..57177,57187..57192))
                     /locus_tag="BAB2_0058"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238550"
     misc_feature    complement(order(56854..56856,56863..56865,56875..56883,
                     56911..56916,56923..56925,56935..56937,56974..56976,
                     56980..56988,57058..57063,57067..57078,57100..57102,
                     57124..57126,57181..57186))
                     /locus_tag="BAB2_0058"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238550"
     misc_feature    complement(56956..56973)
                     /locus_tag="BAB2_0058"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238550"
     gene            complement(57716..58882)
                     /locus_tag="BAB2_0059"
                     /db_xref="GeneID:3827896"
     CDS             complement(57716..58882)
                     /locus_tag="BAB2_0059"
                     /codon_start=1
                     /transl_table=11
                     /product="glutelin"
                     /protein_id="YP_418304.1"
                     /db_xref="GI:83269013"
                     /db_xref="GeneID:3827896"
                     /translation="MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIV
                     VLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMP
                     IAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNAR
                     IQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDS
                     TVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGV
                     VIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQIN
                     LNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK"
     misc_feature    complement(57719..>58534)
                     /locus_tag="BAB2_0059"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    complement(57746..58285)
                     /locus_tag="BAB2_0059"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            complement(58879..59748)
                     /locus_tag="BAB2_0060"
                     /db_xref="GeneID:3827897"
     CDS             complement(58879..59748)
                     /locus_tag="BAB2_0060"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV secretion system CagX conjugation
                     protein"
                     /protein_id="YP_418305.1"
                     /db_xref="GI:83269014"
                     /db_xref="GeneID:3827897"
                     /translation="MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVL
                     VRALPGVGARIVFAPGENIEDVASGFTQGWEFKASHNILYLKARSMTLSHSNQSIDMA
                     PEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRVQFRYPAAAAAAAVAAAQKRV
                     VQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFPAAFLVAED
                     KSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPG
                     VKRVIKSPGENLQ"
     misc_feature    complement(<59137..59694)
                     /locus_tag="BAB2_0060"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cl11423"
                     /db_xref="CDD:264360"
     misc_feature    complement(58969..59244)
                     /locus_tag="BAB2_0060"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    complement(order(58978..58998,59011..59013,59170..59187,
                     59209..59229))
                     /locus_tag="BAB2_0060"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            complement(59745..60464)
                     /locus_tag="BAB2_0061"
                     /db_xref="GeneID:3827898"
     CDS             complement(59745..60464)
                     /locus_tag="BAB2_0061"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence protein"
                     /protein_id="YP_418306.1"
                     /db_xref="GI:83269015"
                     /db_xref="GeneID:3827898"
                     /translation="MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRA
                     WKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVM
                     DKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVR
                     TSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARL
                     TNPLGFNVTSYRVDPEMGVVQ"
     misc_feature    complement(59748..60464)
                     /locus_tag="BAB2_0061"
                     /note="Type IV secretory pathway, component VirB8
                     [Intracellular trafficking and secretion]; Region: VirB8;
                     COG3736"
                     /db_xref="CDD:226259"
     gene            complement(60467..60640)
                     /locus_tag="BAB2_0062"
                     /db_xref="GeneID:3827976"
     CDS             complement(60467..60640)
                     /locus_tag="BAB2_0062"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB7"
                     /protein_id="YP_418307.1"
                     /db_xref="GI:83269016"
                     /db_xref="GeneID:3827976"
                     /translation="MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKP
                     PLAQPNPVDTYED"
     misc_feature    complement(<60488..60640)
                     /locus_tag="BAB2_0062"
                     /note="META domain; Region: META; cl01245"
                     /db_xref="CDD:260851"
     misc_feature    complement(60584..60640)
                     /locus_tag="BAB2_0062"
                     /note="Prokaryotic membrane lipoprotein lipid attachment
                     site; Region: LPAM_1; pfam08139"
                     /db_xref="CDD:149279"
     gene            complement(60804..61847)
                     /locus_tag="BAB2_0063"
                     /db_xref="GeneID:3827977"
     CDS             complement(60804..61847)
                     /locus_tag="BAB2_0063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418308.1"
                     /db_xref="GI:83269017"
                     /db_xref="GeneID:3827977"
                     /translation="MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLY
                     YTAMGILMSVGRIEGPFSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADA
                     FAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGS
                     TLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVAL
                     LSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGS
                     SISAATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSP
                     AYRQHVLGQFNRD"
     misc_feature    complement(60807..61847)
                     /locus_tag="BAB2_0063"
                     /note="Type IV secretory pathway, VirB6 components
                     [Intracellular trafficking and secretion]; Region: VirB6;
                     COG3704"
                     /db_xref="CDD:226227"
     gene            complement(62031..62747)
                     /locus_tag="BAB2_0064"
                     /db_xref="GeneID:3827978"
     CDS             complement(62031..62747)
                     /locus_tag="BAB2_0064"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB5"
                     /protein_id="YP_418309.1"
                     /db_xref="GI:83269018"
                     /db_xref="GeneID:3827978"
                     /translation="MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKF
                     AQQIEQLKQQFEQQKMQFDALTGNRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLA
                     AAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEI
                     ESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLRLYQQMAEAQDKLLDERQHEL
                     DAKDNARRGYPQPKALEAAY"
     misc_feature    complement(62097..62747)
                     /locus_tag="BAB2_0064"
                     /note="P-type DNA transfer protein VirB5; Region: VirB5;
                     TIGR02791"
                     /db_xref="CDD:234016"
     gene            complement(62752..65247)
                     /locus_tag="BAB2_0065"
                     /db_xref="GeneID:3827979"
     CDS             complement(62752..65247)
                     /locus_tag="BAB2_0065"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="YP_418310.1"
                     /db_xref="GI:83269019"
                     /db_xref="GeneID:3827979"
                     /translation="MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWR
                     IAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVALWSHNVRRRTWDHLKSFFSNPFCD
                     ALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFNVAVHRSHAEILQEQQLAIRK
                     LDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSGEWQKVRVP
                     SCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYANHTEPGILNGLMYSDYEY
                     VITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHY
                     SLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGL
                     TSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHYSKGDEDNFDKKLL
                     GNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAKGTILAIGGKYL
                     AIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAIRTVMRM
                     RPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQID
                     FNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFS
                     EFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTD
                     GFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNNELLD
                     QVIAEVGDDPSVWLPVFQERRKARIASSKSTGR"
     misc_feature    complement(62776..65247)
                     /locus_tag="BAB2_0065"
                     /note="Type IV secretory pathway, VirB4 components
                     [Intracellular trafficking and secretion]; Region: VirB4;
                     COG3451"
                     /db_xref="CDD:225982"
     misc_feature    complement(64084..64698)
                     /locus_tag="BAB2_0065"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     gene            complement(65247..65597)
                     /locus_tag="BAB2_0066"
                     /db_xref="GeneID:3827980"
     CDS             complement(65247..65597)
                     /locus_tag="BAB2_0066"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB3-like
                     protein"
                     /protein_id="YP_418311.1"
                     /db_xref="GI:83269020"
                     /db_xref="GeneID:3827980"
                     /translation="MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGS
                     IVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRAS
                     AYSPIAFTKRKRES"
     misc_feature    complement(65250..65567)
                     /locus_tag="BAB2_0066"
                     /note="Type IV secretory pathway, VirB3 components
                     [Intracellular trafficking and secretion]; Region: VirB3;
                     COG3702"
                     /db_xref="CDD:226225"
     gene            complement(65611..65928)
                     /locus_tag="BAB2_0067"
                     /db_xref="GeneID:3827981"
     CDS             complement(65611..65928)
                     /locus_tag="BAB2_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB2"
                     /protein_id="YP_418312.1"
                     /db_xref="GI:83269021"
                     /db_xref="GeneID:3827981"
                     /translation="MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVN
                     TSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAAAEIASY
                     LLR"
     misc_feature    complement(65620..65907)
                     /locus_tag="BAB2_0067"
                     /note="TrbC/VIRB2 family; Region: TrbC; pfam04956"
                     /db_xref="CDD:252903"
     gene            complement(66364..67080)
                     /locus_tag="BAB2_0068"
                     /db_xref="GeneID:3827982"
     CDS             complement(66364..67080)
                     /locus_tag="BAB2_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="SLT domain-containing protein"
                     /protein_id="YP_418313.1"
                     /db_xref="GI:83269022"
                     /db_xref="GeneID:3827982"
                     /translation="MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVR
                     QPVSLDEAITTAQSLEAKGWNFSLGIAQVNRYNLPKYGSTYAQAFDPCKNLKMGSKIL
                     EDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTKPGSPSYVQKVVASADVTTKP
                     IVVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGTANAPVRLKTE
                     QPATTDAPPGKDNTDGVVVF"
     misc_feature    complement(66616..67032)
                     /locus_tag="BAB2_0068"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(<66775..>67017)
                     /locus_tag="BAB2_0068"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(order(66697..66699,66778..66780,66859..66861,
                     67000..67002))
                     /locus_tag="BAB2_0068"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(67000..67002)
                     /locus_tag="BAB2_0068"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(67584..68822)
                     /locus_tag="BAB2_0069"
                     /db_xref="GeneID:3827983"
     CDS             complement(67584..68822)
                     /locus_tag="BAB2_0069"
                     /EC_number="3.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan binding domain-containing protein"
                     /protein_id="YP_418314.1"
                     /db_xref="GI:83269023"
                     /db_xref="GeneID:3827983"
                     /translation="MLRFPFTPEKKLRIKIAATVALAIIGASLSAGTALADAGFRQWI
                     ANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSV
                     AVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATL
                     AYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMD
                     GNGKRDIWNSVPDALGTAANLLHRNGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQI
                     GLVRANGRAFPDPHEKATLKVPDGHQGPAFLMTKNFFVLKRYNNADKYALAVGLLADR
                     IGGYQGLRQDWNRPFTPISMNERLELQTHLKALGYYDGNIDGKIGATSRAAIEAFQQR
                     NGLEPDGHPSKEVLSVLRRR"
     misc_feature    complement(67812..68708)
                     /locus_tag="BAB2_0069"
                     /note="lytic murein transglycosylase; Region: MltB_2;
                     TIGR02283"
                     /db_xref="CDD:233810"
     misc_feature    complement(67824..68708)
                     /locus_tag="BAB2_0069"
                     /note="Transglycosylase SLT domain; Region: SLT_2;
                     pfam13406"
                     /db_xref="CDD:257731"
     misc_feature    complement(<68070..68258)
                     /locus_tag="BAB2_0069"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(68106..68108,68205..68207))
                     /locus_tag="BAB2_0069"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(67596..67766)
                     /locus_tag="BAB2_0069"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            69222..70115
                     /gene="galU"
                     /locus_tag="BAB2_0070"
                     /db_xref="GeneID:3828229"
     CDS             69222..70115
                     /gene="galU"
                     /locus_tag="BAB2_0070"
                     /EC_number="2.7.7.9"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_418315.1"
                     /db_xref="GI:83269024"
                     /db_xref="GeneID:3828229"
                     /translation="MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYV
                     VDEAREAGIEHLIFVTGRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGT
                     TSFTRQQVPLGLGHAVWCARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNI
                     IAVQECDPEEAHKYGIVGKGGAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIF
                     GLLSKQEKGAGNEIQLTDAMLKLADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWR
                     EDIRPSVEGSIGHLLKTIQPA"
     misc_feature    69243..70043
                     /gene="galU"
                     /locus_tag="BAB2_0070"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    order(69258..69269,69309..69314,69543..69545,69552..69563,
                     69621..69623,69627..69632,69741..69746,69801..69806,
                     69840..69842,69924..69926)
                     /gene="galU"
                     /locus_tag="BAB2_0070"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    order(69270..69272,69279..69293,69297..69305,69315..69323,
                     69327..69335,69345..69347,69417..69419,69423..69431,
                     69435..69437,69447..69452,69537..69542,69546..69548,
                     69552..69554,69738..69740,69912..69914,69984..69986,
                     70002..70010,70014..70022,70026..70034,70041..70043)
                     /gene="galU"
                     /locus_tag="BAB2_0070"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            complement(70168..71706)
                     /locus_tag="BAB2_0071"
                     /db_xref="GeneID:3827984"
     CDS             complement(70168..71706)
                     /locus_tag="BAB2_0071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418316.1"
                     /db_xref="GI:83269025"
                     /db_xref="GeneID:3827984"
                     /translation="MFIACAPIGGLAPLARRLRCLLLAGVALALPHFAYAQDADLRGS
                     ISDDIAAAATDADDAGAGADSFYSPEQDNASSGKGDLSQETPAADPVSEDSTFLLDNI
                     RVGAVLPDDDTVRAQRENLRARPGQGRSFTPEADPYAPIGIRAGSFILKPSLEQGIKA
                     TSNGDNSSNGSRAILNETTLRLNALSDWLQHQASLDASGTFSKSISGQDVSEPQANIL
                     GRLRLDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLLF
                     GRVTGGLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKR
                     MFDERIDSNGYERSGRQYALRGGLIFDRGEKFNGEIAAGYMQADSDDPRLANISGPSI
                     NAMVNWSPLRGTDMRFFARTMVDTSTTPGVAGSLQHFASLDVTRRVRANLSFNGKLDA
                     NIRQNKDGTGTDYTLGAGIGATYWLNRMVAIDARLRHEFQTSQVADREYQSNSIYVGM
                     KFQK"
     misc_feature    complement(70171..71451)
                     /locus_tag="BAB2_0071"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5338"
                     /db_xref="CDD:227643"
     gene            71847..72848
                     /locus_tag="BAB2_0072"
                     /db_xref="GeneID:3827985"
     CDS             71847..72848
                     /locus_tag="BAB2_0072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418317.1"
                     /db_xref="GI:83269026"
                     /db_xref="GeneID:3827985"
                     /translation="MEKLDITQKLADAEAAITSALRTIKTENAGLVALEEALNNGLSG
                     PFVEAVERIVASRGRLVVTGVGKSGHIGSKLAATFASTGTSAFFVHSGEANHGDLGMI
                     GLEDVILAISWSGETVELKGIVNYSQRFRIPLIAITSRQDSALGRAADVVLLLPKATE
                     ACPHGLAPTTSTMMQLAIGDALAIALLEARGFTPSDFKTFHPGGSLGASLIHIRDIMH
                     RGNRLPLVKTGTPMPDAMKVLAQKSFGCVVVTDDAGELAGIVTDGDISRNLSRNLSAL
                     AVDDIMTRSPRTIDQNMLASAALKTINENHIGALIVVEANRPIGLVHFHDLLRIGAA"
     misc_feature    71910..72839
                     /locus_tag="BAB2_0072"
                     /note="D-arabinose 5-phosphate isomerase; Provisional;
                     Region: PRK10892"
                     /db_xref="CDD:182814"
     misc_feature    72018..72401
                     /locus_tag="BAB2_0072"
                     /note="KpsF-like protein. KpsF is an arabinose-5-phosphate
                     isomerase which contains SIS (Sugar ISomerase) domains.
                     SIS domains are found in many phosphosugar isomerases and
                     phosphosugar binding proteins. KpsF catalyzes the
                     reversible reaction of ribulose...; Region: SIS_Kpsf;
                     cd05014"
                     /db_xref="CDD:240145"
     misc_feature    order(72048..72050,72180..72182)
                     /locus_tag="BAB2_0072"
                     /note="putative active site [active]"
                     /db_xref="CDD:240145"
     misc_feature    72504..72833
                     /locus_tag="BAB2_0072"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with KpsF/GutQ domains in the API [A5P (D-arabinose
                     5-phosphate) isomerase] protein.  These APIs catalyze the
                     conversion of the pentose pathway...; Region:
                     CBS_pair_KpsF_GutQ_assoc; cd04604"
                     /db_xref="CDD:239977"
     gene            complement(72971..73438)
                     /locus_tag="BAB2_0073"
                     /db_xref="GeneID:3827986"
     CDS             complement(72971..73438)
                     /locus_tag="BAB2_0073"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NfeD"
                     /protein_id="YP_418318.1"
                     /db_xref="GI:83269027"
                     /db_xref="GeneID:3827986"
                     /translation="MIPEFLFQLGIWNWLVFGLILLILEILAPGFFFIWFGLAALVIG
                     ALAFLLSSTAGFGWQLQTVIFLVLAIVFTLAGRRFFGSKSNDTGEPLLNRRGEQLVGQ
                     RATLTEPIVNGHGRIHINDTTWRVKGPDLPAGTEIRIVAFDPVSLEIEVGLGE"
     misc_feature    complement(72989..73420)
                     /locus_tag="BAB2_0073"
                     /note="Membrane protein implicated in regulation of
                     membrane protease activity [Posttranslational
                     modification, protein turnover, chaperones / Intracellular
                     trafficking and secretion]; Region: COG1585"
                     /db_xref="CDD:224501"
     gene            complement(73459..74445)
                     /locus_tag="BAB2_0074"
                     /db_xref="GeneID:3827987"
     CDS             complement(73459..74445)
                     /locus_tag="BAB2_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418319.1"
                     /db_xref="GI:83269028"
                     /db_xref="GeneID:3827987"
                     /translation="MTGFDITLLILVALVLAALIASIKTVPQGYNYTIERFGRYTRTL
                     NPGLNLIVPFFDRVGARLNMMEQVLDVPTQEVITRDNAIVGVDAVAFYQVLNAAQAAY
                     QVAKLQYAILNLTMTNIRTVMGSMDLDELLSNRDAINDRLLRVVDEAAHPWGIKITRV
                     EIKDINPPADIVTSMARQMKAERDKRAQVLEAEGNRNAQILRAEGQKQSQILEAEGKL
                     EAAKREAEARERLAEAEAKATTMVSQAVANGNVQALNYFVAQKYTEALSNITSAKNQK
                     IVLMPLEASSLIGSLGGIGAIAREVFGDGSQPAGPAPQPPARARSVPPTGRD"
     misc_feature    complement(73558..74382)
                     /locus_tag="BAB2_0074"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    complement(73939..74265)
                     /locus_tag="BAB2_0074"
                     /note="Paraslipin or slipin-2 (SLP-2, a subgroup of the
                     stomatin-like proteins (slipins) family; belonging to the
                     SPFH (stomatin, prohibitin, flotillin, and HflK/C)
                     superfamily; Region: SPFH_paraslipin; cd08829"
                     /db_xref="CDD:259811"
     misc_feature    complement(73765..>74100)
                     /locus_tag="BAB2_0074"
                     /note="core domain of the SPFH (stomatin, prohibitin,
                     flotillin, and HflK/C) superfamily; Region: SPFH_like;
                     cl19107"
                     /db_xref="CDD:267460"
     gene            complement(74578..75636)
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /db_xref="GeneID:3828247"
     CDS             complement(74578..75636)
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /EC_number="4.99.1.1"
                     /note="protoheme ferro-lyase; catalyzes the insertion of a
                     ferrous ion into protoporphyrin IX to form protoheme;
                     involved in protoheme biosynthesis; in some organisms this
                     protein is membrane-associated while in others it is
                     cytosolic"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_418320.1"
                     /db_xref="GI:83269029"
                     /db_xref="GeneID:3828247"
                     /translation="MSGTDKVRVNVSQTAQTPLHTSAKLPKVGVLLVNLGTPDGTSYG
                     PMRRYLAEFLSDRRVIEWSRLIWYPILYGIVLNTRPRRSGRLYDRIWNHENNESPLRT
                     YTRAQGEKLAKALSDQPNVVVDWAMRYGQPSIESITDRLLQQGCERIVIFPLYPQYSA
                     TTTATVNDKFFEALMKKRFMPAIRTVPSYEAEPVYIDALARSVEKHLATLSFKPEVIL
                     TSYHGIPKSYSDKGDPYRQQCLETTRLLRERLGLGEDEMRATFQSRFGPEEWLQPYTD
                     ETVKELAKNGVKLVAVLNPGFVADCLETVDEIGNEAAEEFLENGGENFSHIPCLNDSE
                     EGMKVIETLVRRELLGWV"
     misc_feature    complement(74581..75561)
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="ferrochelatase; Reviewed; Region: hemH; PRK00035"
                     /db_xref="CDD:234585"
     misc_feature    complement(75070..75555)
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(75073..75075,75157..75168,75175..75177,
                     75316..75318,75328..75330,75367..75369,75379..75381,
                     75535..75537))
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(75151..75156,75472..75480,75490..75492,
                     75532..75534))
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    complement(74644..75048)
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(74728..74730,74827..74829,74956..74958,
                     74971..74973))
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(74644..74646,74719..74721,74731..74733,
                     74737..74745,74749..74751,74911..74913,74923..74925,
                     74932..74940))
                     /gene="hemH"
                     /locus_tag="BAB2_0075"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            complement(75774..76154)
                     /gene="omp10"
                     /locus_tag="BAB2_0076"
                     /db_xref="GeneID:3828036"
     CDS             complement(75774..76154)
                     /gene="omp10"
                     /locus_tag="BAB2_0076"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein Omp10"
                     /protein_id="YP_418321.1"
                     /db_xref="GI:83269030"
                     /db_xref="GeneID:3828036"
                     /translation="MKRFRIVAPLALMSLALAACETTGPGSGNAPIIAHTPAGIEGSW
                     VDPNGIASSFNGGIFETRTTDTNEKLAEGNYLYLSPQLVEINMRSIVRGTTSKVNCAL
                     VSPTQLNCTSSAGSRFSLTRRNAG"
     gene            complement(76296..77741)
                     /locus_tag="BAB2_0077"
                     /db_xref="GeneID:3827988"
     CDS             complement(76296..77741)
                     /locus_tag="BAB2_0077"
                     /EC_number="2.5.1.44"
                     /codon_start=1
                     /transl_table=11
                     /product="homospermidine synthase"
                     /protein_id="YP_418322.1"
                     /db_xref="GI:83269031"
                     /db_xref="GeneID:3827988"
                     /translation="MAREKWQVYGEITGPIIMIGFGSIGRGTLPLIERHFKFDQSQMV
                     VIDPSEKNRKILDEKNIRFIKQAITRDNYKDVLGPLLKGVKGQPFVVNLSVDTSSLDL
                     MRFVRECGALYIDTVVEPWLGFYFDAQADNAARTNYALRETVRSEKRKNPGGPTAVSC
                     CGANPGMVSWFVKKALVDLAAELKLDFTEPAPQDRHGWAKLMKKAGVKGIHIAERDTQ
                     RARKPKPFNTFWNTWSVEGFIAEGLQPAELGWGSHEKWKPKNARKQKKGNKAAIFLEQ
                     PGGNTRIRTWCPTLGAQYGLLVTHNEAISIADFFTLRDKKGKLDFRLTCHYAYHPCND
                     AIVSLDEMFGAGGKAQPVQHVLEENEILDGADELGVLLYGHARNAYWYGSQLTVQEAR
                     KLAPYQNATGLQVSSAVLAGMVWALENPQSGIVETDEMDYRRCLEVQMQYLGPVKGYY
                     TDWTPLEGRDGLFEEDVDRKDPWQFRNVLVR"
     misc_feature    complement(76299..77741)
                     /locus_tag="BAB2_0077"
                     /note="Homospermidine synthase [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: COG5310"
                     /db_xref="CDD:227626"
     misc_feature    complement(76386..77696)
                     /locus_tag="BAB2_0077"
                     /note="Saccharopine dehydrogenase; Region: Saccharop_dh;
                     pfam03435"
                     /db_xref="CDD:251951"
     gene            complement(77853..78533)
                     /locus_tag="BAB2_0078"
                     /db_xref="GeneID:3827989"
     CDS             complement(77853..78533)
                     /locus_tag="BAB2_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418323.1"
                     /db_xref="GI:83269032"
                     /db_xref="GeneID:3827989"
                     /translation="MSSESTVRDGSKAVTSEPDYQLIETMRWEPLAGVLRFDLHMARL
                     ENSARELNFACNMDVIRQKIAESGTGDQALKLRLTLAPDGVATVAALPYEALPQQTVW
                     RIAIARTRLDHTDPLLRYKTTRRQAYIAAREEYSPAEVDEVILLNERGEVCEGTITSI
                     FLDIGGTARTTPALSCGLLDGVMRRELLDKGVASEEVVSVDILKSARNILVGNSLCGM
                     IRAKLIES"
     misc_feature    complement(77862..78485)
                     /locus_tag="BAB2_0078"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07546"
                     /db_xref="CDD:169002"
     misc_feature    complement(order(77892..77894,77985..77990,78072..78074,
                     78171..78173,78405..78407))
                     /locus_tag="BAB2_0078"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    complement(order(78072..78074,78171..78173,78405..78407))
                     /locus_tag="BAB2_0078"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    complement(order(78093..78095,78135..78137,78147..78149,
                     78153..78155,78165..78167,78279..78281,78303..78305,
                     78309..78311,78384..78386))
                     /locus_tag="BAB2_0078"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238254"
     misc_feature    complement(78171..78173)
                     /locus_tag="BAB2_0078"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            complement(78467..79636)
                     /locus_tag="BAB2_0079"
                     /db_xref="GeneID:3827990"
     CDS             complement(78467..79636)
                     /locus_tag="BAB2_0079"
                     /EC_number="2.6.1.85"
                     /note="catalyzes the formation of
                     4-amino-4-deoxychorismate from chorismate and glutamine"
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate synthase"
                     /protein_id="YP_418324.1"
                     /db_xref="GI:83269033"
                     /db_xref="GeneID:3827990"
                     /translation="MTRPGNKPLILFRDDKAGRDVLFAAPSRIIRADTPDEFEPAWEA
                     MQRAHEAGEWLAGYLSYEAGYLLEPKLRPLLPEGRKTPLLCFGVFDGPSDEQLHVRDS
                     ENATYLRNPVAQWSFEDYAPRFERLYRHLREGDCYQGNLTFPVTAQWGGDPLILFNML
                     AKRQPVRYATYCDLGGPVVLSRSPELFFKVDGDGWIETHPMKGTMPRGATPEEDERNR
                     QFLLNDPKNQAENRMIVDLLRNDISLVSEVGSLDVPELFRVESYPTVHQMISRVRARL
                     KSGLHLRAVFAALFPCGSITGAPKISAMKILRRLETGPRDIYCGSLGWIEPGGRMRFN
                     VAIRTISLLGGNRAIFNVGGGVVFDSTAQAEYEECLLKARFATGQKPLPANRIIS"
     misc_feature    complement(78485..79615)
                     /locus_tag="BAB2_0079"
                     /note="aminodeoxychorismate synthase; Provisional; Region:
                     PRK07508"
                     /db_xref="CDD:236035"
     misc_feature    complement(78509..79474)
                     /locus_tag="BAB2_0079"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     cl10555"
                     /db_xref="CDD:263998"
     gene            complement(79646..81508)
                     /gene="pepF"
                     /locus_tag="BAB2_0080"
                     /db_xref="GeneID:3828044"
     CDS             complement(79646..81508)
                     /gene="pepF"
                     /locus_tag="BAB2_0080"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="YP_418325.1"
                     /db_xref="GI:83269034"
                     /db_xref="GeneID:3828044"
                     /translation="MKFMVYRFSSDAILRAPAADAIAAKKHDLGNLPEWNLADLYPAP
                     DSPQLASNLEKAMQDSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGS
                     YAGLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAI
                     GHYRPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLA
                     IEPTLNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIA
                     DSQHLSNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETP
                     QALIPWDEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSA
                     HPYVLLNYMGKPRDVMTLAHELGHGVHQVLAGSQGALMASTPLTLAETASVFGEMLTF
                     RLLLERTRDKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRAGELTSERIGEI
                     WMDVQRESLGDAVRLNPGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQNSEK
                     GFQQKYFEMLKAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAMED"
     misc_feature    complement(79655..81409)
                     /gene="pepF"
                     /locus_tag="BAB2_0080"
                     /note="oligoendopeptidase, pepF/M3 family; Region:
                     M3_fam_3; TIGR02290"
                     /db_xref="CDD:233812"
     misc_feature    complement(79682..81106)
                     /gene="pepF"
                     /locus_tag="BAB2_0080"
                     /note="Peptidase family M3B Oligopeptidase F (PepF);
                     Region: M3B_PepF_5; cd09610"
                     /db_xref="CDD:189017"
     misc_feature    complement(order(79868..79870,79880..79882,79901..79903,
                     80192..80194,80261..80263,80270..80275))
                     /gene="pepF"
                     /locus_tag="BAB2_0080"
                     /note="active site"
                     /db_xref="CDD:189017"
     misc_feature    complement(order(80192..80194,80261..80263,80273..80275))
                     /gene="pepF"
                     /locus_tag="BAB2_0080"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189017"
     gene            81856..83346
                     /locus_tag="BAB2_0081"
                     /db_xref="GeneID:3827991"
     CDS             81856..83346
                     /locus_tag="BAB2_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="YP_418326.1"
                     /db_xref="GI:83269035"
                     /db_xref="GeneID:3827991"
                     /translation="MATRILIADDDPIQRRNLEAIVMRMGYRTILADGGVSALGFISQ
                     RKDIVLVLLDLTMPDMDGLTVLSRMRAAGVAVPVIVLVHSDDMHRVAQAIRLGAADFM
                     IKPLIFERVQVSVANVLKLDALTHEIQRARSSPRVHLSLSEMVAKSPEMERVMVLARR
                     AAALDAPLLVEGETGSGRQTLARAICGGGSRWRGPFVSLDCRGLTMENADDILFGTAK
                     FCPDDPIVSAGKLAEADGGVLFLDEVGALPHHAQLRLFTAMQSGQYESNGSRVTSNAR
                     IMTSSSQPLVDFVHMGRFHAGLYHLLGSFSIAMPPLRERVEDISILVHQFAVRFASEE
                     RLSHITGIAPHLLERLKAYQWPGNVRELKNAVYRAVLLCDKSELTVEDFAQLNLGAAG
                     FAGAQAMWQKPAAPLSVGRAGTAFSGIDADGEVRTLAAAEEEMIRFAIAHYDGQISEV
                     ARRLGIGRSTLYRKLKEYGIDVASISGKGKESDLENESCSWGRAAI"
     misc_feature    81856..83289
                     /locus_tag="BAB2_0081"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    81871..82212
                     /locus_tag="BAB2_0081"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(81880..81885,82015..82017,82039..82041,82099..82101,
                     82156..82158,82165..82170)
                     /locus_tag="BAB2_0081"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    82015..82017
                     /locus_tag="BAB2_0081"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(82024..82029,82033..82041)
                     /locus_tag="BAB2_0081"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    82165..82173
                     /locus_tag="BAB2_0081"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    82354..82719
                     /locus_tag="BAB2_0081"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    82369..82392
                     /locus_tag="BAB2_0081"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(82372..82395,82579..82581,82696..82698)
                     /locus_tag="BAB2_0081"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    82567..82584
                     /locus_tag="BAB2_0081"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    83134..83259
                     /locus_tag="BAB2_0081"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            83687..85600
                     /locus_tag="BAB2_0082"
                     /db_xref="GeneID:3827992"
     CDS             83687..85600
                     /locus_tag="BAB2_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding motif-containing protein"
                     /protein_id="YP_418327.1"
                     /db_xref="GI:83269036"
                     /db_xref="GeneID:3827992"
                     /translation="MRARASISAGLAIAAVAMVVLPSQASAETRSLKLYYVHTGEKAE
                     IAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQVYQSTGSREYITVVSA
                     YRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLRAIGMRYQIGGVGYYPR
                     SGSPFVHMDVGNVRHWPRMSRRELLALFPDGKTVHIPTDGKPLPGYEQALAMIEKRKA
                     GGGTIMMASNSSSRKRKSLFAALFGGGGADEEEDNGDTAAPATARPARATAPTRQAPA
                     AVPAAPVEQPRETMVAALPARDAPVPMQAPRPETGLDAQAAAAETPVAAFNVPVPAHK
                     PQMAPQDAVALAAAEDPAAAARAAVDANTAQAADAGMSAALTNGFVPVPSARPHLETD
                     NVQLAAAVIPTARPERPGEHPARGQDAIAALVNSQSDEPAQMAGEMADATGNAVAPQP
                     GKTAAFPLPTQTPRADTKLAMVSRRDEIGELIAPPEDDYDYDAKPVAAAAPKQAPAPV
                     QMASAAPTKPAAVASAAMRKKAAIIGKTADTGVRTTTKGARHMAKAPSRPRPVIRPAV
                     MPSSEIAMSTEPVSSTVPVTSPVLRNDALRSAPTMVYTAGFQRGDLPSARANQFSGNA
                     VTFLTVAKFTETN"
     misc_feature    83687..84223
                     /locus_tag="BAB2_0082"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3108"
                     /db_xref="CDD:225650"
     misc_feature    83756..84214
                     /locus_tag="BAB2_0082"
                     /note="Bacterial protein of unknown function (DUF882);
                     Region: Peptidase_M15_2; pfam05951"
                     /db_xref="CDD:253473"
     gene            complement(85666..86271)
                     /locus_tag="BAB2_0083"
                     /db_xref="GeneID:3827993"
     CDS             complement(85666..86271)
                     /locus_tag="BAB2_0083"
                     /EC_number="4.1.2.14"
                     /EC_number="4.1.3.16"
                     /note="catalyzes the formation of pyruvate and glyoxylate
                     from 4-hydroxy-2-oxoglutarate; or pyruvate and
                     D-glyceraldehyde 3-phosphate from
                     2-dehydro-3-deoxy-D-glyconate 6-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="keto-hydroxyglutarate-aldolase/keto-deoxy-
                     phosphogluconate aldolase"
                     /protein_id="YP_418328.1"
                     /db_xref="GI:83269037"
                     /db_xref="GeneID:3827993"
                     /translation="MKGQPVIPVLLIDKVEHAVPLARALARGGLPAIEITLRTAAALD
                     AIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFIVSPDATKYIVAAANDSDVPLLP
                     AAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCPTGGISLANART
                     YLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA"
     misc_feature    complement(85702..86271)
                     /locus_tag="BAB2_0083"
                     /note="KDPG and KHG aldolase; Region: KDPG_aldolase;
                     cd00452"
                     /db_xref="CDD:188632"
     misc_feature    complement(85702..86259)
                     /locus_tag="BAB2_0083"
                     /note="Entner-Doudoroff aldolase; Region: eda; TIGR01182"
                     /db_xref="CDD:162241"
     misc_feature    complement(order(85822..85824,85900..85902,85906..85908,
                     86086..86088,86158..86160,86170..86172,86245..86247))
                     /locus_tag="BAB2_0083"
                     /note="active site"
                     /db_xref="CDD:188632"
     misc_feature    complement(order(85846..85851,85861..85863,85897..85902,
                     85927..85929,85939..85941,85945..85956,86014..86025,
                     86080..86082,86086..86088,86158..86160))
                     /locus_tag="BAB2_0083"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:188632"
     misc_feature    complement(85906..85908)
                     /locus_tag="BAB2_0083"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188632"
     gene            complement(86463..87074)
                     /locus_tag="BAB2_0084"
                     /db_xref="GeneID:3827994"
     CDS             complement(86463..87074)
                     /locus_tag="BAB2_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418329.1"
                     /db_xref="GI:83269038"
                     /db_xref="GeneID:3827994"
                     /translation="MFDRPTIEALTTMAKEADIDPAALLAIAEVESGGRALYAVKGNM
                     EPAIRFEGHYFDRRISGRIRDFARKNGLSAPEAGKIRNPKSQGERWLLLERAMGLSPK
                     GALESTSWGLGQVMGAHWEWLGYRSVDALVAEARESVAGQVRLMLHFIEKAQLVQALR
                     SHDWPGFARRYNGPAFTRNNYDKRMAEAHQRWQNQIGSFKKAA"
     misc_feature    complement(86496..87020)
                     /locus_tag="BAB2_0084"
                     /note="Protein of unknown function (DUF3380); Region:
                     DUF3380; pfam11860"
                     /db_xref="CDD:256680"
     gene            87172..88122
                     /locus_tag="BAB2_0085"
                     /db_xref="GeneID:3827995"
     CDS             87172..88122
                     /locus_tag="BAB2_0085"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like protein"
                     /protein_id="YP_418330.1"
                     /db_xref="GI:83269039"
                     /db_xref="GeneID:3827995"
                     /translation="MQGNFSKKIDPMSNLPFTVAALYCFAPLPQYESLREPLAQLCCA
                     NGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSHASEMPFHRMKV
                     RLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDKRNDYEYAIGTFEGAI
                     DPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGI
                     LKYLEEVPREQSMWNGECFVFDERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEE
                     GVSCAGCYAERTPEDRARYAERQKQVKLAEKRGANKHIGS"
     misc_feature    87217..88119
                     /locus_tag="BAB2_0085"
                     /note="Predicted sulfurtransferase [General function
                     prediction only]; Region: COG1054"
                     /db_xref="CDD:223982"
     misc_feature    87538..87840
                     /locus_tag="BAB2_0085"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily. This CD includes Escherichia coli YceA,
                     Bacillus subtilis YbfQ, and similar uncharacterized
                     proteins; Region: RHOD_YceA; cd01518"
                     /db_xref="CDD:238776"
     misc_feature    87739..87741
                     /locus_tag="BAB2_0085"
                     /note="active site residue [active]"
                     /db_xref="CDD:238776"
     gene            88157..88363
                     /locus_tag="BAB2_0086"
                     /db_xref="GeneID:3827996"
     CDS             88157..88363
                     /locus_tag="BAB2_0086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418331.1"
                     /db_xref="GI:83269040"
                     /db_xref="GeneID:3827996"
                     /translation="MNHTMVAPILERYEFVTEFSGRLLHGRPCIKGLTASGSRLPPSH
                     PSSQVEASDRVRCLSVNSAGFSGG"
     gene            88403..89158
                     /gene="modA"
                     /locus_tag="BAB2_0087"
                     /db_xref="GeneID:3827919"
     CDS             88403..89158
                     /gene="modA"
                     /locus_tag="BAB2_0087"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter periplasmic-binding
                     protein"
                     /protein_id="YP_418332.1"
                     /db_xref="GI:83269041"
                     /db_xref="GeneID:3827919"
                     /translation="MKKLIATFLITIAAGAASVAQAAEKVTVFAAASMKDMIEEAARQ
                     IKARDGTEVVASFASSSALARQIEQGAPAQIFISADLDWMDYVEKAGLIDKASRKIIA
                     GNALVIAAQKDTPKGDARELLSAGRFAMGDPSNVPAGKYGKAALEKLDIWKEVEKNAV
                     FTENVRVALRYVSLAEVKTAIVYASDRVAAPELVEAYRFPADSHAPILYPAALLKKNE
                     SDAARTFLAFLESDAGQAIIKDKGFVGAAEAAE"
     misc_feature    88412..89131
                     /gene="modA"
                     /locus_tag="BAB2_0087"
                     /note="ABC-type molybdate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: ModA; COG0725"
                     /db_xref="CDD:223797"
     gene            89169..89855
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /db_xref="GeneID:3827920"
     CDS             89169..89855
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="part of ModCBA molybdate transporter; member of ABC
                     superfamily; inner membrane component; regulated by
                     repressor protein ModE"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="YP_418333.1"
                     /db_xref="GI:83269042"
                     /db_xref="GeneID:3827920"
                     /translation="MIMESNIWQIVLLSLRVAGIAIIIALPLAFLVGWLLARFHFPGK
                     SLVQAIVTMPLVLPPVVTGYLLLILFGARGPLGAPLQEWLGLSFAFRWTGAALAAGVM
                     AFPLLVRPIRLSIEGLDRGLEEAARTLGASRFTAFFTVILPPLLPGILAGAVLGFAKA
                     LGEFGATITFVSNIPGETQTLSLAIYTLLQTPSGDAEAFRLIAVSATISIAAVVLSEW
                     LQRRLAGGVK"
     misc_feature    89172..89843
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    89202..89738
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(89247..89252,89259..89264,89277..89279,89307..89318,
                     89322..89351,89358..89363,89367..89369,89469..89474,
                     89478..89480,89484..89486,89493..89498,89502..89504,
                     89514..89519,89526..89528,89577..89579,89619..89624,
                     89631..89633,89652..89663,89670..89675,89712..89717)
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(89325..89369,89652..89669)
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(89367..89369,89454..89456,89670..89672,89706..89708,
                     89715..89717)
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(89529..89567,89583..89588,89598..89600)
                     /gene="modB"
                     /locus_tag="BAB2_0088"
                     /gene_synonym="chlJ"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            89852..90931
                     /locus_tag="BAB2_0089"
                     /db_xref="GeneID:3827997"
     CDS             89852..90931
                     /locus_tag="BAB2_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418334.1"
                     /db_xref="GI:83269043"
                     /db_xref="GeneID:3827997"
                     /translation="MSGLTVSIRGRNGAFAIEAGFAAEGGVTALFGHSGAGKTTLLKM
                     IAGTLRPENGRIAVGDFTLFDAQKGINLPPEKRRIGYVFQDARLFAYMSVKRNLTYAR
                     WAGHRPATRSFDEVVALLGIGHLLDRRPSTLSGGERQRVAIGRALLSDPALLLLDEPL
                     SSLDHARRQEILPFIERLRDESHVPIVYVSHEIDEVARLADQIVLLSAGRVTASGAAA
                     DIFPLIDAESEGGGVLLEGIVSAYDERYKLAEIDLGGASFQLSDAGLKQTMHVRLRVR
                     ARDVSIARKIPEAISIRNLLPVTVTGIERGEGPNAHVFLDFRGRRLGARLTRRSVDDL
                     GLSVGDQVVALVKAVSVDRAAIREK"
     misc_feature    89858..90910
                     /locus_tag="BAB2_0089"
                     /note="ABC-type molybdate transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: ModC; COG4148"
                     /db_xref="CDD:226628"
     misc_feature    89861..90496
                     /locus_tag="BAB2_0089"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    89945..89968
                     /locus_tag="BAB2_0089"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(89954..89959,89963..89971,90101..90103,90320..90325,
                     90422..90424)
                     /locus_tag="BAB2_0089"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    90092..90103
                     /locus_tag="BAB2_0089"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    90248..90277
                     /locus_tag="BAB2_0089"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    90308..90325
                     /locus_tag="BAB2_0089"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    90332..90343
                     /locus_tag="BAB2_0089"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    90410..90430
                     /locus_tag="BAB2_0089"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    90719..90904
                     /locus_tag="BAB2_0089"
                     /note="TOBE domain; Region: TOBE; cl01440"
                     /db_xref="CDD:260939"
     gene            91001..91678
                     /locus_tag="BAB2_0090"
                     /db_xref="GeneID:3827998"
     CDS             91001..91678
                     /locus_tag="BAB2_0090"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_418335.1"
                     /db_xref="GI:83269044"
                     /db_xref="GeneID:3827998"
                     /translation="MTDLQNWTPRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVE
                     DAEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPA
                     NGVIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWECHNENGPSRRAAER
                     FGFRFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTL
                     QEFRDLG"
     misc_feature    91061..91588
                     /locus_tag="BAB2_0090"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    91130..91552
                     /locus_tag="BAB2_0090"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            91665..91874
                     /locus_tag="BAB2_0091"
                     /db_xref="GeneID:3827999"
     CDS             91665..91874
                     /locus_tag="BAB2_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418336.1"
                     /db_xref="GI:83269045"
                     /db_xref="GeneID:3827999"
                     /translation="MILAERKESNPAIAAAIILIGFGVLAYFVPSIMLVLGKHSQIAA
                     IIFPIVFVLGFFAIFWLRSKGQNKN"
     gene            complement(91926..92201)
                     /locus_tag="BAB2_0092"
                     /db_xref="GeneID:3828000"
     CDS             complement(91926..92201)
                     /locus_tag="BAB2_0092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418337.1"
                     /db_xref="GI:83269046"
                     /db_xref="GeneID:3828000"
                     /translation="MRGWPFWTSLTVAISMIGFSFIFSYSDYGSVPSNVSETTSAIVA
                     TSFAVACGLTVVAIAPPLAFTRRIIFMIIGVLFIIILGQINRYRINF"
     gene            complement(92171..92674)
                     /locus_tag="BAB2_0093"
                     /pseudo
                     /db_xref="GeneID:3828001"
     misc_feature    complement(92171..92674)
                     /locus_tag="BAB2_0093"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12259.1"
     gene            complement(92816..93919)
                     /locus_tag="BAB2_0094"
                     /db_xref="GeneID:3828002"
     CDS             complement(92816..93919)
                     /locus_tag="BAB2_0094"
                     /codon_start=1
                     /transl_table=11
                     /product="Delayed-early response protein/equilibrative
                     nucleoside transporter"
                     /protein_id="YP_418338.1"
                     /db_xref="GI:83269047"
                     /db_xref="GeneID:3828002"
                     /translation="MRRTAGFMIALCLTMIVAQAYAQSSLGIGANEVAMKPTGPFAHI
                     ILWMNEQQRSFYLAMTTALKAMREDPLQAAWGLVGLSFIYGIFHAVGPGHGKAVISSY
                     MIANETALRRGIFLSFISSLLQAIMAVAVVGLAWLVLRGTGISMNQTAHYMEIASFAL
                     VLFFGLWLLVRKLPQLFRKRDHAGAGPASPLFAAAPQPAIVSGPAWQGSISQATRTAA
                     TSSTVKLNYKPATAATDHIFIGEGDVCAACGNAHIVDPSTLGDDFNWKTAWSAIFSVG
                     LRPCSGALIVLTFALLNGLMVGGLLSVFAMALGTFITVAVLATLAVTAKNTALRFAGS
                     KAMSGRLKAAIEVCAALFITLTGALLLSAALVK"
     misc_feature    complement(92819..93862)
                     /locus_tag="BAB2_0094"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG2215"
                     /db_xref="CDD:225125"
     gene            complement(93919..94623)
                     /locus_tag="BAB2_0095"
                     /db_xref="GeneID:3828003"
     CDS             complement(93919..94623)
                     /locus_tag="BAB2_0095"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418339.1"
                     /db_xref="GI:83269048"
                     /db_xref="GeneID:3828003"
                     /translation="MKFSMLVSLWPRRSFVRSAAIALLAGCLPTLAHAHPHVFAEARL
                     ELTIAPDGTVQQLAHVWRFDDVFSSTALMEFDKKGDLQLDHKELVDLAHVINSSIAEF
                     KYFQSVLADGKDVKMARPTDLAAAFTDNRLLIVFTSKPEKPLKLAPGHKVSFGVYDPT
                     FYTAIDYVKDSDLVVKGLPAGCTSKVIRPDPDEAIAQNQATLTDAFFNDPTGTDMSKI
                     FATRLEIDCAAKGKTG"
     misc_feature    complement(93943..94584)
                     /locus_tag="BAB2_0095"
                     /note="ABC-type uncharacterized transport system,
                     periplasmic component [General function prediction only];
                     Region: COG3683"
                     /db_xref="CDD:226208"
     gene            complement(94663..95556)
                     /locus_tag="BAB2_0096"
                     /db_xref="GeneID:3828004"
     CDS             complement(94663..95556)
                     /locus_tag="BAB2_0096"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_418340.1"
                     /db_xref="GI:83269049"
                     /db_xref="GeneID:3828004"
                     /translation="MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDEL
                     GARLLNRTTRQFSLTEAGHTYYHRALEIIREIDALQDAVSETSSDARGRIKLSAPRTF
                     ADAVIGQSLIDFCLAHPEIVLDVRLDDRFVDLVEEGFDLAIRITRLQDSSLIAKRLSP
                     FHSVLCGAPELIARVGKPQRPEDLTDRPCIVDTNARARNNWHFRNMDGSMMTVPVSGP
                     IEINSPVATKNAALAGLGFCMLPAFIAEDEIEQGKLITCLDEFIVRDGGIYAVYPHRR
                     YLPAKIRALVDFMTQWFKERE"
     misc_feature    complement(95368..95547)
                     /locus_tag="BAB2_0096"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(94684..95529)
                     /locus_tag="BAB2_0096"
                     /note="LysR family transcriptional regulator; Provisional;
                     Region: PRK14997"
                     /db_xref="CDD:184959"
     misc_feature    complement(94690..95283)
                     /locus_tag="BAB2_0096"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(94753..94755,94834..94836,94885..94887,
                     95074..95076,95080..95082,95122..95124,95239..95241,
                     95251..95253))
                     /locus_tag="BAB2_0096"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(94858..94860,94867..94872,94891..94905,
                     94993..94995,95176..95196,95200..95202,95212..95214,
                     95221..95226,95230..95235,95245..95250))
                     /locus_tag="BAB2_0096"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            complement(95560..96765)
                     /locus_tag="BAB2_0097"
                     /db_xref="GeneID:3828005"
     CDS             complement(95560..96765)
                     /locus_tag="BAB2_0097"
                     /EC_number="3.5.1.4"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia"
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="YP_418341.1"
                     /db_xref="GI:83269050"
                     /db_xref="GeneID:3828005"
                     /translation="MANLDPFNALIAKPEKPLAHAASGPLAGERLAVKDIYDIAGMVT
                     GCGNPQILAESPVARKSAPVVEKLLAAGAEFIGKAQTDEVAFSMMGQNSHYPYPINPA
                     APDRVTGGSSSGSAAAVAGKLADIALGTDTGGSIRTPASFCGLIGLRSTHGRIPLEGI
                     MPLAPSLDTIGWFARDIALYEKVGAVLLGDDAQEFKLTQLLYMPVLEQLLLGQAETDA
                     YRAMFAKVRPHFATLKAASQPTLSIDELYLAFRQTQGAEAWENHGAWISSGNRQLGPR
                     IADRFAYGAEMTADMVKNQRARRARFAEEFEAIIGESAVLALPTVPGAAPLTGEPFEA
                     LQAYREQALRLLCLSGLSGLPQITLPLGSLRPGGTMHDAPFGISFIGPRGSDRTLIAL
                     AQTIISERS"
     misc_feature    complement(95563..96765)
                     /locus_tag="BAB2_0097"
                     /note="amidase; Provisional; Region: PRK08310"
                     /db_xref="CDD:181375"
     gene            97350..98483
                     /locus_tag="BAB2_0098"
                     /db_xref="GeneID:3828006"
     CDS             97350..98483
                     /locus_tag="BAB2_0098"
                     /EC_number="4.1.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="Orn/DAP/Arg decarboxylase family protein"
                     /protein_id="YP_418342.1"
                     /db_xref="GI:83269051"
                     /db_xref="GeneID:3828006"
                     /translation="MATQRIIDFLNTRRPEGPCLVVDTDVVRENYQGFEKALPYSRIF
                     YAVKANPAPEILRLLASLGSSFDTASVAEIEMALEAGATPDRISYGNTIKKERDIARA
                     FDLGIRLYAVDCVEEVEKIARVAPGSRVFCRVLTDGEGAEWPLSRKFGCVPAMAKDVL
                     RRAKALGLDAYGVSFHVGSQQTDLTAWDRALADAAAVFRTLADEGIILRMVNMGGGFP
                     TRYLKDVPTAQAYGMAIFDALSRHFGNRIPETIIEPGRGMVGNAGVIKTEVVLVSRKA
                     DNDNVRWVYLDIGKFGGLAETMDEAIRYQIVTPHDGSETEPCVLAGPTCDSADVLYEK
                     TPYPLPVSLTIGDEILIEGTGAYTTTYSAVAFNGFEPLRSYVI"
     misc_feature    97383..98480
                     /locus_tag="BAB2_0098"
                     /note="Diaminopimelate decarboxylase [Amino acid transport
                     and metabolism]; Region: LysA; COG0019"
                     /db_xref="CDD:223098"
     misc_feature    97395..98480
                     /locus_tag="BAB2_0098"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Ornithine Decarboxylase; Region: PLPDE_III_ODC;
                     cd00622"
                     /db_xref="CDD:143482"
     misc_feature    order(97398..97400,97491..97493,97554..97559,97563..97568,
                     97632..97634,97647..97649,97686..97688,97695..97697,
                     97707..97709,97788..97796,98157..98159,98163..98168,
                     98196..98198,98202..98204,98208..98210,98217..98222,
                     98244..98246,98250..98252,98313..98315,98319..98321,
                     98325..98327,98334..98336,98430..98432,98436..98438,
                     98445..98453,98457..98459)
                     /locus_tag="BAB2_0098"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143482"
     misc_feature    order(97485..97487,97491..97493,97548..97550,97746..97748,
                     97875..97877,97884..97886,97992..97997,98106..98117,
                     98247..98249,98322..98324,98418..98420)
                     /locus_tag="BAB2_0098"
                     /note="active site"
                     /db_xref="CDD:143482"
     misc_feature    order(97485..97487,97491..97493,97548..97550,97746..97748,
                     97875..97877,97884..97886,97992..97997,98106..98117,
                     98322..98324,98418..98420)
                     /locus_tag="BAB2_0098"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143482"
     misc_feature    order(97491..97493,98322..98324)
                     /locus_tag="BAB2_0098"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143482"
     misc_feature    order(98244..98249,98322..98327,98418..98420,98445..98447)
                     /locus_tag="BAB2_0098"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143482"
     gene            complement(98559..100277)
                     /locus_tag="BAB2_0099"
                     /db_xref="GeneID:3828007"
     CDS             complement(98559..100277)
                     /locus_tag="BAB2_0099"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="YP_418343.1"
                     /db_xref="GI:83269052"
                     /db_xref="GeneID:3828007"
                     /translation="MDGEDKRKSGSEGKPLLAFSDAPVSDSKKSRSTEDQASPTPPWT
                     PPASPRERAQYYRSHQSASSALTDEEIAGLREIGRDAASSEDKASPSDKEQPASDADE
                     NWPRRSNAAQDAEWKPLIDPRIAIDVIRGSRRLLLATTIFGGIVATLYALSLPQTYIA
                     STDILVDPRNIKVVGTELTPGQLPTDASLAVAESQARMIDSSSVLLKVINKAHLIQDP
                     EFNGTLVPTGIVGFFAQLKDLIGKKEQSDSQTMETRVLDNLRKSLTIHRDAKTFIYSI
                     SVTTREANKSASLANEISSVFQDELASLQSDAARRTSEELFQRLADLRASVEGAEKAV
                     ADFRATHDLIDVDGRLISNNELGRLNEQLTNQRAETVRLQARINVLKDATPDSVVAGT
                     LPEDLRSNTLTALRAQYAQARQAANGMATRLGPRHPQLIQLNSQANAVLNDISAELQR
                     VRSSLQVEVQRSQQQETALSARLAQLKARQANDAKDLVKLRELEREAAARRSIYEAFL
                     LRSRETSEQEGLNTVNIRVLSAARPPLEPAGSTRKLIVIAGLIAGFLAGLAITIIRNF
                     GRLLRL"
     misc_feature    complement(98574..99953)
                     /locus_tag="BAB2_0099"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell envelope biogenesis,
                     outer membrane]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     misc_feature    complement(99390..99902)
                     /locus_tag="BAB2_0099"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    complement(98580..98804)
                     /locus_tag="BAB2_0099"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; pfam13807"
                     /db_xref="CDD:258087"
     gene            complement(100294..100431)
                     /locus_tag="BAB2_0100"
                     /db_xref="GeneID:3828008"
     CDS             complement(100294..100431)
                     /locus_tag="BAB2_0100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418344.1"
                     /db_xref="GI:83269053"
                     /db_xref="GeneID:3828008"
                     /translation="MISGASSIFEAEAHWNIWQVSLYSTAYFNHLFSIKKYSHASSWY
                     S"
     gene            complement(100403..101305)
                     /locus_tag="BAB2_0101"
                     /db_xref="GeneID:3828009"
     CDS             complement(100403..101305)
                     /locus_tag="BAB2_0101"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418345.1"
                     /db_xref="GI:83269054"
                     /db_xref="GeneID:3828009"
                     /translation="MARRQNMAEGRSPVKTAIVTASWDQDFERCKLLCETVDKYTTGF
                     TKHYILVESKDVALFRQLESSRRIIIDERDLLPSWLHAFWDPTHLWRRRIWLSLKTKP
                     LRGWHVQQLRRIALAGAMEEDGFLYMDSDMAFLRPFDCSTLWHGEKLRLFVRPNALAN
                     PKWPEHPVWAANAAKLLGIQNGKSGLNDYIGQLVSWRRDSVISMCERIEAHTGQHWVA
                     ALGKIRRFSECILYGRYVDDILKGVGHFHDTGDLCRVYWFSPPPTEDEFRAFIAGLEP
                     HQVAIGMQSFIGLSIDDIRRVINI"
     gene            complement(101263..101907)
                     /locus_tag="BAB2_0102"
                     /pseudo
                     /db_xref="GeneID:3828010"
     misc_feature    complement(101263..101907)
                     /locus_tag="BAB2_0102"
                     /note="Glycosyl transferase WecB/TagA/CpsF family"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12268.1"
     gene            complement(101922..102023)
                     /locus_tag="BAB2_0103"
                     /pseudo
                     /db_xref="GeneID:3828011"
     misc_feature    complement(101922..102023)
                     /locus_tag="BAB2_0103"
                     /note="glycosyl transferase, WecB/TagA/CpsF family"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12269.1"
     gene            complement(102024..103178)
                     /locus_tag="BAB2_0104"
                     /db_xref="GeneID:3828012"
     CDS             complement(102024..103178)
                     /locus_tag="BAB2_0104"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418346.1"
                     /db_xref="GI:83269055"
                     /db_xref="GeneID:3828012"
                     /translation="MPHAIAATGYEVANAAVIDGLRRAGADVTVLGFTWPGHRAAEDP
                     DTIVLGEVEVRTENAGLKRKVCWVLKSFLTGLTVSSAKLRVIPEQKLRETIRQLGEFD
                     AYVLNGVTLAGAFVDVFKDKPCLFVAHNVEHRSAEENAQNAGGIQKFLFQREAGILKG
                     LETRLCQQASFVFTFAQDDGPALGLDQDHFATLPLVTPGGMQIAQDRPVEYDLALIGT
                     WTWHPNRIGLEWFLHEVKPLLPQDISIAIAGSTPADLIEAWPGVNFVGKVPDATAFVE
                     AGALIPLISRAGTGVQLKTIETFELGMPSVATSHSVRGISQVPANCTIANNPSDFAAA
                     VIKQLEKIRTGDRQKLDGKIFTRSQIKGMDQAIARGLAALRRRLGNTDCI"
     misc_feature    complement(102168..102545)
                     /locus_tag="BAB2_0104"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_4; pfam13692"
                     /db_xref="CDD:257994"
     gene            103350..104342
                     /locus_tag="BAB2_0105"
                     /db_xref="GeneID:3828013"
     CDS             103350..104342
                     /locus_tag="BAB2_0105"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_418347.1"
                     /db_xref="GI:83269056"
                     /db_xref="GeneID:3828013"
                     /translation="MSALPDHIEVISKTSDLRFEDIDIVVTLPTFRRPDHLIRTLDTL
                     KAQKTEKRFAVIVIENEAEKREGAEVAAPLFADGTYRGMLIVESHRGNCNAYNAGWLT
                     AMTCFPNFKYILVIDDDELADPMWIENMVSAAGRFDASLVGGPQYPVFEKPNSQQWAK
                     HPVFMPPYTKTGAVPIIYSSGNLLIARPVLEAIGYPFLDLMFNFTGGGDSDFVGRSKA
                     KGFRIAWCAEGIVRETIPARRLEGDWIRARGLRNGVLSTLTEQRRRKDEPCGQIRVFL
                     KSLALLAYSPIKALRSGLAAGFAPAGMYFIYVGLGRVLAHFGYLNEQYRNPDKN"
     misc_feature    103410..104105
                     /locus_tag="BAB2_0105"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    103416..103931
                     /locus_tag="BAB2_0105"
                     /note="Glycosyl transferase family 2; Region:
                     Glycos_transf_2; pfam00535"
                     /db_xref="CDD:249939"
     misc_feature    order(103434..103436,103440..103442,103521..103523,
                     103698..103700,103704..103706)
                     /locus_tag="BAB2_0105"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            104311..105636
                     /locus_tag="BAB2_0106"
                     /db_xref="GeneID:3828014"
     CDS             104311..105636
                     /locus_tag="BAB2_0106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418348.1"
                     /db_xref="GI:83269057"
                     /db_xref="GeneID:3828014"
                     /translation="MSNIVTRTRTDARMPDATGPQARIRRIALVIASVIFGVLLISFR
                     PFTPAGGAETETGGDIINQLGFSCVGAVALASMAMFANLRKLAGIIRPGWLVMLVFLF
                     ASIFASSDPATAVRGVLLTTVGIVAIIAVLVLPQDGDGYSALLVSVASVVIVISYAGV
                     VLLPSLGTHGADAIEPQNSFLWRGVFSHKNIAGPVMAVFAFAGLYLWRRGWKTSGLLI
                     GLSALGFVSQTGSKTTMALVPFAMLLVVLPGLMGLRKLTAGLIFAIQLAFATFIFGVV
                     LFEPIRRLVENMDVDATFTGRVSIWKFALEALSKRPWTGYGYESFWSSAYARHAARPY
                     YLDWDVRGIVHGHNSYLDVAMTMGIPALLCAIAVIIVMPLVHYARCRPVRENMLLADF
                     FLMIVLFGTLNAMMESFYFRRMDPVWLTLILAIFGLGMTAKVVIPKRSV"
     misc_feature    104488..105597
                     /locus_tag="BAB2_0106"
                     /note="Lipid A core - O-antigen ligase and related enzymes
                     [Cell envelope biogenesis, outer membrane]; Region: RfaL;
                     COG3307"
                     /db_xref="CDD:225844"
     misc_feature    104995..105408
                     /locus_tag="BAB2_0106"
                     /note="O-Antigen ligase; Region: Wzy_C; pfam04932"
                     /db_xref="CDD:252887"
     gene            105650..106786
                     /locus_tag="BAB2_0107"
                     /db_xref="GeneID:3828170"
     CDS             105650..106786
                     /locus_tag="BAB2_0107"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_418349.1"
                     /db_xref="GI:83269058"
                     /db_xref="GeneID:3828170"
                     /translation="MNIAIIGTGFVADYYMTTLRNYPELSLRGVYDRSPERLKAFVAH
                     YNVPAYESYEALLADPDVQIVVNLTTPESHFAVSHAALCAGKHVYSEKPLAMDFDDAK
                     ALLELARQSGLTLAAAPANGLSDAHKLVSSLIKTIGTPRLVYAEMEDGPVFRDKWSTW
                     RSQSGAPWPGLHEFEIGCTLEHAGYALSWLVSLFGPVESVSAFSAITFPDKGPGTEHL
                     HMAPDFSVGCLVFKSGLVARLTSGLAMPKDRSLTVVADKGSIVVDDLWDNRSAVRLER
                     VEEKRRFFARLFANLERRLGKFLSWKPGVGRKIAYPKTGKYALPSFPSQIDFMRGVAD
                     QARSISSGEKAFFSGDVALHITEIALALNNAGQGAAVYRMKSSF"
     misc_feature    105650..106732
                     /locus_tag="BAB2_0107"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    105650..105994
                     /locus_tag="BAB2_0107"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     gene            complement(106783..107832)
                     /locus_tag="BAB2_0108"
                     /db_xref="GeneID:3828171"
     CDS             complement(106783..107832)
                     /locus_tag="BAB2_0108"
                     /EC_number="1.3.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="YP_418350.1"
                     /db_xref="GI:83269059"
                     /db_xref="GeneID:3828171"
                     /translation="MTQNERIGGDFRWGIWGTDMIASSFAADIAASAGMRVVAVCSHT
                     TQTAQAFCRHIGINKAFGNPHAFLADPEIDAVYIASPNMLHVEQALDAIMAGKACLIE
                     KPLSLDPEGARQIETASKARNIFAMEAMWTRFLPAAQAVKHAIDASRIGTVTHIEADL
                     SYSRAYDPESRFFSPALGGGAAFDLGVYPLSLALYFLGLPEKVDGHCQRAASGVDLRS
                     EFNLGWPSATAWISCGFDRDGENRMLIEGTDGAILIHPPFLKAQRLTFFSRSALHSPF
                     GPKNSKGRIGNIINRLPLPGRTIETHAFAGNGLQFQAQAVRDAIRRGEISTPIMPLAQ
                     SAAVADIISRVLVSG"
     misc_feature    complement(106789..107802)
                     /locus_tag="BAB2_0108"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(107452..107802)
                     /locus_tag="BAB2_0108"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    complement(107092..107409)
                     /locus_tag="BAB2_0108"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            108149..109558
                     /gene="gnd"
                     /locus_tag="BAB2_0109"
                     /db_xref="GeneID:3828241"
     CDS             108149..109558
                     /gene="gnd"
                     /locus_tag="BAB2_0109"
                     /EC_number="1.1.1.44"
                     /note="catalyzes the formation of D-ribulose 5-phosphate
                     from 6-phospho-D-gluconate"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="YP_418351.1"
                     /db_xref="GI:83269060"
                     /db_xref="GeneID:3828241"
                     /translation="MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIE
                     KAGRLRDKIIPCPTFEELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDA
                     GNSDYRDTVRRLKALGPNDPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLA
                     VAAKYQGEPCCALVGPDGAGHFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGD
                     VFEKWNEGPLNSYLIEITAKVLKSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILG
                     VPATGIEAAVAARSLSSMKGEREEAAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIA
                     AYAQGFAVMEAASREHGWNIPLATTARIWRAGCIIRSQLLDDIAQAFEGNESRNLLMA
                     PAFVPRMETSVKSLRQIVAQAALASLPLPALGSALSYFDSYTQALGTANLIQGQRDFF
                     GSHGFKRIDKEGDFHGPWG"
     misc_feature    108149..109555
                     /gene="gnd"
                     /locus_tag="BAB2_0109"
                     /note="6-phosphogluconate dehydrogenase [Carbohydrate
                     transport and metabolism]; Region: Gnd; COG0362"
                     /db_xref="CDD:223439"
     misc_feature    108158..108640
                     /gene="gnd"
                     /locus_tag="BAB2_0109"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    108686..109552
                     /gene="gnd"
                     /locus_tag="BAB2_0109"
                     /note="6-phosphogluconate dehydrogenase, C-terminal
                     domain; Region: 6PGD; pfam00393"
                     /db_xref="CDD:249826"
     gene            complement(109654..110715)
                     /locus_tag="BAB2_0110"
                     /db_xref="GeneID:3828172"
     CDS             complement(109654..110715)
                     /locus_tag="BAB2_0110"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter ATPase"
                     /protein_id="YP_418352.1"
                     /db_xref="GI:83269061"
                     /db_xref="GeneID:3828172"
                     /translation="MAFLNIKNLKKSFGTNTVVHDFNLAVEKGEFVSFLGPSGCGKTT
                     VLRMIAGFETSDDGSIEIDGKDVVNLRPNQRNIGMVFQAYALFPNMTVAQNVSFGLRV
                     SGKSRSEIDATVKEMLSLIRLDHLADRYPYQMSGGQQQRVALARALATKPQVLLLDEP
                     LSALDAKIRISLREEIRAIQQKLGITTVFVTHDQEEALSISDRIVVMHEGRADQIGSP
                     FDIYNRPASRFVASFVGTLNMLEASVSEPAQNSIDLDGRQITVQETLAHHPKGKPLTL
                     ALRPEAVSLEARKSHDTSLEATIDDVHFLGSVIRTRVILGKNRLSFDTFNDPTHPPPQ
                     RGDKVTVHFASHDLLVLAD"
     misc_feature    complement(109657..110715)
                     /locus_tag="BAB2_0110"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(110011..110706)
                     /locus_tag="BAB2_0110"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(110587..110610)
                     /locus_tag="BAB2_0110"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(110140..110142,110239..110244,
                     110470..110472,110584..110592,110596..110601))
                     /locus_tag="BAB2_0110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110470..110481)
                     /locus_tag="BAB2_0110"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110287..110316)
                     /locus_tag="BAB2_0110"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110239..110256)
                     /locus_tag="BAB2_0110"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110221..110232)
                     /locus_tag="BAB2_0110"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(110134..110154)
                     /locus_tag="BAB2_0110"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(109663..109890)
                     /locus_tag="BAB2_0110"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(110721..111539)
                     /locus_tag="BAB2_0111"
                     /db_xref="GeneID:3828173"
     CDS             complement(110721..111539)
                     /locus_tag="BAB2_0111"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418353.1"
                     /db_xref="GI:83269062"
                     /db_xref="GeneID:3828173"
                     /translation="MKSKGSNLRKISAQKIGAWIAFFVGAIYFLVPLIGTFEFSLRMR
                     RGEYSFDAYRVVFADANFQATFTYSIVLGLLTIIFGVLLAVPTAYWVRLRLPQLRPVM
                     EFITLMPLVIPAIVIVFGYLRIYNSSSWLPFTASTRATDVLLMFGYMTLSLPYMYRAV
                     DTAMRTIDVNTLTEAAQSLGAGWGRIMFKVIFPNVISGVMSGAFITFAIVIGEFTLAS
                     LLNRPAFGPYLQLVGANRAYEPSALAIISFGITWLSIIMLQLVSRLNKFKTTAG"
     misc_feature    complement(110724..111494)
                     /locus_tag="BAB2_0111"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(110769..111344)
                     /locus_tag="BAB2_0111"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110775..110780,110787..110792,
                     110796..110801,110808..110813,110841..110846,
                     110883..110888,110895..110906,110925..110927,
                     110934..110939,110979..110981,111033..111035,
                     111042..111047,111057..111059,111063..111068,
                     111075..111077,111081..111083,111087..111092,
                     111174..111176,111180..111185,111192..111221,
                     111225..111236,111264..111266,111279..111284,
                     111291..111296))
                     /locus_tag="BAB2_0111"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110889..110906,111174..111218))
                     /locus_tag="BAB2_0111"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110811..110813,110841..110843,
                     110850..110852,110886..110888,111114..111116,
                     111174..111176))
                     /locus_tag="BAB2_0111"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(110958..110960,110970..110975,
                     110991..111026,111030..111032))
                     /locus_tag="BAB2_0111"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(111536..112429)
                     /locus_tag="BAB2_0112"
                     /db_xref="GeneID:3828174"
     CDS             complement(111536..112429)
                     /locus_tag="BAB2_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="YP_418354.1"
                     /db_xref="GI:83269063"
                     /db_xref="GeneID:3828174"
                     /translation="MSSVAETTAPTSGVRKRQLPLSWLGVAPFFLFAILFLIWPTMYL
                     IIGAFQDPAGNFTLQNIHDLFQPQIMSAYWISIKVSFASAVGGAIIGFFLAWAVVLGN
                     LPSWLRPTVLTFSGVASNFAGVPLAFAFLATLGRTGFVTILLREWFGFNLYSTGFNLL
                     SFFGLTLTYLFFQIPLMVLILTPALDGLKKEWREASSILGATHMQYWRMVAFPILWPS
                     LLGTTLLLFANAFGAIATAYALTGSSLNIVPILLYAQIRGDVLHNQNLGYALALGMIV
                     ITGVSNLLYIWLRIRAERWQR"
     misc_feature    complement(111548..112387)
                     /locus_tag="BAB2_0112"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(111596..112213)
                     /locus_tag="BAB2_0112"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111596..111598,111605..111610,
                     111617..111622,111626..111631,111638..111643,
                     111671..111676,111713..111718,111725..111736,
                     111755..111757,111764..111769,111809..111811,
                     111860..111862,111869..111874,111884..111886,
                     111890..111895,111902..111904,111908..111910,
                     111917..111922,112037..112039,112043..112048,
                     112055..112084,112088..112099,112127..112129,
                     112148..112153,112160..112165))
                     /locus_tag="BAB2_0112"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111719..111736,112037..112081))
                     /locus_tag="BAB2_0112"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111641..111643,111671..111673,
                     111680..111682,111716..111718,111935..111937,
                     112037..112039))
                     /locus_tag="BAB2_0112"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(111788..111790,111800..111805,
                     111821..111859))
                     /locus_tag="BAB2_0112"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(112638..113741)
                     /locus_tag="BAB2_0113"
                     /db_xref="GeneID:3828175"
     CDS             complement(112638..113741)
                     /locus_tag="BAB2_0113"
                     /codon_start=1
                     /transl_table=11
                     /product="solute-binding family 1 protein"
                     /protein_id="YP_418355.1"
                     /db_xref="GI:83269064"
                     /db_xref="GeneID:3828175"
                     /translation="MLSYTARLLSLSTAIAVAGVSIATAEPSAELIAAAKAEGELTTI
                     ALPHDWCGYGDIIKSFKDKYGIKVNELNPDAGSGDEVEAIKANKNNKGPQAPDVIDVG
                     FAFGTSAKKDGLTQAYKVSTWDEIPDSAKDPEGHWYGDYYGVLAFEVNKDIVKDAPQD
                     WEDLLKSDYANAVALAGDPRVSAQAILGVHAAGIARGAEPGEAAGKKGLEFYKELNAN
                     GNFVPVIGKAASLAQGSTPIVIRWDYNSLADRDTLNGNPEVETIIPKSGVIAGVYVQA
                     ISAYAPHPNAAKLWMEHIYSDEGQLGYLKGYCHPIRFNAMAKAGKIPQELLDKLPPAA
                     AYEKAIFPTIEQIEAAQATITKDWDSVVGANVQ"
     misc_feature    complement(112647..113576)
                     /locus_tag="BAB2_0113"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            complement(114150..115214)
                     /locus_tag="BAB2_0114"
                     /pseudo
                     /db_xref="GeneID:3828176"
     misc_feature    complement(114150..115214)
                     /locus_tag="BAB2_0114"
                     /note="Major facilitator superfamily (MFS)"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12280.1"
     gene            complement(115211..115672)
                     /locus_tag="BAB2_0115"
                     /pseudo
                     /db_xref="GeneID:3828177"
     misc_feature    complement(115211..115672)
                     /locus_tag="BAB2_0115"
                     /note="Major facilitator superfamily (MFS)"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12281.1"
     gene            complement(115765..116730)
                     /locus_tag="BAB2_0116"
                     /pseudo
                     /db_xref="GeneID:3828178"
     misc_feature    complement(115765..116730)
                     /locus_tag="BAB2_0116"
                     /note="Secretion protein HlyD"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12282.1"
     gene            116831..117574
                     /locus_tag="BAB2_0117"
                     /db_xref="GeneID:3828179"
     CDS             116831..117574
                     /locus_tag="BAB2_0117"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LacI"
                     /protein_id="YP_418356.1"
                     /db_xref="GI:83269065"
                     /db_xref="GeneID:3828179"
                     /translation="MKPARNTSRIGDISDDKKGELRSAPDKAELSASCLPETECGRTR
                     LAAGQDPAKRSQILEGAQSVFLRMGFDAASMNDITREAGVSKGTIYVYFNSKEDLFVA
                     LCEHYRQTLFSSFIGQLEKGFSNRQELIDFGVALTTLITSSIAIRAQRIVVGVSERKP
                     ELAARFYERGPKRSHAIMAQSLQAMIDAGVLEQHDVTRTAYQLSDLFFAGLYRPRLFG
                     ALAEAPSEQAIRDNVESAVDFFFRAYGKK"
     misc_feature    116984..117559
                     /locus_tag="BAB2_0117"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    116999..117139
                     /locus_tag="BAB2_0117"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    117395..117562
                     /locus_tag="BAB2_0117"
                     /note="AefR-like transcriptional repressor, C-terminal
                     region; Region: TetR_C_7; pfam14246"
                     /db_xref="CDD:258436"
     gene            117848..118627
                     /locus_tag="BAB2_0118"
                     /db_xref="GeneID:3828180"
     CDS             117848..118627
                     /locus_tag="BAB2_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family regulatory protein"
                     /protein_id="YP_418357.1"
                     /db_xref="GI:83269066"
                     /db_xref="GeneID:3828180"
                     /translation="MSLDLVHFPNYKKTFFGSSFQSDTLALLTRIRDEIGCRYVTHTY
                     RGRVGDCTKVNSADLTVLMTLPATWVARYSSKNYFAIDPVFQEDAPYYRNDTSAIARD
                     LKEDADICPAVAELLHDAEKHGLGNLFIAVSARNPKGVAGCTVFTFEVEDEDRTQFLA
                     RMRPRLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEIAEILSIAR
                     WTVVTYLQNAKIKLNCSNRTSAVATALSLGIIDMPEVQHLV"
     misc_feature    117911..118378
                     /locus_tag="BAB2_0118"
                     /note="Autoinducer binding domain; Region: Autoind_bind;
                     pfam03472"
                     /db_xref="CDD:251983"
     misc_feature    118415..118585
                     /locus_tag="BAB2_0118"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(118418..118426,118463..118471,118493..118498,
                     118502..118507,118511..118525,118556..118558)
                     /locus_tag="BAB2_0118"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(118451..118453,118457..118459,118463..118465,
                     118556..118564,118571..118573,118580..118585)
                     /locus_tag="BAB2_0118"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(118593..119114)
                     /locus_tag="BAB2_0119"
                     /db_xref="GeneID:3828181"
     CDS             complement(118593..119114)
                     /locus_tag="BAB2_0119"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418358.1"
                     /db_xref="GI:83269067"
                     /db_xref="GeneID:3828181"
                     /translation="MQFSKERETIIAENIRDVVSDLRLVDPADYIAFIRCELFANIAD
                     LVSSAAELYFYPGTLGLGHGGEFHCDWQSPPSITLDMEFRHQGVYAYFRITLTDRTAG
                     VELNHIAFEDADGDPSANTVRLAKAFEDARCPCANAPETRLSFSFRLLRRRAEGFRAT
                     MLIRRDAVPRAYR"
     gene            complement(119234..120304)
                     /gene="flhB"
                     /locus_tag="BAB2_0120"
                     /db_xref="GeneID:3828182"
     CDS             complement(119234..120304)
                     /gene="flhB"
                     /locus_tag="BAB2_0120"
                     /note="membrane protein responsible for substrate
                     specificity switching from rod/hook-type export to
                     filament-type export"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="YP_418359.1"
                     /db_xref="GI:83269068"
                     /db_xref="GeneID:3828182"
                     /translation="MADDADKESKTEEATEQKIRDAQDKGNMPFSREAPILAGIASFL
                     VIAVFVAAPAATRLAVFLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIII
                     PLAGIAASAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASV
                     IVFLVFFKGDSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHW
                     RQELRMTRQEVKDELKQSEGDPLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFS
                     VALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQLARALYKQVNVDQMI
                     APEFYKAVAELIRIINTRRAIS"
     misc_feature    complement(119243..120301)
                     /gene="flhB"
                     /locus_tag="BAB2_0120"
                     /note="Flagellar biosynthesis pathway, component FlhB
                     [Cell motility and secretion / Intracellular trafficking
                     and secretion]; Region: FlhB; COG1377"
                     /db_xref="CDD:224295"
     gene            complement(120321..121121)
                     /locus_tag="BAB2_0121"
                     /pseudo
                     /db_xref="GeneID:3828183"
     misc_feature    complement(120321..121121)
                     /locus_tag="BAB2_0121"
                     /note="Flagellar motor switch protein FliG"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12287.1"
     gene            complement(121308..121628)
                     /locus_tag="BAB2_0122"
                     /db_xref="GeneID:3828184"
     CDS             complement(121308..121628)
                     /locus_tag="BAB2_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch FliN"
                     /protein_id="YP_418360.1"
                     /db_xref="GI:83269069"
                     /db_xref="GeneID:3828184"
                     /translation="MQQELNEAIEELREEKPRSAQKSASKPNLDLIMGIPVDVQVVLG
                     GTTMPVSSLMKLGRGAVITLDKQIGDPVDIVVNGRVIARGEVIVLEDDSSRFGVSLTE
                     IIGK"
     misc_feature    complement(121311..121547)
                     /locus_tag="BAB2_0122"
                     /note="flagellar motor switch protein FliN; Region: fliN;
                     TIGR02480"
                     /db_xref="CDD:131533"
     gene            complement(121652..122113)
                     /locus_tag="BAB2_0123"
                     /db_xref="GeneID:3828185"
     CDS             complement(121652..122113)
                     /locus_tag="BAB2_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418361.1"
                     /db_xref="GI:83269070"
                     /db_xref="GeneID:3828185"
                     /translation="MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAA
                     ASNGLERAVKAIRNERTDLTDASAKLDARLAETQRVRREMDEAIEELNRLRKALSRDM
                     RQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRRAVKKATVELAGQA"
     gene            complement(122094..122426)
                     /locus_tag="BAB2_0124"
                     /pseudo
                     /db_xref="GeneID:3828186"
     misc_feature    complement(122094..122426)
                     /locus_tag="BAB2_0124"
                     /note="Surface presentation of antigens (SPOA) protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12290.1"
     gene            complement(122342..123043)
                     /locus_tag="BAB2_0125"
                     /pseudo
                     /db_xref="GeneID:3828187"
     misc_feature    complement(122342..123043)
                     /locus_tag="BAB2_0125"
                     /note="ATP/GTP-binding site motif A (P-loop):Flagellar
                     motor switch protein FliM"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12291.1"
     gene            complement(123045..123917)
                     /locus_tag="BAB2_0126"
                     /db_xref="GeneID:3828188"
     CDS             complement(123045..123917)
                     /locus_tag="BAB2_0126"
                     /note="With MotB forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="YP_418362.1"
                     /db_xref="GI:83269071"
                     /db_xref="GeneID:3828188"
                     /translation="MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGT
                     FFVANPFSLVKDTGRACMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHID
                     NPKESPIFLAYPSVLKKEDLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLK
                     PYQAMITISEALPALGIVAAVLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYG
                     VIGPIANKIKSTREKNNRLYIVVKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVV
                     EQETMASVPTQQAA"
     misc_feature    complement(123069..123917)
                     /locus_tag="BAB2_0126"
                     /note="flagellar motor protein MotA; Validated; Region:
                     PRK09110"
                     /db_xref="CDD:181655"
     gene            124075..124851
                     /locus_tag="BAB2_0127"
                     /db_xref="GeneID:3828189"
     CDS             124075..124851
                     /locus_tag="BAB2_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgF"
                     /protein_id="YP_418363.1"
                     /db_xref="GI:83269072"
                     /db_xref="GeneID:3828189"
                     /translation="MTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDF
                     MADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDF
                     AGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILG
                     DKALLTMLQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMHEM
                     NNPTASSPASIASFLLGGTSSIGISMNILATLQNFKPGGR"
     misc_feature    <124087..>124260
                     /locus_tag="BAB2_0127"
                     /note="Protein of unknown function (DUF1217); Region:
                     DUF1217; pfam06748"
                     /db_xref="CDD:148384"
     misc_feature    124243..124689
                     /locus_tag="BAB2_0127"
                     /note="Protein of unknown function (DUF1217); Region:
                     DUF1217; pfam06748"
                     /db_xref="CDD:148384"
     gene            124851..125582
                     /gene="flgF"
                     /locus_tag="BAB2_0128"
                     /db_xref="GeneID:3828212"
     CDS             124851..125582
                     /gene="flgF"
                     /locus_tag="BAB2_0128"
                     /note="FlgF, with FlgB and C, makes up the proximal
                     portion of the flagellar basal body rod; Bradyrhizobium
                     have one thick flagellum and several thin flagella; the
                     protein in this cluster is associated with the thin
                     flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="YP_418364.1"
                     /db_xref="GI:83269073"
                     /db_xref="GeneID:3828212"
                     /translation="MQNNSIYVGLSSLITLERRMDAIAHNVANASTVGFRGEGTKFDT
                     IVSDKASDDVSFATAGKSYIRTEAGPLIKTDNPLDVAVKGDAWMSFSTPQGQVYSRDG
                     RMKMLSTGDPVSVTGNAILDVGGAPIVLNPGGGAPRISSDGAIYQNGVQVGAIGLYTI
                     PADADLAYAGTSGVIPSKPAQPVVDDNSVGVVQGMIEGSNVDAMTEMTRLISISRAFE
                     QVNNLLSQQEATVSEAIKTLGSKNG"
     misc_feature    124854..125576
                     /gene="flgF"
                     /locus_tag="BAB2_0128"
                     /note="flagellar basal body rod protein FlgF; Reviewed;
                     Region: flgF; PRK12642"
                     /db_xref="CDD:237153"
     misc_feature    124866..124958
                     /gene="flgF"
                     /locus_tag="BAB2_0128"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    125232..125504
                     /gene="flgF"
                     /locus_tag="BAB2_0128"
                     /note="flagellar basal-body rod protein FlgF; Region:
                     flgF; TIGR02490"
                     /db_xref="CDD:233892"
     gene            125579..126940
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /db_xref="GeneID:3828221"
     CDS             125579..126940
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /EC_number="3.6.3.14"
                     /note="involved in type III protein export during
                     flagellum assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellum-specific ATP synthase"
                     /protein_id="YP_418365.1"
                     /db_xref="GI:83269074"
                     /db_xref="GeneID:3828221"
                     /translation="MTPDLPLTRLAAFVRQQTIAPEPLTGIGGTVSDVSRSSIAVRGL
                     SRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMPSLGAAVFEEGPLRIR
                     PAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARVDRGLRTGVNVIDI
                     FTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGREVREMLEETMAG
                     HLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTRFAHAAREVA
                     IAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDHNDPVSDT
                     IRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMVARFEE
                     TRDLRAIGAYQKSHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALRGDRQA
                     QNA"
     misc_feature    125579..126937
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /note="flagellum-specific ATP synthase; Validated; Region:
                     fliI; PRK06002"
                     /db_xref="CDD:235666"
     misc_feature    125870..126856
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(126098..126103,126113..126121)
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(126101..126103,126113..126121,126170..126172,
                     126176..126181,126365..126370)
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    126353..126367
                     /gene="fliI"
                     /locus_tag="BAB2_0129"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            127024..127542
                     /locus_tag="BAB2_0130"
                     /db_xref="GeneID:3827184"
     CDS             127024..127542
                     /locus_tag="BAB2_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418366.1"
                     /db_xref="GI:83269075"
                     /db_xref="GeneID:3827184"
                     /translation="MKKPLSKGDRYLVIAVIALAAASALLPIVTYLQRVDFNPANKAE
                     RKIIDPLDRSEQKTVRRFPSFRPSEQVAPASEVDKTMTGSVMSNGKGLPGAGKGEGEI
                     GDGRGQPFPKPVFALRDVVGGMAMIEDASGYWFVEKGSLLPDGSRLVSIGRGAGTWQL
                     TTSSGDIIDMRR"
     gene            complement(127567..128544)
                     /locus_tag="BAB2_0131"
                     /db_xref="GeneID:3827185"
     CDS             complement(127567..128544)
                     /locus_tag="BAB2_0131"
                     /codon_start=1
                     /transl_table=11
                     /product="PA-phosphatase-like phosphoesterase"
                     /protein_id="YP_418367.1"
                     /db_xref="GI:83269076"
                     /db_xref="GeneID:3827185"
                     /translation="MKQAHGPDDNRSMWMLMGIGIVCVFGFFIQILVLSRYLDRPLAL
                     FMASQKGTALVDIAAHITKFGKAYWFLVPAAALFVFYRFINRSPQKSFNCFFIIASIA
                     VSGIVIKILKIIFGRARPGVLIDDGFYGFTFFRLDREFNSFPSAHTGVAIAAGVALAL
                     IMQKHRWVPIILGIVIASSRIIINAHYLSDVVASSLISTVTVLLLYDILGYFGYRAGE
                     PDRHSPDMQGSLKLMSNVIGAPVAEHENGQRPQDGLTTRIIGVMNIAAILILIGLIFD
                     FVLIEWFEWQYQPAELIPGWWLPAAITLCALGVGASLYVGRAGRGCARR"
     misc_feature    complement(127927..128508)
                     /locus_tag="BAB2_0131"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    complement(127918..128439)
                     /locus_tag="BAB2_0131"
                     /note="PAP2_like proteins, Lipid A 1-phosphatase
                     subfamily. Lipid A 1-phosphatase, or LpxE from Francisella
                     novicida selectively dephosphorylates lipid A at the
                     1-position. Lipid A is the membrane-anchor component of
                     lipopolysaccharides (LPS), the major...; Region:
                     PAP2_lipid_A_1_phosphatase; cd03389"
                     /db_xref="CDD:239483"
     misc_feature    complement(order(127975..127977,127987..127989,
                     128005..128007,128104..128112,128188..128190,
                     128209..128211))
                     /locus_tag="BAB2_0131"
                     /note="active site"
                     /db_xref="CDD:239483"
     gene            129088..129483
                     /locus_tag="BAB2_0132"
                     /db_xref="GeneID:3827186"
     CDS             129088..129483
                     /locus_tag="BAB2_0132"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418368.1"
                     /db_xref="GI:83269077"
                     /db_xref="GeneID:3827186"
                     /translation="MAPRAMFKRFPIFVGGSAIGAVIDYVVTLSASNYINLYPPVALA
                     LAMLISGSVVFFFHIRITFQYSTHKIFRQYALFMGWTCAIYFLRAAMLQICLYAGLPL
                     AVALILAIGLASVINFVISSVIIFAKSPA"
     misc_feature    129139..129465
                     /locus_tag="BAB2_0132"
                     /note="GtrA-like protein; Region: GtrA; pfam04138"
                     /db_xref="CDD:252403"
     gene            129480..130460
                     /locus_tag="BAB2_0133"
                     /db_xref="GeneID:3827187"
     CDS             129480..130460
                     /locus_tag="BAB2_0133"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_418369.1"
                     /db_xref="GI:83269078"
                     /db_xref="GeneID:3827187"
                     /translation="MNAKTLCIIVPVYNEAEGLSDLLDRLHSAADSIASQFTLNIEFI
                     FIDDGSSDGSFALLKAHDFGSRPVRLLRFSRNFGKEAALSAGIDAAEGADAAILMDAD
                     LQHPPEMIADFVRIWQEEDADSVYAYKASRLASEGPVKAALSRAFFWVINRDQRYKIP
                     PGAGGFRLVNRRFMAALRSLPESDRFMKGLYGWVGFNQVGLPLQPPPRMRGTSYYNPL
                     QLLLMSLGAMTSFSTTPLRLMALAGIVVAGLSAAYGLYVLSEYFFFPGVPVGLTSILA
                     LTAFFGGIQLMFLGLLGEYIGKSVLEAKKRPIYILAEDIRRKESDDADRG"
     misc_feature    129489..130451
                     /locus_tag="BAB2_0133"
                     /note="undecaprenyl phosphate
                     4-deoxy-4-formamido-L-arabinose transferase; Provisional;
                     Region: PRK10714"
                     /db_xref="CDD:182669"
     misc_feature    129501..130067
                     /locus_tag="BAB2_0133"
                     /note="Bacterial DPM1_like enzymes are related to
                     eukaryotic DPM1; Region: DPM1_like_bac; cd04187"
                     /db_xref="CDD:133030"
     misc_feature    order(129510..129512,129516..129518,129783..129785)
                     /locus_tag="BAB2_0133"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133030"
     misc_feature    order(129621..129623,129780..129785)
                     /locus_tag="BAB2_0133"
                     /note="Putative Catalytic site; other site"
                     /db_xref="CDD:133030"
     misc_feature    129777..129785
                     /locus_tag="BAB2_0133"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133030"
     misc_feature    130185..>130406
                     /locus_tag="BAB2_0133"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     gene            130444..131193
                     /locus_tag="BAB2_0134"
                     /db_xref="GeneID:3827188"
     CDS             130444..131193
                     /locus_tag="BAB2_0134"
                     /codon_start=1
                     /transl_table=11
                     /product="Glu/Leu/Phe/Val dehydrogenase"
                     /protein_id="YP_418370.1"
                     /db_xref="GI:83269079"
                     /db_xref="GeneID:3827188"
                     /translation="MRIADDFGLGRGHDRVILSLLETGRLDGTSVMMNDAMNPEDIAR
                     LRKLRAGGAKVGLHLNLTQALPGGGPIWPLGELIRPLLGAPFLGAITASLVRQVDAFV
                     TQFGSLPDYYDGHQHCHCFPAIAPLVARLSYGPATWVRVPLPATWEGRWLNIRAGGAK
                     VLLILALAARARAIFVRAGLKTNHDFSGFLRLGDPASVRRWLPELLARATPDCLIMLH
                     PGDGADPVQCAGHAAGSRAIEARILFESPIK"
     misc_feature    130444..131172
                     /locus_tag="BAB2_0134"
                     /note="uncharacterized YdjC-like family proteins from
                     bacteria; Region: YdjC_like_3; cd10807"
                     /db_xref="CDD:212118"
     misc_feature    order(130456..130467,130609..130617,130771..130788,
                     131095..131097,131149..131151)
                     /locus_tag="BAB2_0134"
                     /note="YdjC motif; other site"
                     /db_xref="CDD:212118"
     misc_feature    order(130456..130461,130465..130467,130609..130611,
                     130615..130617,130774..130776,130780..130782,
                     130786..130788,131095..131097,131149..131151)
                     /locus_tag="BAB2_0134"
                     /note="putative active site [active]"
                     /db_xref="CDD:212118"
     misc_feature    order(130456..130461,130615..130617,130786..130788)
                     /locus_tag="BAB2_0134"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212118"
     misc_feature    order(130474..130476,130540..130542,130549..130563,
                     130684..130686,130690..130692,130717..130719,
                     130741..130743,130750..130752)
                     /locus_tag="BAB2_0134"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212118"
     gene            131190..132626
                     /locus_tag="BAB2_0135"
                     /db_xref="GeneID:3827189"
     CDS             131190..132626
                     /locus_tag="BAB2_0135"
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase family protein"
                     /protein_id="YP_418371.1"
                     /db_xref="GI:83269080"
                     /db_xref="GeneID:3827189"
                     /translation="MMKNRAIVWGLFLLLFVRLLAMIWVPLTDPTEARYAEIARKMFE
                     TGNWITPQFDYGVPFWAKPPLHTWLSAAGIAIFGTTAFTARLGILLASLATLTILWQW
                     ACTLTDRRTATIAVLVAASSGLFYVSAVFVQTDMVLTLGVTASMAGFYNGLAGSRRWG
                     WLFFLGLAIGLLAKGPVAVVLSATPIAVWMLWRGNWRDLKHLPWAGGLTLCAVLVIPW
                     YVAAEIAPPGFLKYFLIGEHIQRFLQPGWSGDLYGAGREHARGSIWLFWIVATLPWSP
                     LLPVLIWRLRKNGMPDGKGLHLYLLLFALTPLVFFTPAANILLAYVLPGVPAAALLAV
                     ILWTRTGPAGAGWLKLGVVEVLLIFLVITIGSFFGLGRSFLPTQAPLIASYSGPGRLA
                     ILGGRSFSAEFYTQDKIVRFQTLNELAAWLKPGDGVLVPKSAYDAFAARFGNAVKPIS
                     EDRKYLLFIPIPAASVAKGTGAAAGAVI"
     misc_feature    131190..132584
                     /locus_tag="BAB2_0135"
                     /note="4-amino-4-deoxy-L-arabinose transferase and related
                     glycosyltransferases of PMT family [Cell envelope
                     biogenesis, outer membrane]; Region: ArnT; COG1807"
                     /db_xref="CDD:224720"
     misc_feature    131277..>132275
                     /locus_tag="BAB2_0135"
                     /note="Dolichyl-phosphate-mannose-protein
                     mannosyltransferase; Region: PMT_2; cl19158"
                     /db_xref="CDD:267511"
     gene            132870..133826
                     /locus_tag="BAB2_0136"
                     /db_xref="GeneID:3827190"
     CDS             132870..133826
                     /locus_tag="BAB2_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-hairpin-helix DNA-binding
                     domain-containing protein"
                     /protein_id="YP_418372.1"
                     /db_xref="GI:83269081"
                     /db_xref="GeneID:3827190"
                     /translation="MKPMYEIIMDPNDRSYELSGSAKLYASGLITIGTTTFNTQSYAR
                     TPKIIAQGGLDFYVLQLLTGGHLLGDFDGTDVAAKPGDIVIIDMAKTLVSRAFKGSRT
                     TVFIPRAELEEVVGGRNLHGLVLSGTRPITRLLFSYIQELNAVVPDLSMDEAIAAQKV
                     MLTFLRTGITGLEEDLVGFLPVNLPMKKRILSFIDQNLSDPLLGPRTIIQNFHVSRSH
                     LYRAFENDGGVAKTIRDKRLDRAFRILAEERNRTVYSKEVAYRCGFNDPAQFASAFKN
                     RFGMSPRDVQASGATLLSLDVDGFSFPKYISQEIAKVVPPSS"
     misc_feature    132918..133340
                     /locus_tag="BAB2_0136"
                     /note="AraC-binding-like domain; Region: AraC_binding_2;
                     pfam14525"
                     /db_xref="CDD:258665"
     misc_feature    133503..133733
                     /locus_tag="BAB2_0136"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    133608..133721
                     /locus_tag="BAB2_0136"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            134089..134193
                     /locus_tag="BAB2_0137"
                     /db_xref="GeneID:3827191"
     CDS             134089..134193
                     /locus_tag="BAB2_0137"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418373.1"
                     /db_xref="GI:83269082"
                     /db_xref="GeneID:3827191"
                     /translation="MPKMGSQSQAEYRMMICAQWGIIRTIDGAFIDGH"
     gene            134183..134620
                     /locus_tag="BAB2_0138"
                     /db_xref="GeneID:3827192"
     CDS             134183..134620
                     /locus_tag="BAB2_0138"
                     /codon_start=1
                     /transl_table=11
                     /product="SyrB family protein"
                     /protein_id="YP_418374.1"
                     /db_xref="GI:83269083"
                     /db_xref="GeneID:3827192"
                     /translation="MATEFEHGPDMYTPEDVIKNFKDHSSQSRSRGTKTLENEKHTAN
                     GRMVKRYTPEERRKVFSEIATSVKSGQSSLKDALATAGISEQTYYNWKKIFTGNGPAS
                     STTLGKDLQELIELEAENQRLRQELADKLRMENAELRRRLGKV"
     misc_feature    134327..134569
                     /locus_tag="BAB2_0138"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            134642..134752
                     /locus_tag="BAB2_0139"
                     /db_xref="GeneID:3827193"
     CDS             134642..134752
                     /locus_tag="BAB2_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418375.1"
                     /db_xref="GI:83269084"
                     /db_xref="GeneID:3827193"
                     /translation="MNQIGALTICFDAHLFRKPFHTFRDALYIVRPVVTG"
     gene            complement(134814..136115)
                     /locus_tag="BAB2_0140"
                     /db_xref="GeneID:3827194"
     CDS             complement(134814..136115)
                     /locus_tag="BAB2_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily transporter"
                     /protein_id="YP_418376.1"
                     /db_xref="GI:83269085"
                     /db_xref="GeneID:3827194"
                     /translation="MKNSNTAITSPEVVENMTYRKVAFRIIPLLMICYIIAYLDRVNV
                     GFAKLQMSEELGFSEAIYGLGAGLFFIGYFFFEIPSNILLHKLGARLWIARIMITWGL
                     LSALFAFVQTEWQFYILRFLLGAAEAGFYPGVILYLTYWFPSHRRGKMFALFQAGSPA
                     AGIFGNPLSGWIMDQFHDTAGWQGWQWMFVLEAIPAVVLGVVILLYLDNSVKAAKWLT
                     EEEKAIISRDIEADSKGKAASHSLMSLVKNPMLWVMTLIYFCFVMGQYGLTLWMPTLI
                     RASGVTSNVTIGLLGAIPFICAIIAMVIFSRSADHYRERRWHLVVPALLGAVGFVVAA
                     SATNTTVSIIFLSMAAAGVLACAPLFWSLPTAILSGAAAAAGIALINSVANLAGFISP
                     YMVGIIRDATHSSELGMYVLAGFLILGAAIVLCIPASKVNR"
     misc_feature    complement(134862..136058)
                     /locus_tag="BAB2_0140"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     misc_feature    complement(134835..136037)
                     /locus_tag="BAB2_0140"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(134952..134954,134961..134966,
                     134973..134978,134985..134990,135021..135023,
                     135030..135035,135045..135047,135054..135059,
                     135066..135068,135210..135212,135222..135224,
                     135231..135233,135243..135245,135255..135257,
                     135297..135299,135306..135311,135318..135323,
                     135330..135332,135630..135632,135648..135653,
                     135660..135665,135699..135701,135708..135713,
                     135720..135725,135732..135737,135873..135878,
                     135882..135887,135897..135899,135906..135911,
                     135918..135920,135969..135974,135978..135986,
                     135993..135995))
                     /locus_tag="BAB2_0140"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(136141..136773)
                     /locus_tag="BAB2_0141"
                     /db_xref="GeneID:3827195"
     CDS             complement(136141..136773)
                     /locus_tag="BAB2_0141"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldolase"
                     /protein_id="YP_418377.1"
                     /db_xref="GI:83269086"
                     /db_xref="GeneID:3827195"
                     /translation="MTEQEIRELIVELGASLFARGYCVGSAGNISVRLADGYLMTPTN
                     SCLGRLRADRLSKLDKGWNHIGGDRPSKEVFMHRAVLGARPQAGAVVHLHSTYATAIS
                     CLSSPADTMPITPLTPYFVMRIGKHLPTIPYYRPGDPAMEREIHDAAQNASAMLLANH
                     GPVVSGNSLVDAVYAAEELEESARLSIMLQGLPARKLTDEQIEDLLHTFK"
     misc_feature    complement(136144..136773)
                     /locus_tag="BAB2_0141"
                     /note="putative aldolase; Validated; Region: PRK08130"
                     /db_xref="CDD:181241"
     misc_feature    complement(order(136156..136158,136231..136233,
                     136243..136245,136264..136266,136297..136299,
                     136375..136377,136423..136428,136432..136434,
                     136462..136470,136483..136488,136492..136494,
                     136627..136632,136636..136638,136702..136704))
                     /locus_tag="BAB2_0141"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(136294..136296,136492..136494,
                     136498..136500,136555..136563,136642..136647,
                     136687..136689))
                     /locus_tag="BAB2_0141"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(136294..136296,136492..136494,
                     136498..136500))
                     /locus_tag="BAB2_0141"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(136799..137764)
                     /locus_tag="BAB2_0142"
                     /db_xref="GeneID:3827196"
     CDS             complement(136799..137764)
                     /locus_tag="BAB2_0142"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418378.1"
                     /db_xref="GI:83269087"
                     /db_xref="GeneID:3827196"
                     /translation="MAKIVVTGGAGFLGSRLIRGLLASRGQNGVPSFDSIVSVDLVAC
                     SIDDPRITSVTGDIADPAFARSVITKGTVGVYHMAAALSGQSEAEFDVGMRVNIDGTR
                     ALLEAARATQEAPKFIFTSSLAVFGGEMPDVVPENLALLPQSSYGAEKAIGEFLVGDY
                     SRRGFIDGRICRLPTIVVRPGKPNSAASSFASGIIREPLAGIASNNPVPPATRMWLSS
                     PDIAARNLVHAITVEGSALGINRVLNLPGICVTVADMLDSLERIAGKDVRALVSAEPE
                     QRVIDIVCSWPGEFDIARPLALGFTRDADFDAVVRQYRDEFAHSS"
     misc_feature    complement(136808..137758)
                     /locus_tag="BAB2_0142"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(136835..137758)
                     /locus_tag="BAB2_0142"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(137237..137248,137315..137317,
                     137327..137329,137399..137407,137525..137533,
                     137645..137653,137726..137728,137732..137737,
                     137741..137743))
                     /locus_tag="BAB2_0142"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(137315..137317,137327..137329,
                     137399..137401,137474..137476))
                     /locus_tag="BAB2_0142"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(137764..138555)
                     /locus_tag="BAB2_0143"
                     /db_xref="GeneID:3827197"
     CDS             complement(137764..138555)
                     /locus_tag="BAB2_0143"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_418379.1"
                     /db_xref="GI:83269088"
                     /db_xref="GeneID:3827197"
                     /translation="MIPAERQALIVSRLSARGILSIAELAEMLGVSPMTVRRDIHSLE
                     EQGRALSVAGGVQLPERIFSEPSHIVKAALYHNEKAAIGQLAAQMIRSGTVIYLDAGT
                     TTLEIAYRLTDRQDLTVVTNDFVIAAFLSQESNCKLFHTGGEVERENQSCVGSAAGEA
                     IRRFNFDLAFISTSSFGARGVSTPSENKIAVKRAVVESAVRRVLVTDSSKYGLIGTFN
                     AIPLDVLSAVVTDAGLPENARETITQRGVELHLVEAGTGKVEGKI"
     misc_feature    complement(137797..138555)
                     /locus_tag="BAB2_0143"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    complement(138382..138540)
                     /locus_tag="BAB2_0143"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    complement(137857..138339)
                     /locus_tag="BAB2_0143"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(138552..139337)
                     /locus_tag="BAB2_0144"
                     /db_xref="GeneID:3827198"
     CDS             complement(138552..139337)
                     /locus_tag="BAB2_0144"
                     /EC_number="5.3.1.22"
                     /codon_start=1
                     /transl_table=11
                     /product="AP endonuclease"
                     /protein_id="YP_418380.1"
                     /db_xref="GI:83269089"
                     /db_xref="GeneID:3827198"
                     /translation="MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADV
                     IARELKQHNLTQVLFNMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTL
                     HAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEA
                     VGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGEL
                     NYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRDQSA"
     misc_feature    complement(138561..139337)
                     /locus_tag="BAB2_0144"
                     /note="Hydroxypyruvate isomerase [Carbohydrate transport
                     and metabolism]; Region: Hfi; COG3622"
                     /db_xref="CDD:226149"
     misc_feature    complement(138579..139334)
                     /locus_tag="BAB2_0144"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     gene            complement(139337..140611)
                     /locus_tag="BAB2_0145"
                     /db_xref="GeneID:3827199"
     CDS             complement(139337..140611)
                     /locus_tag="BAB2_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418381.1"
                     /db_xref="GI:83269090"
                     /db_xref="GeneID:3827199"
                     /translation="MRLGVIADDFTGATDIAGFLVGNGLRTIQLNGVPADDLAVDADA
                     VVISLKTRSCPTGQAIAESLAALKWLQKNNCQQFFFKYCSTFDSTPKGNIGPVTDALL
                     EALGEEFTVICPALPVNGRTIYNGYLFVNGVLLSETGMRNHPVTPMTDSNIMRVMESQ
                     SRGRAGNISSTIVDQGSDAVRDALRKLQSEGIRYAVLDALNDQHIETLGRAVSQMKLV
                     TGGSGLADGMARAWTQLRGKNVAAAEAAGAPVKGRTVILSGSCSQMTNAQVAAYKAKA
                     PALAMDVEKAINDAAYIDVLAEWVLAQSGDALPPLVYATMPPEALKAVQERFGGERAS
                     AAIEDLFGQLAKRLEAEGFTRFIVAGGETSGAVTQALAIDGFTIGPQIAPGVPWVRGI
                     GKPLSLALKSGNFGTEAFFFEAQKIANQEGDK"
     misc_feature    complement(139364..140611)
                     /locus_tag="BAB2_0145"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3395"
                     /db_xref="CDD:225930"
     gene            complement(140613..141296)
                     /locus_tag="BAB2_0146"
                     /pseudo
                     /db_xref="GeneID:3827200"
     misc_feature    complement(140613..141296)
                     /locus_tag="BAB2_0146"
                     /note="D-beta-hydroxybutyrate dehydrogenase"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12312.1"
     gene            141673..141810
                     /locus_tag="BAB2_0147"
                     /db_xref="GeneID:3827201"
     CDS             141673..141810
                     /locus_tag="BAB2_0147"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418382.1"
                     /db_xref="GI:83269091"
                     /db_xref="GeneID:3827201"
                     /translation="MQEIQTIKGSFRQLQIAACYERRLWNRAEVSLQSLCAETSIPVQ
                     A"
     gene            141887..142267
                     /gene="flgB"
                     /locus_tag="BAB2_0148"
                     /db_xref="GeneID:3828211"
     CDS             141887..142267
                     /gene="flgB"
                     /locus_tag="BAB2_0148"
                     /note="with FlgF and C makes up the proximal portion of
                     the flagellar basal body rod; Bradyrhizobium have one
                     thick flagellum and several thin flagella; the proteins in
                     this cluster are associated with the thin flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="YP_418383.1"
                     /db_xref="GI:83269092"
                     /db_xref="GeneID:3828211"
                     /translation="MSSIHLFDLAARQAQWLSVRQATVAGNVANADTPDFRARDVQPF
                     ADVLDKTQLTMTATSPLHLEAEADGIAATRLRPDDVTEQTHSGNTVDVEQEMMKAGEI
                     AREYSLNTSIVKAFHRMMLSVAKG"
     misc_feature    141887..142264
                     /gene="flgB"
                     /locus_tag="BAB2_0148"
                     /note="flagellar basal body rod protein FlgB; Reviewed;
                     Region: flgB; PRK06003"
                     /db_xref="CDD:168340"
     misc_feature    141929..142219
                     /gene="flgB"
                     /locus_tag="BAB2_0148"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     gene            142270..142692
                     /gene="flgC"
                     /locus_tag="BAB2_0149"
                     /db_xref="GeneID:3827202"
     CDS             142270..142692
                     /gene="flgC"
                     /locus_tag="BAB2_0149"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="YP_418384.1"
                     /db_xref="GI:83269093"
                     /db_xref="GeneID:3827202"
                     /translation="MSSDALQSTLKIAASGLSAQSTRLRIVSENIANAQSTARTADTD
                     PYRRKTVSFRTELEQGTGAAEVRVAEVGKDTSPFIEQYDPSHPAADARGYVKYPNVNM
                     VVEMADMREANRSYEANLQVVRQARELISMTIDLLRST"
     misc_feature    142273..142686
                     /gene="flgC"
                     /locus_tag="BAB2_0149"
                     /note="flagellar basal body rod protein FlgC; Reviewed;
                     Region: flgC; PRK12782"
                     /db_xref="CDD:139220"
     misc_feature    142297..>142371
                     /gene="flgC"
                     /locus_tag="BAB2_0149"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    <142540..142677
                     /gene="flgC"
                     /locus_tag="BAB2_0149"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            142692..143027
                     /gene="fliE"
                     /locus_tag="BAB2_0150"
                     /db_xref="GeneID:3828219"
     CDS             142692..143027
                     /gene="fliE"
                     /locus_tag="BAB2_0150"
                     /note="forms a junction between the M-ring and FlgB during
                     flagella biosynthesis; Bradyrhizobium has one thick
                     flagellum and several thin flagella; the protein in this
                     cluster is associated with the thin flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body protein FliE"
                     /protein_id="YP_418385.1"
                     /db_xref="GI:83269094"
                     /db_xref="GeneID:3828219"
                     /translation="MYDSIMSVSARNALSRLSETVAEKGVGSASAPQAVPAAPGASFG
                     EVLSQMTGSVSQKLQAAEATSIQGIKGDAPVRDVVSSVMEAEQSLQTAIAIRDKIVQA
                     YLEISRMPI"
     misc_feature    142692..143024
                     /gene="fliE"
                     /locus_tag="BAB2_0150"
                     /note="flagellar hook-basal body protein FliE; Reviewed;
                     Region: fliE; PRK00790"
                     /db_xref="CDD:179126"
     gene            143113..143901
                     /gene="flgG"
                     /locus_tag="BAB2_0151"
                     /db_xref="GeneID:3828213"
     CDS             143113..143901
                     /gene="flgG"
                     /locus_tag="BAB2_0151"
                     /note="makes up the distal portion of the flagellar basal
                     body rod; Bradyrhizobium has one thick flagellum and
                     several thin flagella; the Bradyrhizobium protein in this
                     cluster is associated with the thick flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgG"
                     /protein_id="YP_418386.1"
                     /db_xref="GI:83269095"
                     /db_xref="GeneID:3828213"
                     /translation="MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLL
                     YQSERTAGVPNQANQAIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGW
                     FQIQSPTGETLYTRAGAFNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAK
                     LQDQINQVDLGQLTLANFTNEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGY
                     LEASNVDPVKEITDLITAQRAYEMNSKVIQAADEMAATVSKNLR"
     misc_feature    143113..143898
                     /gene="flgG"
                     /locus_tag="BAB2_0151"
                     /note="flagellar basal body rod protein FlgG; Reviewed;
                     Region: flgG; PRK12691"
                     /db_xref="CDD:183686"
     misc_feature    143122..143214
                     /gene="flgG"
                     /locus_tag="BAB2_0151"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    143656..143889
                     /gene="flgG"
                     /locus_tag="BAB2_0151"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            143913..144395
                     /gene="flgA"
                     /locus_tag="BAB2_0152"
                     /db_xref="GeneID:3827802"
     CDS             143913..144395
                     /gene="flgA"
                     /locus_tag="BAB2_0152"
                     /note="required for the assembly of the flagellar basal
                     body P-ring; Bradyrhizobium japonicum has two types of
                     flagella, a single thick flagella and a few thin flagella;
                     the protein in this cluster is associated with the thin
                     flagella"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring biosynthesis protein
                     FlgA"
                     /protein_id="YP_418387.1"
                     /db_xref="GI:83269096"
                     /db_xref="GeneID:3827802"
                     /translation="MDRVKAIFQTARLALAGGFLLAAMAGAGAADRIAFVVPSATVYP
                     GQIVSDTALLEKQFFINAPAATQYVLSLDQAVGKVARKTLLPGKPILVSALGEPSLVT
                     RGIPAPLVFTAGTLTITAMGTPLESGVAGDFIKVRNVDSGIIVSGTVLANGRIQVGMQ
                     "
     misc_feature    144018..144197
                     /gene="flgA"
                     /locus_tag="BAB2_0152"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     misc_feature    <144117..144386
                     /gene="flgA"
                     /locus_tag="BAB2_0152"
                     /note="Domains similar to fish antifreeze type III
                     protein; Region: SAF; cl00555"
                     /db_xref="CDD:260496"
     gene            144392..145396
                     /gene="flgI"
                     /locus_tag="BAB2_0153"
                     /pseudo
                     /db_xref="GeneID:3828215"
     misc_feature    144392..145396
                     /gene="flgI"
                     /locus_tag="BAB2_0153"
                     /note="Flagellar P-ring protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12319.1"
     gene            145421..145765
                     /gene="flgI"
                     /locus_tag="BAB2_0154"
                     /pseudo
                     /db_xref="GeneID:3828216"
     misc_feature    145421..145765
                     /gene="flgI"
                     /locus_tag="BAB2_0154"
                     /note="Flagellar P-ring protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12320.1"
     gene            145762..146322
                     /locus_tag="BAB2_0155"
                     /db_xref="GeneID:3827803"
     CDS             145762..146322
                     /locus_tag="BAB2_0155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418388.1"
                     /db_xref="GI:83269097"
                     /db_xref="GeneID:3827803"
                     /translation="MIMAHKMIRYGSAVALFLAASVPAFADPPALGNLDEIRKFCGNI
                     DDQAADARYALQAKQLTELKADVEERMRALEEKRREYELWLKRRDEFVSKAQDALVDI
                     ISKMKPDAAAAQMALIGDEAAAALILKLNPRVSSIILNEMPPEKAAKLARVIVGSQRT
                     SSAAQPVKDQSGRDQRAAAQTGNTVQ"
     misc_feature    145765..146256
                     /locus_tag="BAB2_0155"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3334"
                     /db_xref="CDD:225871"
     gene            146319..147047
                     /gene="flgH"
                     /locus_tag="BAB2_0156"
                     /db_xref="GeneID:3828214"
     CDS             146319..147047
                     /gene="flgH"
                     /locus_tag="BAB2_0156"
                     /note="part of the flagellar basal body which consists of
                     four rings L,P, S and M mounted on a central rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body L-ring protein"
                     /protein_id="YP_418389.1"
                     /db_xref="GI:83269098"
                     /db_xref="GeneID:3828214"
                     /translation="MKNSMNKAILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQ
                     NNPQFNGYPARPGKASYSLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDR
                     ERVSKGIYGGGGSFATSSITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAA
                     IVTDTLPNGNLIIRGSQEVRVNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYG
                     GRGRLSEIQQPPYGQQILDQFSPF"
     misc_feature    146352..147044
                     /gene="flgH"
                     /locus_tag="BAB2_0156"
                     /note="flagellar basal body L-ring protein; Reviewed;
                     Region: flgH; PRK00249"
                     /db_xref="CDD:234700"
     gene            147060..147551
                     /locus_tag="BAB2_0157"
                     /db_xref="GeneID:3827804"
     CDS             147060..147551
                     /locus_tag="BAB2_0157"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body-associated protein FliL"
                     /protein_id="YP_418390.1"
                     /db_xref="GI:83269099"
                     /db_xref="GeneID:3827804"
                     /translation="MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMISAG
                     QQASAKPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHE
                     IPPAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISAL
                     VVE"
     misc_feature    147060..>147302
                     /locus_tag="BAB2_0157"
                     /note="Flagellar basal body-associated protein FliL;
                     Region: FliL; cl00681"
                     /db_xref="CDD:260568"
     misc_feature    147264..147545
                     /locus_tag="BAB2_0157"
                     /note="Flagellar basal body-associated protein FliL;
                     Region: FliL; pfam03748"
                     /db_xref="CDD:252145"
     gene            147548..148288
                     /gene="fliP"
                     /locus_tag="BAB2_0158"
                     /db_xref="GeneID:3828222"
     CDS             147548..148288
                     /gene="fliP"
                     /locus_tag="BAB2_0158"
                     /note="FliP, with proteins FliQ and FliR, forms the core
                     of the central channel in the flagella export apparatus"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="YP_418391.1"
                     /db_xref="GI:83269100"
                     /db_xref="GeneID:3828222"
                     /translation="MKHSLGLGVILTLALTVSAQAQQALPLDKLLPAGSGAASGQIVQ
                     LFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALFMTFYVM
                     APAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLCLFEDLADPSFR
                     TSDDGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTV
                     ISLPFKILFFVLIDGWNILVGSLIRSFS"
     misc_feature    147557..148285
                     /gene="fliP"
                     /locus_tag="BAB2_0158"
                     /note="FliP family; Region: FliP; cl00593"
                     /db_xref="CDD:260517"
     gene            148383..148877
                     /locus_tag="BAB2_0159"
                     /db_xref="GeneID:3827805"
     CDS             148383..148877
                     /locus_tag="BAB2_0159"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418392.1"
                     /db_xref="GI:83269101"
                     /db_xref="GeneID:3827805"
                     /translation="MVPAVLLKQESLYLLQVSFDNSSADITAKQYTKRHYMDFPAWTW
                     WAVAIGLFLLIEALMAIWYIRRLSRQRVETTAALKEVQHTGEPGSALVLEATDTGKRL
                     GAYSFLGVRLRLRVTRANGEEFETAIDAHISPVRIADFAEGKHIKVSIDPHARTVVLN
                     QPIQ"
     misc_feature    148500..>148667
                     /locus_tag="BAB2_0159"
                     /note="Domain of unknown function (DUF4381); Region:
                     DUF4381; pfam14316"
                     /db_xref="CDD:258491"
     gene            148890..149306
                     /locus_tag="BAB2_0160"
                     /db_xref="GeneID:3827806"
     CDS             148890..149306
                     /locus_tag="BAB2_0160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418393.1"
                     /db_xref="GI:83269102"
                     /db_xref="GeneID:3827806"
                     /translation="MLAACGKPMNIMALISILHLSSGGVALAADTGRIIIRNDLAACV
                     DMRVEKPPFEYPNGSNIVAINANFKLRKPIGACGCMSALARYASSVNERESRLFLQQG
                     LFNLKKSDTKTLPLATEPALVKDGNIEITVGCARPR"
     misc_feature    148929..149303
                     /locus_tag="BAB2_0160"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4893"
                     /db_xref="CDD:227230"
     gene            complement(149502..150386)
                     /locus_tag="BAB2_0161"
                     /db_xref="GeneID:3827807"
     CDS             complement(149502..150386)
                     /locus_tag="BAB2_0161"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_418394.1"
                     /db_xref="GI:83269103"
                     /db_xref="GeneID:3827807"
                     /translation="MRFDVTDLRLFVSIAETGSITHGAAMVNMALGAASARVRGMEEL
                     AGVALLNRERLGVSITPAGRALLQHGRIVLQQLGRMHSELDEFAHGLKGHVRLFSNTN
                     ALAEFLPVALSSFLMDNPGVNIDLQEHLSDEIVRSVVEGIADIGIVAGTVDVASLETF
                     PFREDYLVVVVPQGHPFARRRRIAFKDTLDYDFIGLSQGAALQNFLSAHAMRMGQRLR
                     LRVQLRSFDSICQMVESRAGIAIVPASAAKRLRRIMAIRIIALDDAWALRRLTICVRS
                     LQDLPAHAARLVEHLRQT"
     misc_feature    complement(149508..150380)
                     /locus_tag="BAB2_0161"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(150195..150368)
                     /locus_tag="BAB2_0161"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(149514..150107)
                     /locus_tag="BAB2_0161"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator,
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_LTTR_like_1; cd08421"
                     /db_xref="CDD:176113"
     misc_feature    complement(order(149682..149687,149691..149696,
                     149712..149729,150003..150023,150027..150029,
                     150039..150041,150048..150053,150057..150062))
                     /locus_tag="BAB2_0161"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176113"
     gene            150566..151783
                     /locus_tag="BAB2_0162"
                     /db_xref="GeneID:3827808"
     CDS             150566..151783
                     /locus_tag="BAB2_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_418395.1"
                     /db_xref="GI:83269104"
                     /db_xref="GeneID:3827808"
                     /translation="MTAPFSVQPPESALRPLDGITVVSLEHAIAAPFATRQLADLGAR
                     VIKVERPGVGDFARAYDDRVNGMASHFVWCNRSKESLAIDLKHPDARGILHDLVSKAD
                     VLVQNLAPGAAARLGLSAEALRADCPHLIVCDISGYGSDGPYRDRKAYDLLIQSEAGF
                     LSVTGTPDEQAKAGISIADIAAGMYAYSGILSALLMRERTGQGSHIEVSMLEALGEWM
                     GFPLYYTYGGKEPPPRTGASHATIFPYGPFPTGDGKTVMLGLQNEREWAIFCEKVLHQ
                     PALAQDERFVSNVLRVRNRDALTEIIVASFAASNAEAITMQLDEAGIANARVRTMAEV
                     WDHPQLQARGRWTEITTPAGQVPALLPPAFPNGMEPRMDPVPALGAHNISILTELGLD
                     EAQIAALREAGAI"
     misc_feature    150593..151780
                     /locus_tag="BAB2_0162"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            151851..152687
                     /locus_tag="BAB2_0163"
                     /db_xref="GeneID:3827809"
     CDS             151851..152687
                     /locus_tag="BAB2_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418396.1"
                     /db_xref="GI:83269105"
                     /db_xref="GeneID:3827809"
                     /translation="MELNIEQLRSWIGREETRHELVTPSLVERFNATFDHEGDTANDA
                     VAPLLIHLCLTQPAALTSRLGPDGHPARGGFLPPVPLPRRMWAGGAFTFRDDIRVGDI
                     VTRTSRIQDVVVKEGRTGTLCFVTVGHEFHSNGRHAVTERQDIVYRGADMSNPAAKTQ
                     PAVPHGPHCRFITPSAPLLFRYSALTFNGHRIHYDAPYVRNVENYPGLIVHGPMQATM
                     LVRFATEIRGKPPVRFDFRSLSPLFDDADFTLNAIDDGEGLKLWTSYANGPVAMEARA
                     LW"
     misc_feature    151857..152684
                     /locus_tag="BAB2_0163"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3777"
                     /db_xref="CDD:226300"
     misc_feature    151878..152270
                     /locus_tag="BAB2_0163"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    152364..152678
                     /locus_tag="BAB2_0163"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    order(152481..152486,152562..152573)
                     /locus_tag="BAB2_0163"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(152499..152501,152508..152513,152520..152522,
                     152544..152546)
                     /locus_tag="BAB2_0163"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            152681..153505
                     /locus_tag="BAB2_0164"
                     /db_xref="GeneID:3827810"
     CDS             152681..153505
                     /locus_tag="BAB2_0164"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase subunit beta"
                     /protein_id="YP_418397.1"
                     /db_xref="GI:83269106"
                     /db_xref="GeneID:3827810"
                     /translation="MVSIASIRAPLFVPADRPDRFSKAAASGTDCVILDLEDAVAPKA
                     KDAARAALDTSFTDLPVMVRINPHGTPWHEADMAAVARLDVAGVILPKAETAERIEAA
                     ARMLDLPLIALVETARGLANARSIAAASGVVRLAFGSIDFCADLACAHMREILLPARV
                     ELVMASRLAGIAAPIDGVTPGFNDPVMCHQDAAHARALGMMGKLCIHPRQISEVLRAF
                     AWSDQEIDWARRVLASGEGAISIDGMMVDEPVRIRARTILEQADIGAAPVLTKPTG"
     misc_feature    152705..153484
                     /locus_tag="BAB2_0164"
                     /note="Citrate lyase beta subunit [Carbohydrate transport
                     and metabolism]; Region: CitE; COG2301"
                     /db_xref="CDD:225184"
     gene            153955..154533
                     /locus_tag="BAB2_0165"
                     /db_xref="GeneID:3827811"
     CDS             153955..154533
                     /locus_tag="BAB2_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-dependent hydrogenase b-type cytochrome
                     subunit"
                     /protein_id="YP_418398.1"
                     /db_xref="GI:83269107"
                     /db_xref="GeneID:3827811"
                     /translation="MTQSKAIFDSPIGYGVVSRVLHWAMALMFAWQFTSAILHYFAKG
                     SAIFKFFWAAHFQLGFALLLLVLLRGVWGLINCNRRPRAESSGGRIVALGHGLIYILM
                     IAVPTVAMLRSYNSGRGFSFLGMEIFAKTAVQNPAGGAPAAAVNAGLSLHGLLGWILL
                     AVVIAHILLALAHHFIMQDNTLRYMTGRRAVS"
     misc_feature    153973..154524
                     /locus_tag="BAB2_0165"
                     /note="Cytochrome B561 [Energy production and conversion];
                     Region: CybB; COG3038"
                     /db_xref="CDD:225580"
     gene            155202..155375
                     /locus_tag="BAB2_0166"
                     /pseudo
                     /db_xref="GeneID:3827812"
     misc_feature    155202..155375
                     /locus_tag="BAB2_0166"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12332.1"
     gene            155931..161798
                     /locus_tag="BAB2_0167"
                     /pseudo
                     /db_xref="GeneID:3827813"
     misc_feature    155931..161798
                     /locus_tag="BAB2_0167"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12333.1"
     gene            161690..162337
                     /locus_tag="BAB2_0168"
                     /pseudo
                     /db_xref="GeneID:3827814"
     misc_feature    161690..162337
                     /locus_tag="BAB2_0168"
                     /note="Autotransporter beta-domain"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12334.1"
     gene            162573..162968
                     /gene="cycA"
                     /locus_tag="BAB2_0169"
                     /db_xref="GeneID:3828140"
     CDS             162573..162968
                     /gene="cycA"
                     /locus_tag="BAB2_0169"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c heme-binding domain-containing
                     protein"
                     /protein_id="YP_418399.1"
                     /db_xref="GI:83269108"
                     /db_xref="GeneID:3828140"
                     /translation="MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGE
                     GAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKM
                     VYAGLKDEGKIDDLIAFLKQYDLGGKIKE"
     misc_feature    162579..162956
                     /gene="cycA"
                     /locus_tag="BAB2_0169"
                     /note="Cytochrome c2 [Energy production and conversion];
                     Region: COG3474"
                     /db_xref="CDD:226005"
     gene            complement(163192..163431)
                     /locus_tag="BAB2_0170"
                     /db_xref="GeneID:3827815"
     CDS             complement(163192..163431)
                     /locus_tag="BAB2_0170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418400.1"
                     /db_xref="GI:83269109"
                     /db_xref="GeneID:3827815"
                     /translation="MSNTPHTLGEEFPGQLEAIHALKAKDAHFARILEESDSVNDLIH
                     RAETNIQPVSQEEETNLRKQRLALKDKIASALAAA"
     misc_feature    complement(163195..163410)
                     /locus_tag="BAB2_0170"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2841"
                     /db_xref="CDD:225397"
     gene            163861..163998
                     /locus_tag="BAB2_0171"
                     /db_xref="GeneID:3827816"
     CDS             163861..163998
                     /locus_tag="BAB2_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418401.1"
                     /db_xref="GI:83269110"
                     /db_xref="GeneID:3827816"
                     /translation="MTAKNATLLTVLMVSAIVFMAVGIFTVDAGNQTAPTDGYGISSA
                     H"
     gene            complement(164076..164888)
                     /locus_tag="BAB2_0172"
                     /db_xref="GeneID:3827817"
     CDS             complement(164076..164888)
                     /locus_tag="BAB2_0172"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418402.1"
                     /db_xref="GI:83269111"
                     /db_xref="GeneID:3827817"
                     /translation="MADTVFSRIQASRTADDVVHQIESLILEGVLRGGDRLPGERELA
                     RQFDISRPILRDALKRLETAGLLTSRHGGGTFVADVIGQVFSAPVVKLFADHHKATAD
                     YLEYRREIESVAAEYAALRATPADRALLTEIMNAMEKAHGADDFATEARLDVELHNAI
                     GEAAHNIVLLHTLRSCYQLLKDGVFYNRSVIYNHPGVADVFLSQHRAIYDAVMAGNPQ
                     AAREAVQKHIRFVEQATHDRALNDERERVARLRYRQRAGSKELKEIREDESE"
     misc_feature    complement(164121..164873)
                     /locus_tag="BAB2_0172"
                     /note="transcriptional regulator PdhR; Reviewed; Region:
                     pdhR; PRK09464"
                     /db_xref="CDD:181879"
     misc_feature    complement(164655..164846)
                     /locus_tag="BAB2_0172"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(164664..164675,164679..164684,
                     164712..164714,164721..164726,164730..164744,
                     164766..164771,164775..164777,164844..164846))
                     /locus_tag="BAB2_0172"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(164202..164585)
                     /locus_tag="BAB2_0172"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(165010..165930)
                     /locus_tag="BAB2_0173"
                     /db_xref="GeneID:3827818"
     CDS             complement(165010..165930)
                     /locus_tag="BAB2_0173"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_418403.1"
                     /db_xref="GI:83269112"
                     /db_xref="GeneID:3827818"
                     /translation="MMSSLADMEIFARVVATGSMSAAARDLGLSPAVVSKRLGRLEER
                     LGTSLLQCTTRQIALTEAGQGYHERVLAILANIEEAEAFVARRSADARGTLKISAPTT
                     FGRMHIAPYLVPFMRANADLTVNMQLSDEMVDIVGDGYDLAIRIGELSDSTLVARRLA
                     PVRRIFVAAPRYLKERGTPQTIEDLQDHICLAPHNNDPWRLEGPKGPIVIRPTGPLQT
                     NSSEIVREAVLAGLGIAQRSTWDVGPELAAGKLVQVLPDYAASRNVAIHAVYPSKQFL
                     PAKVRLFIDYLADLYGPVPYWESGTFPEEN"
     misc_feature    complement(165739..165918)
                     /locus_tag="BAB2_0173"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(165067..165912)
                     /locus_tag="BAB2_0173"
                     /note="transcriptional activator TtdR; Provisional;
                     Region: PRK09801"
                     /db_xref="CDD:182085"
     misc_feature    complement(165070..165654)
                     /locus_tag="BAB2_0173"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(165133..165135,165217..165219,
                     165268..165270,165445..165447,165451..165453,
                     165493..165495,165610..165612,165622..165624))
                     /locus_tag="BAB2_0173"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(165241..165243,165250..165255,
                     165274..165288,165364..165366,165547..165567,
                     165571..165573,165583..165585,165592..165597,
                     165601..165606,165616..165621))
                     /locus_tag="BAB2_0173"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            166281..167777
                     /locus_tag="BAB2_0174"
                     /db_xref="GeneID:3827819"
     CDS             166281..167777
                     /locus_tag="BAB2_0174"
                     /EC_number="1.1.3.15"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_418404.1"
                     /db_xref="GI:83269113"
                     /db_xref="GeneID:3827819"
                     /translation="MSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFE
                     TDGLTAHRQLPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVL
                     LVMSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGNVA
                     ENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSEGLLGV
                     VTEITVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAED
                     FVRVGYPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWA
                     GRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLH
                     PLILYDANNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLD
                     QQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF"
     misc_feature    166329..167774
                     /locus_tag="BAB2_0174"
                     /note="glycolate oxidase subunit GlcD; Provisional;
                     Region: PRK11230"
                     /db_xref="CDD:183043"
     misc_feature    166443..166862
                     /locus_tag="BAB2_0174"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    166965..167690
                     /locus_tag="BAB2_0174"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            167793..169025
                     /gene="glcE"
                     /locus_tag="BAB2_0175"
                     /db_xref="GeneID:3828235"
     CDS             167793..169025
                     /gene="glcE"
                     /locus_tag="BAB2_0175"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase"
                     /protein_id="YP_418405.1"
                     /db_xref="GI:83269114"
                     /db_xref="GeneID:3828235"
                     /translation="MSDANILKPQDEAGVLEMVQAALASSTPLEIIGHGSKRGIGRPV
                     EAGHVLDVSGLSGVTLYEPDELVLSARAGTPMAEIQKLLADHNQCFHFEPMDYGPLLG
                     AEPGRGTIGGTLAANLAGPRRLKAGAARDHVLGVRVVSGRGEVFKSGGRVVKNVTGYD
                     LSKGMANSWGTLGVATEVTFKVLPAPETVATLAVRGLDDEQAARVMALAMGSREEVSS
                     AAHLPPTVAWRFLDGKLGGDAATILRLEGFAPSVAHRSRQLQDLLGRTGTIDVLDDSQ
                     SRQLWREVRDVLPYAQAGDGRAVWRVSMAPMQGWRMVDEFRRHAGVDAYYDWQGGLIW
                     MRMEAEPEADVLRKLIARHGGGHATLIRAPERVRGSVDVFQQQPAALAALSARLKQQF
                     DPENILNPGRMYPHQAGA"
     misc_feature    167808..168239
                     /gene="glcE"
                     /locus_tag="BAB2_0175"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    167823..169007
                     /gene="glcE"
                     /locus_tag="BAB2_0175"
                     /note="glycolate oxidase FAD binding subunit; Provisional;
                     Region: glcE; PRK11282"
                     /db_xref="CDD:236893"
     misc_feature    168348..169001
                     /gene="glcE"
                     /locus_tag="BAB2_0175"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            169030..170331
                     /gene="glcF"
                     /locus_tag="BAB2_0176"
                     /db_xref="GeneID:3828236"
     CDS             169030..170331
                     /gene="glcF"
                     /locus_tag="BAB2_0176"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_418406.1"
                     /db_xref="GI:83269115"
                     /db_xref="GeneID:3828236"
                     /translation="MQTHFSPEQLRDPGVLEAEKILRKCVHCGFCTATCPTYVTLGNE
                     LDSPRGRIYLIKDMLENGRPADEEIVRHVDRCLSCLACMTTCPSGVNYMHLVDHARAH
                     IEKTYKRPFMNRLLRSVLAQVLPYPARFRLALKLAKLGKPFASLFRKSPVLRPVAAML
                     DLAPQSLPAMPAATNAVRGEKRGRVAILNGCAQPVLNPGINAATLRLLNRFDIEVATP
                     KGEGCCGSLVHHMGREEQALEQARHNVDVWTREIETGGLDAIIVTASGCGTTIKDYGY
                     MLRLDPAYKDKAARVSALAKDITEYLATLELPEPDAPKTLTVAYHSACSMQHGQKIVR
                     EPKDLLVKAGFTVKEPLEGHLCCGSAGTYNIMQPEIATKLRDRKVKNIEATGAALIAT
                     GNIGCMTQMATGSDLPIVHTVELIDWAYGGPTPQALEKAGA"
     misc_feature    169030..170280
                     /gene="glcF"
                     /locus_tag="BAB2_0176"
                     /note="glycolate oxidase iron-sulfur subunit; Provisional;
                     Region: glcF; PRK11274"
                     /db_xref="CDD:236890"
     misc_feature    169093..169299
                     /gene="glcF"
                     /locus_tag="BAB2_0176"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    169582..169845
                     /gene="glcF"
                     /locus_tag="BAB2_0176"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    169981..170232
                     /gene="glcF"
                     /locus_tag="BAB2_0176"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            complement(170554..171438)
                     /locus_tag="BAB2_0177"
                     /db_xref="GeneID:3827820"
     CDS             complement(170554..171438)
                     /locus_tag="BAB2_0177"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="YP_418407.1"
                     /db_xref="GI:83269116"
                     /db_xref="GeneID:3827820"
                     /translation="MWWPAPRKTAQKISGKGYIMTVPTVKLNDGNHIPQLGYGVWQIS
                     NDEAVSAVSEALKAGYRHIDTATIYGNEEGVGKAINGSGIARADIFLTTKLWNSDQGY
                     ESTLKAFDTSLKKLGTDYVDLYLIHWPMPSKDLFMETWRAFIKLKEEGRVKSIGVSNF
                     RTADLERLIKESGVTPVLNQIELHPQFQQDELRLFHGKHDIATEAWSPLGQGKLLEDP
                     TLKSIAEKHAKSVAQIILRWHIETGNIVIPKSITPARIKENFDIFDFTLNGTDHDAIT
                     KLDMADGRIGPNPSVFSA"
     misc_feature    complement(170605..171369)
                     /locus_tag="BAB2_0177"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(170662..170667,170674..170676,
                     170689..170700,170743..170745,170806..170823,
                     170899..170901,170962..170967,171055..171060,
                     171157..171159,171232..171234,171247..171249,
                     171316..171324))
                     /locus_tag="BAB2_0177"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(171058..171060,171157..171159,
                     171232..171234,171247..171249))
                     /locus_tag="BAB2_0177"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(171707..172390)
                     /locus_tag="BAB2_0178"
                     /pseudo
                     /db_xref="GeneID:3827821"
     misc_feature    complement(171707..172390)
                     /locus_tag="BAB2_0178"
                     /note="ErfK/YbiS/YcfS/YnhG"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12344.1"
     gene            172630..173286
                     /gene="tag"
                     /locus_tag="BAB2_0179"
                     /db_xref="GeneID:3827782"
     CDS             172630..173286
                     /gene="tag"
                     /locus_tag="BAB2_0179"
                     /EC_number="3.2.2.20"
                     /codon_start=1
                     /transl_table=11
                     /product="methyladenine glycosylase"
                     /protein_id="YP_418408.1"
                     /db_xref="GI:83269117"
                     /db_xref="GeneID:3827782"
                     /translation="MSDMAEARAGLVVGADGRTRCFWPGELPDYLAYHDNEWGVPVAD
                     DFRLFEKICLEGFQSGLSWLTILRKRENFRAAFDGFNFHRIATYDESDVERLLADKGI
                     VRHRGKIVSVINNAGRAIELIEEKGSLAAYFWSFEPGAENRPAVVDYPTLVANPITAT
                     STRISKDLKKRGWSFVGPTTVYAFMQAMGLVNDHIEGCHCRATIEKLRQNFKRPGKKL
                     "
     misc_feature    172681..173247
                     /gene="tag"
                     /locus_tag="BAB2_0179"
                     /note="3-methyladenine DNA glycosylase [DNA replication,
                     recombination, and repair]; Region: Tag; COG2818"
                     /db_xref="CDD:225374"
     gene            173405..174022
                     /locus_tag="BAB2_0180"
                     /db_xref="GeneID:3827673"
     CDS             173405..174022
                     /locus_tag="BAB2_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine exporter protein LysE/YggA"
                     /protein_id="YP_418409.1"
                     /db_xref="GI:83269118"
                     /db_xref="GeneID:3827673"
                     /translation="MDLMSLVAFAGILVVAAGTPGPKVGALVARVISRGHKGVFPFMF
                     GLWLGDAVWLSLAVWGLSALAHTFQTAFLVLKYAGVAYLIYLSWKMWFAPVDEEADEN
                     TIPRQGEGKRLFLSALGVTLGNPKIMVFYLAILPTVVDITHVSLTGWVELLLVMFMVL
                     AAVDTAWVVLAAQARKFLRSPRMMRLANRTSAGMMAGAAVAIAAR"
     misc_feature    173405..173977
                     /locus_tag="BAB2_0180"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            174133..175641
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /db_xref="GeneID:3827165"
     CDS             174133..175641
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /EC_number="6.1.1.21"
                     /note="catalyzes a two-step reaction, first charging a
                     histidine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; class II aminoacyl-tRNA
                     synthetase; forms homodimers; some organisms have a
                     paralogous gene, hisZ, that is similar to hisS and
                     produces a protein that performs the first step in
                     histidine biosynthesis along with HisG"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="YP_418410.1"
                     /db_xref="GI:83269119"
                     /db_xref="GeneID:3827165"
                     /translation="MADKADKMKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFE
                     PVETPLVEYTDALGKFLPDQDRPNEGVFSFQDDDEQWLSLRYDLTAPLARYVAENFET
                     LPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDADTVGAPNVSADAEMCMMMADTLERLG
                     IQRGDYAIRVNNRKVLDGVLDAIGLEGEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGK
                     GRLDESGDFTKGAQLPEAAIEKVLAFTAAGGADGAQTIANLQAVVAGNAKGEEGVQEL
                     ADMQALFFAGGYEGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGG
                     GRYDGLVSRFRGEPVPATGFSIGVSRLMTALKNLGKLDVSDTVGPVVVLVMDKDTQNL
                     GRYQKMVSDLRKAGIRAEMYVGGSGMKAQMKYADRRAAPCVVIQGSQEREAGEVQIKD
                     LVEGKRLSAEIEDNVTWLESRPAQITVREDGLVDAVREILDAQARDRAEQSK"
     misc_feature    174151..175572
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="Histidyl-tRNA synthetase [Translation, ribosomal
                     structure and biogenesis]; Region: HisS; COG0124"
                     /db_xref="CDD:223202"
     misc_feature    174199..175230
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(174214..174216,174250..174252,174265..174285,
                     174352..174357,174391..174393,174397..174399,
                     174412..174417,174424..174429,174511..174516,
                     174535..174537,174559..174561,174571..174573,
                     174580..174582,175099..175101,175189..175194)
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    174259..174285
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(174391..174393,174397..174399,174481..174483,
                     174487..174489,174508..174510,174517..174519,
                     174523..174525,174535..174537,175030..175032,
                     175036..175038,175042..175047,175099..175101,
                     175192..175194,175201..175203,175210..175212)
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    174478..174492
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(175189..175203,175210..175212)
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     misc_feature    175267..175593
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="HisRS Histidyl-anticodon binding domain. HisRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     HisRS_anticodon; cd00859"
                     /db_xref="CDD:238436"
     misc_feature    order(175285..175290,175399..175401,175417..175419,
                     175441..175443,175471..175473,175477..175479)
                     /gene="hisS"
                     /locus_tag="BAB2_0181"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238436"
     gene            175650..176780
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /db_xref="GeneID:3827674"
     CDS             175650..176780
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="May allow the feedback regulation of ATP
                     phosphoribosyltransferase activity by histidine"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase regulatory
                     subunit"
                     /protein_id="YP_418411.1"
                     /db_xref="GI:83269120"
                     /db_xref="GeneID:3827674"
                     /translation="MVGSRTSPIFNALRVELNAREAELVEIPLIQPADPFLDMAGEDL
                     RRRIFLTENENGDSLCLRPEFTIPVCRNHIALNAATPKRYAYLGEVFRQRRDGAAEFL
                     QAGIEDLGAADEAASDARSLADALSCVKAIAPDAPLEIVLGDQSVFAGMLKALGLPQG
                     WRKKLLRSFGDAHSMDLALAELTGTQRRDPLPESLAVLVAEGDEIGLARMLEAEMLEA
                     GISPGAGRTPVEIARRLIEKEDLAATHFPAAALDLLRQFLAIRVSLDMAAVTLRAFAA
                     DNALDLGAVLQKFEARADAIAQAGIEMKDIIYDASFGRPLDYYTGLVYEIRDASNRQD
                     GVLAGGGRYDRLLTMLGACEAIPGVGFSIWLDRLQALAGEKQ"
     misc_feature    175650..176777
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="ATP phosphoribosyltransferase involved in histidine
                     biosynthesis [Amino acid transport and metabolism];
                     Region: HisZ; COG3705"
                     /db_xref="CDD:226228"
     misc_feature    175650..176771
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="ATP phosphoribosyltransferase regulatory subunit;
                     Provisional; Region: hisZ; PRK12295"
                     /db_xref="CDD:183413"
     misc_feature    175713..175727
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="motif 1; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(175716..175721,175725..175727,175860..175865,
                     175920..175922,175926..175928,176025..176027)
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(175839..175841,175845..175847,175923..175925,
                     175950..175952,175956..175958,175962..175970,
                     176655..176660,176670..176672,176727..176732,
                     176736..176741,176748..176750)
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="active site"
                     /db_xref="CDD:238391"
     misc_feature    175920..175928
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="motif 2; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(176739..176741,176748..176750)
                     /gene="hisZ"
                     /locus_tag="BAB2_0182"
                     /note="motif 3; other site"
                     /db_xref="CDD:238391"
     gene            176777..177472
                     /gene="hisG"
                     /locus_tag="BAB2_0183"
                     /db_xref="GeneID:3827675"
     CDS             176777..177472
                     /gene="hisG"
                     /locus_tag="BAB2_0183"
                     /EC_number="2.4.2.17"
                     /note="short form of enzyme; requires HisZ for function;
                     catalyzes the formation of N'-5'-phosphoribosyl-ATP from
                     phosphoribosyl pyrophosphate; crucial role in histidine
                     biosynthesis; forms heteromultimer of HisG and HisZ"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase catalytic subunit"
                     /protein_id="YP_418412.1"
                     /db_xref="GI:83269121"
                     /db_xref="GeneID:3827675"
                     /translation="MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEGE
                     DDLDILFLSASEIARELGYGSVDLGVTGEDLVRETLAHADERVAIEAQLGFGHADVVV
                     AVPEVWRDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVES
                     LGATEGAPAAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTSRRV
                     EEIAARIRAGLEI"
     misc_feature    176777..>177466
                     /gene="hisG"
                     /locus_tag="BAB2_0183"
                     /note="ATP phosphoribosyltransferase [Amino acid transport
                     and metabolism]; Region: HisG; COG0040"
                     /db_xref="CDD:223118"
     misc_feature    176777..177454
                     /gene="hisG"
                     /locus_tag="BAB2_0183"
                     /note="ATP phosphoribosyltransferase catalytic subunit;
                     Provisional; Region: hisG; PRK13583"
                     /db_xref="CDD:237438"
     gene            complement(177545..178783)
                     /locus_tag="BAB2_0184"
                     /db_xref="GeneID:3827676"
     CDS             complement(177545..178783)
                     /locus_tag="BAB2_0184"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/galactose transporter"
                     /protein_id="YP_418413.1"
                     /db_xref="GI:83269122"
                     /db_xref="GeneID:3827676"
                     /translation="MATSIPTNNPLHTETSSQKNYGFALTSLTLLFFMWGFITCLNDI
                     LIPHLKNVFQLNYTQSMLIQFCFFGAYFIVSLPAGQLVKRISYKRGIVVGLIVAAIGC
                     ALFIPAASYRVYALFLGALFVLASGVTILQVAANPYVTILGKPETAASRLTLTQAFNS
                     LGTTVAPVFGAVLILSAATDATVNAEADAVRFPYLLLALAFTVLAIIFAILKPPDVQE
                     DEPALSDKKEGSAWQYRHLVLGAIGIFVYVGAEVSVGSFLVNFLSDPTVAGLSETDAA
                     HHVAYFWGGAMVGRFIGSAAMRYIDDGKALAFNAFVAIILLFITVATTGHIAMWSVLA
                     IGLFNSIMFPTIFSLALHGLGSHTSQGSGILCLAIVGGAIVPLIQGALADAIGIHLAF
                     LMPIICYAYIAFYGLIGSKS"
     misc_feature    complement(177548..178753)
                     /locus_tag="BAB2_0184"
                     /note="Fucose permease [Carbohydrate transport and
                     metabolism]; Region: FucP; COG0738"
                     /db_xref="CDD:223809"
     misc_feature    complement(177560..178711)
                     /locus_tag="BAB2_0184"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(177668..177670,177683..177688,
                     177695..177700,177731..177733,177740..177745,
                     177755..177757,177764..177769,177776..177778,
                     177914..177916,177926..177928,177935..177937,
                     177947..177949,177959..177961,178007..178009,
                     178016..178021,178028..178033,178040..178042,
                     178295..178297,178313..178318,178325..178330,
                     178364..178366,178373..178378,178385..178390,
                     178397..178402,178547..178552,178556..178561,
                     178571..178573,178580..178585,178592..178594,
                     178643..178648,178652..178660,178667..178669))
                     /locus_tag="BAB2_0184"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(179069..179470)
                     /locus_tag="BAB2_0185"
                     /db_xref="GeneID:3827677"
     CDS             complement(179069..179470)
                     /locus_tag="BAB2_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxD-like protein"
                     /protein_id="YP_418414.1"
                     /db_xref="GI:83269123"
                     /db_xref="GeneID:3827677"
                     /translation="MSSITPKANGAATLIIRVFLSVLFIIAGYNKLTALDGTADYFAS
                     IGLPMPIVTAVVVGLIEFVGGLAILFGFKTRIAAVIVGLFTLGATLVAHMDFAEGMNL
                     LIAQKNLAIAGGLFLLFLHGAGSLSIDARRG"
     misc_feature    complement(179072..179440)
                     /locus_tag="BAB2_0185"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(179573..180964)
                     /gene="fumC"
                     /locus_tag="BAB2_0186"
                     /db_xref="GeneID:3828227"
     CDS             complement(179573..180964)
                     /gene="fumC"
                     /locus_tag="BAB2_0186"
                     /EC_number="4.2.1.2"
                     /note="class II family (does not require metal);
                     tetrameric enzyme; fumarase C; reversibly converts
                     (S)-malate to fumarate and water; functions in the TCA
                     cycle"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="YP_418415.1"
                     /db_xref="GI:83269124"
                     /db_xref="GeneID:3828227"
                     /translation="MAATRTETDTFGPIDVPADRYWGAQTQRSLQNFRIGGERMPLPL
                     VHALGVVKRAAAETNIALGKLDPVLGQVIAVAASEVIEGKLDDHFPLVVWQTGSGTQS
                     NMNANEVISNRAIELLGGEMGSKKPIHPNDHVNMSQSSNDSFPTAIHIATAVETVNRL
                     YPALEHLTKALKVKEEAFKDIIKIGRTHTQDATPVTLGQEFSGYRAALEYARHRLEQS
                     LADVFLLAQGGTAVGTGLNAPVGFDKGFAEAVSEITGLSFKTAPNKFEALASHGAVLN
                     FHGSLNALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQAEAMT
                     MVATQVFGNQTAVTVAASQGHFELNVFKPVIAYNVLQSIRLLSDTMVSFADHCVEGIE
                     PNTARIKELLERSLMLVTALAPAIGYDNAARIAKTAHKNGTTLREEALASGLVSEEDY
                     DRLVRAERMIAPQ"
     misc_feature    complement(179576..180964)
                     /gene="fumC"
                     /locus_tag="BAB2_0186"
                     /note="fumarate hydratase; Reviewed; Region: fumC;
                     PRK00485"
                     /db_xref="CDD:234779"
     misc_feature    complement(179588..180952)
                     /gene="fumC"
                     /locus_tag="BAB2_0186"
                     /note="Class II fumarases; Region: Fumarase_classII;
                     cd01362"
                     /db_xref="CDD:176465"
     misc_feature    complement(order(179972..179974,179987..179989,
                     179993..179995,180401..180403,180542..180550,
                     180569..180580,180587..180589,180665..180667,
                     180671..180673))
                     /gene="fumC"
                     /locus_tag="BAB2_0186"
                     /note="active site"
                     /db_xref="CDD:176465"
     misc_feature    complement(order(179735..179737,179894..179902,
                     179909..179911,179933..179935,180083..180088,
                     180095..180100,180104..180109,180116..180121,
                     180128..180130,180137..180142,180149..180151,
                     180155..180160,180167..180169,180176..180181,
                     180269..180271,180323..180325,180335..180337,
                     180347..180349,180365..180370,180386..180388,
                     180398..180409))
                     /gene="fumC"
                     /locus_tag="BAB2_0186"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176465"
     gene            complement(181114..181401)
                     /locus_tag="BAB2_0187"
                     /db_xref="GeneID:3827678"
     CDS             complement(181114..181401)
                     /locus_tag="BAB2_0187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418416.1"
                     /db_xref="GI:83269125"
                     /db_xref="GeneID:3827678"
                     /translation="MKPEETGTENHMRKELPIETAPKDGRKITVIWIDDDDQRNESIA
                     QYRTLEQLRAGGGQWDEADTGWWTFTDNKTQRKIEPTAWIRETDDDESQED"
     gene            complement(181698..181919)
                     /locus_tag="BAB2_0188"
                     /db_xref="GeneID:3827679"
     CDS             complement(181698..181919)
                     /locus_tag="BAB2_0188"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418417.1"
                     /db_xref="GI:83269126"
                     /db_xref="GeneID:3827679"
                     /translation="MLLPIMSSNPVSILALPRYVLLMQAFLPPVESLPNPGEPPLPGL
                     TFLTVPDARNGHTNSVKLSPFFPAPHNHF"
     gene            complement(182121..183761)
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /db_xref="GeneID:3828243"
     CDS             complement(182121..183761)
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="YP_418418.1"
                     /db_xref="GI:83269127"
                     /db_xref="GeneID:3828243"
                     /translation="MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSF
                     GAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQE
                     GAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGK
                     MIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDA
                     YILLHEKKLSNLQALLPVLEAVVQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVD
                     GAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEK
                     KDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKGVNADQEAGINIVRRAIQAPA
                     RQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAA
                     SVAGLLITTEAMIAELPKKDAAPAGMPGGMGGMGGMDF"
     misc_feature    complement(182178..183761)
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(182193..183752)
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(182196..182216,182223..182225,
                     182388..182390,182604..182606,182610..182612,
                     182991..182993,183075..183077,183171..183173,
                     183534..183536,183543..183545,183555..183557,
                     183579..183581,183585..183587,183615..183617,
                     183621..183626,183639..183641,183645..183656,
                     183687..183689,183738..183740,183750..183752))
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(182277..182279,182283..182285,
                     182403..182405,182517..182519,182568..182570,
                     183312..183314,183489..183491,183501..183503,
                     183663..183671))
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(182364..182366,182373..182378,
                     182382..182384,182409..182411,182463..182465,
                     183435..183437))
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(182532..182537,182637..182639,
                     183183..183185,183204..183206,183339..183341))
                     /gene="groEL"
                     /locus_tag="BAB2_0189"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(183852..184148)
                     /gene="groES"
                     /locus_tag="BAB2_0190"
                     /db_xref="GeneID:3828244"
     CDS             complement(183852..184148)
                     /gene="groES"
                     /locus_tag="BAB2_0190"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="YP_418419.1"
                     /db_xref="GI:83269128"
                     /db_xref="GeneID:3828244"
                     /translation="MADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVV
                     AAGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG"
     misc_feature    complement(183858..184136)
                     /gene="groES"
                     /locus_tag="BAB2_0190"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(183861..183869,183915..183917,
                     183921..183923,183936..183938,183966..183968,
                     184029..184034,184113..184115,184122..184124,
                     184128..184130,184134..184136))
                     /gene="groES"
                     /locus_tag="BAB2_0190"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(184047..184088)
                     /gene="groES"
                     /locus_tag="BAB2_0190"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(183972..183974,184005..184007))
                     /gene="groES"
                     /locus_tag="BAB2_0190"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            184626..185477
                     /locus_tag="BAB2_0191"
                     /db_xref="GeneID:3827680"
     CDS             184626..185477
                     /locus_tag="BAB2_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="YP_418420.1"
                     /db_xref="GI:83269129"
                     /db_xref="GeneID:3827680"
                     /translation="MMILPERLDDLTDRYDAIFCDVWGVVHNGETSFAPAIAALQRAR
                     AKGVTIILVTNSPRPHPGVVAQMSLLGVPEDAYDRVVTSGDVTRDLIAEGPRRIFHIG
                     CERELAIYDGLDVELVEEFEAAGVVCTGLYDDEVETPEDYRELLQRLRARNLPFICAN
                     PDIMVERGPRLIWCAGALAREYGQLGGRTLIAGKPHRPIYEAALRAVESIRGGSVDKS
                     RILGIGDGVLTDVKGAADFGLDVLYISGGVHAADYAVNGDLDMAKMEAFLEKHGHRPI
                     ASLHALV"
     misc_feature    184647..185474
                     /locus_tag="BAB2_0191"
                     /note="Predicted sugar phosphatases of the HAD superfamily
                     [Carbohydrate transport and metabolism]; Region: NagD;
                     COG0647"
                     /db_xref="CDD:223720"
     misc_feature    184674..>184907
                     /locus_tag="BAB2_0191"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(184686..184694,184785..184790)
                     /locus_tag="BAB2_0191"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    184686..184703
                     /locus_tag="BAB2_0191"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    184785..184787
                     /locus_tag="BAB2_0191"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <185052..185345
                     /locus_tag="BAB2_0191"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     gene            185513..185626
                     /locus_tag="BAB2_0192"
                     /db_xref="GeneID:3827681"
     CDS             185513..185626
                     /locus_tag="BAB2_0192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418421.1"
                     /db_xref="GI:83269130"
                     /db_xref="GeneID:3827681"
                     /translation="MPLLFQALTLLRRLFSNNEEIKLSAPHRNRGFAASPA"
     gene            185607..186554
                     /locus_tag="BAB2_0193"
                     /gene_synonym="ribC; ribF"
                     /db_xref="GeneID:3827682"
     CDS             185607..186554
                     /locus_tag="BAB2_0193"
                     /gene_synonym="ribC; ribF"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /note="catalyzes the formation of FMN from riboflavin and
                     the formation of FAD from FMN; in Bacillus the ribC gene
                     has both flavokinase and FAD synthetase activities"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="YP_418422.1"
                     /db_xref="GI:83269131"
                     /db_xref="GeneID:3827682"
                     /translation="MPPALHDCVVAIGNFDGVHRGHQAVLERALELAERESRPAVVLT
                     FEPHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVMEQPFTAEFSQRSAEDFVQHIL
                     VEKLRASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDAFTDEGGMLVSSTRI
                     RNLLSEGEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMALAPQTSLKHGIYAV
                     RFRLDDAMLYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGKTAAVSFFGFLRGEV
                     KFDGLDPLIDQMKQDEAQARALLADVRPISGLDRMLSFN"
     misc_feature    185610..186506
                     /locus_tag="BAB2_0193"
                     /gene_synonym="ribC; ribF"
                     /note="bifunctional riboflavin kinase/FMN
                     adenylyltransferase; Reviewed; Region: PRK05627"
                     /db_xref="CDD:235536"
     misc_feature    185628..186173
                     /locus_tag="BAB2_0193"
                     /gene_synonym="ribC; ribF"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    order(185643..185654,185661..185663,185670..185672,
                     185952..185954,186042..186044,186069..186077)
                     /locus_tag="BAB2_0193"
                     /gene_synonym="ribC; ribF"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    186129..186506
                     /locus_tag="BAB2_0193"
                     /gene_synonym="ribC; ribF"
                     /note="Riboflavin kinase; Region: Flavokinase; smart00904"
                     /db_xref="CDD:214901"
     gene            186898..189816
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /db_xref="GeneID:3827171"
     CDS             186898..189816
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /EC_number="6.1.1.5"
                     /note="IleRS; catalyzes the formation of
                     isoleucyl-tRNA(Ile) from isoleucine and tRNA(Ile); since
                     isoleucine and other amino acids such as valine are
                     similar, there are additional editing function in this
                     enzyme; one is involved in hydrolysis of activated
                     valine-AMP and the other is involved in deacylation of
                     mischarged Val-tRNA(Ile); there are two active sites, one
                     for aminoacylation and one for editing; class-I
                     aminoacyl-tRNA synthetase family; some organisms carry two
                     different copies of this enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="YP_418423.1"
                     /db_xref="GI:83269132"
                     /db_xref="GeneID:3827171"
                     /translation="MTDTTKIDYSKTLYLPQTEFPMRAGLPQREPLFVQRWEEMNLYK
                     KLREQAKDRPLYVLHDGPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDC
                     HGLPIEWKIEEKYRAAGKNKDEVPINEFRKECREFASNWIKVQTEEFKRLAILGDFEN
                     PYTTMNFHAEARIAGELLKFAASGQLYRGSKPVMWSVVERTALAEAEVEYHDIESDMI
                     WVKFPVAGEVATENDLSGSAVVIWTTTPWTIPGNRAVSYSSRIEYGLFEITEAENDFG
                     PRPGERLVFADKLVEECCAKAKLQFKRLRSVSAEELGKIVLDHPLKGFGGGYEFVVPM
                     LDGDHVTDDAGTGFVHTAPSHGREDFEAWMDNARQLEARGIDPNIPFPVGDDGFYTKD
                     APGFGPDREGGPARVIDDNGKKGDANKVVIEQLIAADKLFARGRLKHSYPHSWRSKKP
                     VIFRNTPQWFVYMDKNLGDGTTLRSRALKAIDETRFVPAAGQTRLRSMIEGRPDWVLS
                     RQRAWGVPICVFVDEEGNILQDDAVNKRIMDAFEKEGADAWFADGARERFLGARAGEG
                     WTQVRDILDVWFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCGTRG
                     RAPYNAVVTHGFTMDEHGKKMSKSLGNTVTPQDVIKESGADILRLWVMTTDYWEDQRL
                     GKSIIQTNIDAYRKLRNTIRWMLGTLAHDEGENVAYADLPELERLMLHRLTELDELVR
                     SGYDTFDFKRIARALVDFMNVELSAFYFDIRKDALYCDAPSSIRRKAALQTVREIFVR
                     LTTWLAPMLPFTMEEAWLDRYPQSVSIHAEQFRPTPAEWRDDVLAEKWRKVRAVRRVV
                     TGALELERADKRIGSSLEAAPVVYIADKSLSDSLEGLDFAEICITSGISVSDAAAPEG
                     AFTLGDVKGVAVVPERAKGEKCARSWRYTTDVGADPEFPEVSARDAAALRELQALGKL
                     "
     misc_feature    186898..189810
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="isoleucyl-tRNA synthetase; Provisional; Region:
                     ileS; PRK13804"
                     /db_xref="CDD:237514"
     misc_feature    187057..>187497
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    187105..187116
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    187105..187116
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    order(187105..187107,187114..187116)
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    <188185..188943
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="catalytic core domain of isoleucyl-tRNA
                     synthetases; Region: IleRS_core; cd00818"
                     /db_xref="CDD:173909"
     misc_feature    order(188377..188379,188626..188628,188635..188637,
                     188704..188718,188722..188724,188728..188730,
                     188797..188811,188821..188838,188932..188934)
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="active site"
                     /db_xref="CDD:173909"
     misc_feature    188827..188841
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173909"
     misc_feature    188941..189435
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="Anticodon-binding domain of bacterial and
                     eukaryotic mitochondrial isoleucyl tRNA synthetases;
                     Region: Anticodon_Ia_Ile_BEm; cd07960"
                     /db_xref="CDD:153414"
     misc_feature    order(188950..188952,188962..188964,188971..188973,
                     188983..188985,188992..188994,189001..189006,
                     189142..189144,189151..189156,189163..189168,
                     189175..189177,189190..189192,189202..189204,
                     189211..189213)
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153414"
     misc_feature    order(188992..188994,189001..189003)
                     /gene="ileS"
                     /locus_tag="BAB2_0194"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153414"
     gene            190008..190679
                     /locus_tag="BAB2_0195"
                     /db_xref="GeneID:3827683"
     CDS             190008..190679
                     /locus_tag="BAB2_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418424.1"
                     /db_xref="GI:83269133"
                     /db_xref="GeneID:3827683"
                     /translation="MKIEGRVLVLMTALAGLSLSGCVSSPTYGTDKSAGAQLLDDVSN
                     MASFGQGKKKERIDYKPRPDLVRPAPGDKGYLPAPQQSLASSSDPNWPESPEQRRKRV
                     RDEITAHRDDPNYVSPVLQDAPVADNIRTALPRGNSRREDYASRTPTSDPAKVAALKA
                     ARAQQNQGSATTRRYLSEPPLAYRQPASTAAVGELGPDEAQKERERKKAASGSRGWRD
                     YLPWN"
     gene            191024..191584
                     /locus_tag="BAB2_0196"
                     /db_xref="GeneID:3827684"
     CDS             191024..191584
                     /locus_tag="BAB2_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-dependent hydrogenase b-type cytochrome
                     subunit"
                     /protein_id="YP_418425.1"
                     /db_xref="GI:83269134"
                     /db_xref="GeneID:3827684"
                     /translation="MSSKTYIWDDRSGYGLVSRGFHWLMALLFLWQFASAILRVFAKD
                     TPIYSFFWSAHFQLGFALLVLALLRGVWGLMNIHRRPHKDGAIGKLAVLGHLAIYVLM
                     ITIPSLALLRAYGSGRGFSFLGMPIFAKTDIQNAMLTAPANALHGPLGWALLAAIVGH
                     VAMALVYHFALRDDTLRYMTGHGTPN"
     misc_feature    191042..191572
                     /locus_tag="BAB2_0196"
                     /note="Cytochrome B561 [Energy production and conversion];
                     Region: CybB; COG3038"
                     /db_xref="CDD:225580"
     gene            complement(191638..192111)
                     /locus_tag="BAB2_0197"
                     /db_xref="GeneID:3827685"
     CDS             complement(191638..192111)
                     /locus_tag="BAB2_0197"
                     /EC_number="3.5.4.1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine/deoxycytidylate deaminase"
                     /protein_id="YP_418426.1"
                     /db_xref="GI:83269135"
                     /db_xref="GeneID:3827685"
                     /translation="MRKAASITKANSATPMDIALEEAHAAGERGEVPIGAVIVRDGEI
                     IARAGNRTREFNDVTAHAEILTIRQAGEMLGSERLIDCDLYVTLEPCAMCAAAISFAR
                     IRRLYYGASDPKGGGIEHGGRFYTQPTCHHAPEIYPGFCEADARKILKDFFREKR"
     misc_feature    complement(191758..192066)
                     /locus_tag="BAB2_0197"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(191830..191832,191839..191841,
                     191923..191931,191962..191964,192010..192012))
                     /locus_tag="BAB2_0197"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(191809..191814,191821..191826,
                     191833..191838,191908..191910,191920..191922,
                     191935..191937))
                     /locus_tag="BAB2_0197"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(191830..191832,191839..191844,
                     191923..191931))
                     /locus_tag="BAB2_0197"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            192252..193997
                     /locus_tag="BAB2_0198"
                     /db_xref="GeneID:3827686"
     CDS             192252..193997
                     /locus_tag="BAB2_0198"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="high mobility group protein HMG-I-like protein"
                     /protein_id="YP_418427.1"
                     /db_xref="GI:83269136"
                     /db_xref="GeneID:3827686"
                     /translation="MMAQGDAVTLLKGLYQMTTEDDNKGGKPPHGRKGHSDRPGRPDW
                     DSRPRREGGDRDKPRKFGSRGAPVEEETSERIAKRLARAGIASRREAETMIAAGRIAV
                     NGKVLESPAVNVKRTDIITVDGKPLRQTERTRLWLYHKPAGLVTTNRDPEGRPTVFEA
                     LPPEMPRVLSVGRLDINTEGLLLLTNDGGLSRVLELPSTGWLRRYRVRAHGKVTQQQL
                     DELKNGIAVDGVFYGSVEAELERVQGANVWISIGLREGKNREVKNILGALGLTVGRLI
                     RVSFGPFQLGDLEEGAVREIKGRTLRDQLGDKLIEESGADFDAPVLNEFSNAAVQGRT
                     RREMEEGELPQEGERRRAPREREWISSTGERRRGREEKTEKVEPRRRGNANVWMAPGA
                     RPKGEKEAAKPARVEHQQPHRSAKFSGDLQMRPRRFSEEERGGEESGERRYKRPEGRF
                     EREGGRPDNREKYEKHEGAGKERRPGKRERAELRNAEGQTTERGKGGFEGRKPGKPGG
                     PRSEGRFGGADRDTRSGPRGSGPRGAGDGPRRGHDGKPGGKPGGKPTGRPGGKPGTKP
                     GGGGRSGGGGADRRR"
     misc_feature    192465..193190
                     /locus_tag="BAB2_0198"
                     /note="16S rRNA uridine-516 pseudouridylate synthase and
                     related pseudouridylate synthases [Translation, ribosomal
                     structure and biogenesis]; Region: RsuA; COG1187"
                     /db_xref="CDD:224108"
     misc_feature    192471..192644
                     /locus_tag="BAB2_0198"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(192474..192476,192510..192512,192516..192521,
                     192525..192530,192537..192542,192546..192548,
                     192567..192590,192594..192596)
                     /locus_tag="BAB2_0198"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    192651..193142
                     /locus_tag="BAB2_0198"
                     /note="Pseudouridine synthases catalyze the isomerization
                     of specific uridines in an RNA molecule to pseudouridines
                     (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130"
                     /db_xref="CDD:260207"
     misc_feature    order(192765..192776,193035..193037)
                     /locus_tag="BAB2_0198"
                     /note="active site"
                     /db_xref="CDD:211324"
     misc_feature    193728..>193874
                     /locus_tag="BAB2_0198"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            193978..194541
                     /locus_tag="BAB2_0199"
                     /db_xref="GeneID:3827687"
     CDS             193978..194541
                     /locus_tag="BAB2_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 adenine-specific DNA methylase"
                     /protein_id="YP_418428.1"
                     /db_xref="GI:83269137"
                     /db_xref="GeneID:3827687"
                     /translation="MRIVGGKFRGRALVTPSTNAIRPTTDRTRESLFNILAHSFPDKV
                     EGVRVLDLFAGTGALGLEALSRGARYATFVEESAEGRGILRQNIEALGLQGHTKILRR
                     DACQLGIVGTMEPFDLVFADPPYGRRMGEKAFLSALQGGWLNPDALLVLEEDAQAALE
                     LDDRFAVREERNYGGTVIRLIELKAAS"
     misc_feature    194119..194433
                     /locus_tag="BAB2_0199"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(194131..194151,194200..194205,194281..194289,
                     194341..194343)
                     /locus_tag="BAB2_0199"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            194579..196171
                     /locus_tag="BAB2_0200"
                     /pseudo
                     /db_xref="GeneID:3827688"
     misc_feature    194579..196171
                     /locus_tag="BAB2_0200"
                     /note="Insulinase-like peptidase, family M16:Peptidase M16
                     inactive"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12366.1"
     gene            196572..196670
                     /locus_tag="BAB2_0201"
                     /pseudo
                     /db_xref="GeneID:3827689"
     misc_feature    196572..196670
                     /locus_tag="BAB2_0201"
                     /note="zinc protease"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12367.1"
     gene            196737..197534
                     /locus_tag="BAB2_0202"
                     /pseudo
                     /db_xref="GeneID:3827690"
     misc_feature    196737..197534
                     /locus_tag="BAB2_0202"
                     /note="Peptidase M16 inactive"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12368.1"
     gene            197545..198426
                     /locus_tag="BAB2_0203"
                     /db_xref="GeneID:3827691"
     CDS             197545..198426
                     /locus_tag="BAB2_0203"
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="YP_418429.1"
                     /db_xref="GI:83269138"
                     /db_xref="GeneID:3827691"
                     /translation="MDKALSSSPRFAVAFGGGGARGIAHIHVVDVLNELGIQPVAIAG
                     SSIGSIIGSSMANGMSGKDIYDYMASIFTNRSEVVRRMWQTRPAHWAELFKGGLRVSQ
                     FNIEKVLDVFLPDSFPSNVEDLKIPMTITAVDFHGAREIHISDGDLRSAIAASCAIPP
                     VFAPVRRNGRILVDGGLFNPVPFDLLFDKADIVIGIDVVGGPVGPDDHMPTTFEAVIG
                     TSQLTMCSIIENKFRYRPPHIFVRPNVERIGLLDFLKFEQVISQSAAVRDELKRAIEQ
                     ALDGKVAPILPEKLPDL"
     misc_feature    197548..198420
                     /locus_tag="BAB2_0203"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    197578..198138
                     /locus_tag="BAB2_0203"
                     /note="Patatins and Phospholipases; Region:
                     Patatin_and_cPLA2; cl11396"
                     /db_xref="CDD:264349"
     misc_feature    order(197596..197601,197605..197607,197680..197682,
                     198064..198066)
                     /locus_tag="BAB2_0203"
                     /note="active site"
                     /db_xref="CDD:132836"
     misc_feature    197674..197688
                     /locus_tag="BAB2_0203"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132836"
     gene            complement(198439..200346)
                     /locus_tag="BAB2_0204"
                     /db_xref="GeneID:3827203"
     CDS             complement(198439..200346)
                     /locus_tag="BAB2_0204"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA-N:potassium efflux system protein"
                     /protein_id="YP_418430.1"
                     /db_xref="GI:83269139"
                     /db_xref="GeneID:3827203"
                     /translation="MPKSGVFKATSSTIFKYQEHSMVANGGSLYLQSLIILGGAIIAA
                     PLFKRLGLGTVLGYLAAGITIGPVARLIADGEEFLHFSELGVVFLLFIIGLELNPSRL
                     WSLRHSIFGLGTAQVLLCGAALAALGVYLAGLDTEAAIIIGFGLALSSTAFAMQVLED
                     RAETNQKHGQRAFAILLFQDLAIVPILAIIPALSPNEPSQASAGFHLATAIASIAALV
                     IAGRYLINPMFRIIANTGAREVMITAALFVVLGSASLLQYAGLSMAMGAFIAGVLLAE
                     SSYRHELEADIEPFRGIFLGLFFVAVGLSLNLSVILEYWAVILAAVPIFMATKIVIIY
                     LLCRIFRSSHNDAVRIAFLLPQGGEFAFVLFSAASAAAIISSALGSELVAAVTVSMAL
                     TPLSVAIGSRLLIKDKADDIIEENFDGAGSDVLMIGFSRYGQIAAQILLAGGIDVTVI
                     DSSSNRVRAAGKFGFRIYFGDGTRKDVLEAAGIRKAKIVAICTHKKSTTNHIVNLIQS
                     EYPDVRLFVRSYDREHTLQLRAQGVEYELRETFESGLLFGQRTLEGLGLSEANAYAIR
                     EDVRQRDEDRLHVQASEGIMAGRHLLFNKPVTPEPLVKPTREGQRIDKSDDGQRAPSP
                     QETAAAPVAAE"
     misc_feature    complement(198628..200271)
                     /locus_tag="BAB2_0204"
                     /note="glutathione-regulated potassium-efflux system
                     protein KefB; Provisional; Region: PRK03659"
                     /db_xref="CDD:179625"
     misc_feature    complement(199135..200268)
                     /locus_tag="BAB2_0204"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    complement(198742..199077)
                     /locus_tag="BAB2_0204"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     gene            200485..201828
                     /gene="pmbA"
                     /locus_tag="BAB2_0205"
                     /db_xref="GeneID:3828047"
     CDS             200485..201828
                     /gene="pmbA"
                     /locus_tag="BAB2_0205"
                     /codon_start=1
                     /transl_table=11
                     /product="modulator of DNA gyrase"
                     /protein_id="YP_418431.1"
                     /db_xref="GI:83269140"
                     /db_xref="GeneID:3828047"
                     /translation="MISDNSADKLVERAAELVAAAKRAGADEVDAVVMRARSVSVSVR
                     LGKVEGTESSESDDFALRVFVGRRIASVSANAGADPHRLAERAVAMARVAPEDPYERL
                     ADPSLLVKSPRDLDLFDATEIDTARLTEDALAMEAAALAVSGVTNSGGAGASRSLGGM
                     VLVTSTGFSGHYAATRFGRSVSAIAGEGTGMERDYDFSSRLHFADLDAPEAIGRSAGE
                     RAVRRLGARQAKTGPVTVVYDPRLARGIAGHLASAINGASVARKTSFLRNSLGKPVLK
                     QGINVTDNPLRVRGPSSRPFDGEGIEGQPLTMVEDGVLQHWLLSGSSARELGLQGNGR
                     GVRSGSGVTPASTNFAIEPGTQSPEELIRAVGTGFYVTEVFGQGVDMISGQYSRGASG
                     FWIENGELAYPVSEVTIASNLKDMFLNMTPASDIDRNFGMAAPTLVIEGMTLAGN"
     misc_feature    200518..201825
                     /gene="pmbA"
                     /locus_tag="BAB2_0205"
                     /note="Predicted Zn-dependent proteases and their
                     inactivated homologs [General function prediction only];
                     Region: TldD; COG0312"
                     /db_xref="CDD:223389"
     gene            201860..202624
                     /locus_tag="BAB2_0206"
                     /db_xref="GeneID:3827204"
     CDS             201860..202624
                     /locus_tag="BAB2_0206"
                     /EC_number="3.1.3.25"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="YP_418432.1"
                     /db_xref="GI:83269141"
                     /db_xref="GeneID:3827204"
                     /translation="MLREAAREAGRIAMHYFGRSPEVWLKDGVSPVSEADLAVDRFLK
                     ETLLAARPDYDWISEETVDERAAAERSRAFVVDPIDGTRAYIGGQDQWCVSIAIIENG
                     SPVAGVLECPVREELLEAGKGLGARQNGCRIHTKVPLAGEEITIAFARNQINALPEQW
                     RGPVRVHPYVPSLAYRIAMVARGDIAGTFIRPNSHDWDLAAADLILSESGGAILTSKA
                     LPLVYGGPTRSHGALVAASGNLLREMLSVVADQPLS"
     misc_feature    201863..202564
                     /locus_tag="BAB2_0206"
                     /note="CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate
                     (PAPS) 3'-phosphatase, is a bacterial member of the
                     inositol monophosphatase family. It has been proposed that
                     CysQ helps control intracellular levels of PAPS, which is
                     an intermediate in...; Region: CysQ; cd01638"
                     /db_xref="CDD:238816"
     misc_feature    order(201965..201967,202034..202039,202088..202105,
                     202109..202111,202304..202306,202313..202315,
                     202385..202387,202421..202423,202448..202453)
                     /locus_tag="BAB2_0206"
                     /note="active site"
                     /db_xref="CDD:238816"
     gene            202663..202914
                     /locus_tag="BAB2_0207"
                     /db_xref="GeneID:3827205"
     CDS             202663..202914
                     /locus_tag="BAB2_0207"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418433.1"
                     /db_xref="GI:83269142"
                     /db_xref="GeneID:3827205"
                     /translation="MSDAGDNKQLLHLVFGGELKKLDSLEFRDLQNLDIVGIYPDYES
                     AKTAWKSKAQQTVDNAHMRYFIVHLHRLLDPNNMTLKAE"
     misc_feature    202684..202890
                     /locus_tag="BAB2_0207"
                     /note="Domain of unknown function (DUF4170); Region:
                     DUF4170; pfam13773"
                     /db_xref="CDD:205946"
     gene            202978..203721
                     /locus_tag="BAB2_0208"
                     /db_xref="GeneID:3827206"
     CDS             202978..203721
                     /locus_tag="BAB2_0208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418434.1"
                     /db_xref="GI:83269143"
                     /db_xref="GeneID:3827206"
                     /translation="MQKKKGGLAKRLWRRIRGPLARSAAVKSILVWLIASYLKLVHAT
                     NPRLKDSASSEDIVHDFAPFIVTFWHGQHLMGPFLRPKGLELVAMFSRSADAELNARV
                     AEKLGLLTVRGSGGRGTRANPEKGGARALLTLKNALRKGQSTSMIADIAHGKAREAGE
                     GIILLAKLSGRPIIPLAYAFSRNHVLEKTWDKTTIPLPFGRSTIVRGDPVWVDADADD
                     VQLEEKRVELTRQLNRATDRAYAALEKAK"
     misc_feature    203089..203679
                     /locus_tag="BAB2_0208"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: DUF374; Region:
                     LPLAT_DUF374-like; cd07983"
                     /db_xref="CDD:153245"
     misc_feature    order(203185..203187,203194..203196,203200..203202,
                     203245..203256,203425..203433)
                     /locus_tag="BAB2_0208"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153245"
     gene            203718..205058
                     /gene="kdtA"
                     /locus_tag="BAB2_0209"
                     /db_xref="GeneID:3827172"
     CDS             203718..205058
                     /gene="kdtA"
                     /locus_tag="BAB2_0209"
                     /EC_number="2.-.-.-"
                     /note="catalyzes the transfer of
                     2-keto-3-deoxy-D-manno-octulosonic acid to lipid A"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic-acid transferase"
                     /protein_id="YP_418435.1"
                     /db_xref="GI:83269144"
                     /db_xref="GeneID:3827172"
                     /translation="MSERWARSILSAYRFLGSAAYPFVGSYIAYRASRGKEDRSRRGE
                     RYGKSAIARPQGPVIWAHAASVGETIALVPLVERIVATGIHVVMTTGTVTSAKVVADQ
                     LGSRVIHQYAPLDLQPAVDHFLDHWKPDLVIGCESEVWPATVLSLGSRHIPHVLVNGR
                     MSDRSFAAWQKRPALAEALFENFAHVVAQSELDGERFRALGARPVSVSGNLKVDTPPP
                     PSDPQALSLMQRQVAGRRTWAAISTHDGEEEIAAEVHQMLKMRYPRLITIIVPRHPDR
                     APAIEAMLAAKGLKVARRSTGQPIEADTDVLLGDTIGEMGLYLQLTEIAFIGNSLTKE
                     GGHNPLEPAMMGTAVLTGRNVQNFRESFQRLIKNGGARIVKDRNMLAGAINFLFNNPQ
                     HLRAMINAGVTTVRDMRGALDRTLAALEPFIQPLVLQAQLPGNRNEPAFSLDEH"
     misc_feature    203742..204986
                     /gene="kdtA"
                     /locus_tag="BAB2_0209"
                     /note="3-deoxy-D-manno-octulosonic-acid transferase [Cell
                     envelope biogenesis, outer membrane]; Region: KdtA;
                     COG1519"
                     /db_xref="CDD:224436"
     misc_feature    203829..204368
                     /gene="kdtA"
                     /locus_tag="BAB2_0209"
                     /note="3-Deoxy-D-manno-octulosonic-acid transferase
                     (kdotransferase); Region: Glycos_transf_N; pfam04413"
                     /db_xref="CDD:252580"
     misc_feature    <204615..204920
                     /gene="kdtA"
                     /locus_tag="BAB2_0209"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     gene            205061..206086
                     /gene="lpxK"
                     /locus_tag="BAB2_0210"
                     /db_xref="GeneID:3827177"
     CDS             205061..206086
                     /gene="lpxK"
                     /locus_tag="BAB2_0210"
                     /EC_number="2.7.1.130"
                     /note="transfers the gamma-phosphate of ATP to the 4'
                     position of a tetraacyldisaccharide 1-phosphate
                     intermediate to form tetraacyldisaccharide
                     1,4'-bis-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="YP_418436.1"
                     /db_xref="GI:83269145"
                     /db_xref="GeneID:3827177"
                     /translation="MASEAPPFWWDEPDWRALALAPAAWIYGRVSGRRLIRAVPPRVS
                     LPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKPGIVSRGYGGNYSGLHLVDPGHDGA
                     RHVGDEPLLLARHAAVALSPDRVKAAEYLKSLGCDFIIMDDGFQSARLHADFSLLVVD
                     ASRGIGNGRVIPAGPLRAPLTDQMRKTDALLCIGKGNGADFVIRQAARAGRPIYHAQL
                     RPSSSATVAGRRWLAFAGIGNPDKFYESVRQAGGEVVETHSFADHYSFEPDDIRGLVD
                     MARRQGLGLITTAKDHVRLATMPGVPPEFLSKLAVLDVDLEFDRTDALDHILDTVVER
                     FKSRLHG"
     misc_feature    205061..206077
                     /gene="lpxK"
                     /locus_tag="BAB2_0210"
                     /note="Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope
                     biogenesis, outer membrane]; Region: LpxK; COG1663"
                     /db_xref="CDD:224577"
     gene            complement(206100..206336)
                     /locus_tag="BAB2_0211"
                     /db_xref="GeneID:3827207"
     CDS             complement(206100..206336)
                     /locus_tag="BAB2_0211"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418437.1"
                     /db_xref="GI:83269146"
                     /db_xref="GeneID:3827207"
                     /translation="MNRFESPRSSEAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDEL
                     KYWSVARQEPYASGLISFERELEMNPELRSRKKA"
     misc_feature    complement(206109..206336)
                     /locus_tag="BAB2_0211"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3908"
                     /db_xref="CDD:226423"
     gene            complement(206434..208305)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /db_xref="GeneID:3827922"
     CDS             complement(206434..208305)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="This protein is involved in the repair of
                     mismatches in DNA. It is required for dam-dependent
                     methyl-directed DNA mismatch repair. Promotes the
                     formation of a stable complex between two or more
                     DNA-binding proteins in an ATP-dependent manner without
                     itself being part of a final effector complex"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein"
                     /protein_id="YP_418438.1"
                     /db_xref="GI:83269147"
                     /db_xref="GeneID:3827922"
                     /translation="MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEV
                     VTAGGGKTLLRVTDNGSGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGS
                     VSKLTLKSRPQDADSGFEVCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKT
                     DRAEATAITDVVKRIGIAFPHIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREF
                     GENALAIDAERDGVRLAGFVGIPSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDV
                     IARDRHPVAVLFLTLDPALVDVNVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRP
                     ATSGAEAMLQAFRAEGFGAQQSAPRPANSYSPASWRTAPPAPRSEWSPQTAHPAHRPL
                     DLQAAPALRENGQAVLGDVAVPAADARASVAEAPVELMQKPLGAARAQIHENYIVAQT
                     EDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLLIPEIVDLPEEDAQRLAGHAETL
                     ARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLADEIAEHDTADGLKAMLHHVAA
                     TMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRPTYIELKLTDIERLFGRR"
     misc_feature    complement(206437..208305)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="DNA mismatch repair protein; Reviewed; Region:
                     mutL; PRK00095"
                     /db_xref="CDD:234630"
     misc_feature    complement(207934..208239)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(207943..207945,207949..207954,
                     207976..207978,207982..207984,208015..208026,
                     208117..208122,208126..208128,208132..208134,
                     208138..208140,208198..208200,208207..208209,
                     208219..208221))
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(208207..208209)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(208018..208020,208024..208026,
                     208120..208122,208126..208128))
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(207325..207690)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="MutL_Trans: transducer domain, having a ribosomal
                     S5 domain 2-like fold, conserved in the C-terminal domain
                     of DNA mismatch repair (MutL/MLH1/PMS2) family. This
                     transducer domain is homologous to the second domain of
                     the DNA gyrase B subunit, which is...; Region: MutL_Trans;
                     cd00782"
                     /db_xref="CDD:238405"
     misc_feature    complement(207394..207396)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238405"
     misc_feature    complement(206566..207009)
                     /gene="mutL"
                     /locus_tag="BAB2_0212"
                     /note="MutL C terminal dimerization domain; Region:
                     MutL_C; pfam08676"
                     /db_xref="CDD:254967"
     gene            complement(208489..209772)
                     /gene="mucK"
                     /locus_tag="BAB2_0213"
                     /db_xref="GeneID:3827921"
     CDS             complement(208489..209772)
                     /gene="mucK"
                     /locus_tag="BAB2_0213"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418439.1"
                     /db_xref="GI:83269148"
                     /db_xref="GeneID:3827921"
                     /translation="MRTINENTATKTSRAAVRPEHNRIWILVFIFSFLGLMIDGADLM
                     LLSYSLTSIKAEFGLTSVEAGSLGSITLAGMAIGGIYGGWACDRFGRVKTVSWTIVLF
                     SIGTAVLGLTHSYFQFAVARFVSSLGLGALYVACNTLMAEYVPTKYRTTALGTLQAGW
                     SVGYIVATVLAGAILPVYGWRYLFFVAIVPVIIALLMHKGVPEPESWVRAKAERESGG
                     SKFTTAKRESAFKAIFGNPRVRTLFIFWALTAGFLQFGYYGVNNWLPSYLETEMGMNF
                     KSMTAYMIGSYTAMILSKVLAGVAADWLGRRAVFALGALGTAAFLPIIVLYHSPDTIL
                     WMLVVFGFLYGVPYGVNATYMAESFEAKYRGTAVGGAYNIGRAGAALAPVAIGFFASQ
                     ISIGFGFLVMGGAYFICGVIPALFIREKQFDPEKQ"
     misc_feature    complement(208609..209709)
                     /gene="mucK"
                     /locus_tag="BAB2_0213"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    complement(208522..209688)
                     /gene="mucK"
                     /locus_tag="BAB2_0213"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(208636..208638,208645..208650,
                     208657..208662,208669..208674,208705..208707,
                     208714..208719,208729..208731,208738..208743,
                     208750..208752,208891..208893,208903..208905,
                     208912..208914,208924..208926,208936..208938,
                     208978..208980,208987..208992,208999..209004,
                     209011..209013,209281..209283,209299..209304,
                     209311..209316,209350..209352,209359..209364,
                     209371..209376,209383..209388,209524..209529,
                     209533..209538,209548..209550,209557..209562,
                     209569..209571,209620..209625,209629..209637,
                     209644..209646))
                     /gene="mucK"
                     /locus_tag="BAB2_0213"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(209870..211024)
                     /locus_tag="BAB2_0214"
                     /db_xref="GeneID:3827208"
     CDS             complement(209870..211024)
                     /locus_tag="BAB2_0214"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_418440.1"
                     /db_xref="GI:83269149"
                     /db_xref="GeneID:3827208"
                     /translation="MIRDPETLEILRDTVSQFVSETLIPRENEVAETNAIPADIIAQM
                     KELGFFGLTIPEEFGGLGLTMEEEVNVAFELGRASPAFRSYIGTNNGIGSIGILIDGT
                     DEQKRNYLPRLASGELLSSFCLTEPDAGSDAASLKTTAVRDGDFYILNGTKRFITNAP
                     IADIFTVMARTAADVKGADGISAFIIERNSPGLSLGKPDQKMGQKGALTSDVIFENVR
                     VPASQLIGGVEGKGFKTAMKMLDKGRLHIAALSTGAAERMLADTLAYALDRKQFGKPI
                     ADFQLIQAMLADSKAEIYAAKCMVLDAARKRDSGQNVSTEASCAKMFATEMCGRVADR
                     CVQIHGGAGYVSEYAIERFYRDVRLFRIYEGTTQIQQIVIARNMIREARR"
     misc_feature    complement(209876..211012)
                     /locus_tag="BAB2_0214"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(209885..211009)
                     /locus_tag="BAB2_0214"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(209921..209923,209927..209929,
                     209933..209941,210554..210556,210560..210562,
                     210653..210655,210659..210661,210749..210751))
                     /locus_tag="BAB2_0214"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(211081..211935)
                     /locus_tag="BAB2_0215"
                     /db_xref="GeneID:3827209"
     CDS             complement(211081..211935)
                     /locus_tag="BAB2_0215"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator IclR family
                     protein"
                     /protein_id="YP_418441.1"
                     /db_xref="GI:83269150"
                     /db_xref="GeneID:3827209"
                     /translation="MRSRTGSDASRRQERSAEMRKPTMLTPLEAGVEEEDRQFVTALA
                     RGLEVLRCFTPTENTLGNQEIAHKTGLPKPTVSRLTHTLVRLGYLRQDALSGLYQLDI
                     GILRLGYAMLSNLMIRTVASPLMQVLADYAKAAVAMAARDRLSMVYLDVVQGEGNMTM
                     RRQIGSTLPLAGSSVGRACLAAMPEDERTFILEHIREREPENWPSIRKGLDRALRDFE
                     DYGYCLSIGEWHRDVNSVAVPLVHKQYGVLVFNCGGPSFQLPREKLEDDIGPRLIEMV
                     HNISSAVP"
     misc_feature    complement(211546..211818)
                     /locus_tag="BAB2_0215"
                     /note="helix_turn_helix isocitrate lyase regulation;
                     Region: HTH_ICLR; smart00346"
                     /db_xref="CDD:214629"
     misc_feature    complement(211087..211815)
                     /locus_tag="BAB2_0215"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(211114..211464)
                     /locus_tag="BAB2_0215"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            212195..214537
                     /locus_tag="BAB2_0216"
                     /pseudo
                     /db_xref="GeneID:3827210"
     misc_feature    212195..214537
                     /locus_tag="BAB2_0216"
                     /note="NAD binding site:FAD-dependent pyridine
                     nucleotide-disulphide oxidoreductase:Enoyl-CoA
                     hydratase/isomerase:3-hydroxyacyl-CoA..."
                     /pseudo
                     /db_xref="PSEUDO:CAJ12382.1"
     gene            214701..215840
                     /locus_tag="BAB2_0217"
                     /pseudo
                     /db_xref="GeneID:3827211"
     misc_feature    214701..215840
                     /locus_tag="BAB2_0217"
                     /note="L-carnitine dehydratase/bile acid-inducible protein
                     F"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12383.1"
     gene            215806..215943
                     /locus_tag="BAB2_0218"
                     /pseudo
                     /db_xref="GeneID:3827212"
     misc_feature    215806..215943
                     /locus_tag="BAB2_0218"
                     /note="CAIB/BAIF family protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12384.1"
     gene            complement(215927..217201)
                     /locus_tag="BAB2_0219"
                     /db_xref="GeneID:3827213"
     CDS             complement(215927..217201)
                     /locus_tag="BAB2_0219"
                     /EC_number="1.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="YP_418442.1"
                     /db_xref="GI:83269151"
                     /db_xref="GeneID:3827213"
                     /translation="MSLFSPLVLNNGATIPNRIAKAAMEENMADADHAPSAGLLRLYK
                     AWAEGETGLIITGNVMVDARAMTGPGGVVLEDDRHLDRFQAWAEAGRTRGAHIWMQIN
                     HPGRQMPAALGQETLAPSAIALDLGAQSKRFPIPREMSEADIADVERRFINTAQLAER
                     ADFTGVEIHAAHGYLLSQFLSPLSNRRQDRWGGSLENRARLLVNIVRGIRAAVSPGFC
                     VAVKLNSADFQRGGFSPEDARAVVMMLAPLGVDLVELSGGSYEAPAMMGSARDERTLA
                     REAYFLDFARDIAEIATMPLMVTGGIRRREVAEQVIESGIAMAGIATALAIEPNLPRN
                     WRLGRADAPKLKPIAWKNKPLAASAHMAAVKYQLTRLSCQRRTAPGISPVWALAVSQI
                     DAFFRARRYRQWMVDRRATPGRYRPDQFIRQS"
     misc_feature    complement(216188..217195)
                     /locus_tag="BAB2_0219"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 2.  Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_2_FMN; cd04733"
                     /db_xref="CDD:240084"
     misc_feature    complement(order(216233..216238,216524..216526,
                     216680..216682,216902..216904,217028..217030,
                     217127..217129,217133..217135))
                     /locus_tag="BAB2_0219"
                     /note="putative active site [active]"
                     /db_xref="CDD:240084"
     misc_feature    complement(order(216233..216238,216524..216526,
                     216902..216904,217028..217030,217127..217129,
                     217133..217135))
                     /locus_tag="BAB2_0219"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240084"
     misc_feature    complement(order(216680..216682,216686..216688))
                     /locus_tag="BAB2_0219"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240084"
     misc_feature    complement(216680..216682)
                     /locus_tag="BAB2_0219"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240084"
     gene            217287..217751
                     /locus_tag="BAB2_0220"
                     /db_xref="GeneID:3827214"
     CDS             217287..217751
                     /locus_tag="BAB2_0220"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_418443.1"
                     /db_xref="GI:83269152"
                     /db_xref="GeneID:3827214"
                     /translation="MKIGELAKRSGLAASRIRFYESIGLLKTVDRRSNGYRTYPEEAV
                     LVLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALIEVLRRKVADIEALEARLARSKL
                     QLLGLISDIEAKPDDMACADNARRVLSRLMAEEMEAPASLQDEGRPHRRTTI"
     misc_feature    217287..217679
                     /locus_tag="BAB2_0220"
                     /note="Helix-Turn-Helix DNA binding domain of putative
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-like_sg7; cd04786"
                     /db_xref="CDD:133413"
     misc_feature    217287..217628
                     /locus_tag="BAB2_0220"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    order(217290..217298,217338..217340,217389..217397)
                     /locus_tag="BAB2_0220"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133413"
     misc_feature    order(217431..217433,217440..217442,217452..217457,
                     217482..217484,217533..217535,217545..217547,
                     217563..217565,217575..217577,217584..217589)
                     /locus_tag="BAB2_0220"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133413"
     gene            complement(217849..219189)
                     /locus_tag="BAB2_0221"
                     /db_xref="GeneID:3827215"
     CDS             complement(217849..219189)
                     /locus_tag="BAB2_0221"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase-like ATP-binding protein"
                     /protein_id="YP_418444.1"
                     /db_xref="GI:83269153"
                     /db_xref="GeneID:3827215"
                     /translation="MRPRSLQWRISLWLGLGISMLWAIAALVTASQLSREMNVVFDSA
                     LEETAQRILPLAVLDITERESDDEMNQRMATLRKHDEYFTYVVRNTAGEVLLQSHSAD
                     LSIFPPFTTMGFQTTPTHRIYFDAALQGAVNIAVAEPLGARRGVAMQVLWRLALPLGL
                     VIPLSLIGVWAIVRVSMAPLWAFRSDIEARGSGDLSPVTVNDLPSEVSPIAQAVNRLM
                     DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRL
                     SRLSEKLMQLAKAEGGRLHAAEPIDMGVILRMVVRELSQPHGNENRIRLSIPDMAVKI
                     DIDADAFAILARNLIENALKHGPHDEPVEVLLTASGKLVVSNGGPAVPPDILERLSHR
                     FERGATKAEGTGLGLAIAKAIAAGTGGTIDLFSPREGRKDGFEVRFTPGGRVLH"
     misc_feature    complement(217879..219189)
                     /locus_tag="BAB2_0221"
                     /note="sensor protein QseC; Provisional; Region: PRK10337"
                     /db_xref="CDD:182388"
     misc_feature    complement(218521..218730)
                     /locus_tag="BAB2_0221"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(218326..218517)
                     /locus_tag="BAB2_0221"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(218341..218343,218353..218355,
                     218362..218364,218374..218376,218383..218385,
                     218395..218397,218443..218445,218452..218454,
                     218464..218466,218473..218475,218485..218487,
                     218497..218499))
                     /locus_tag="BAB2_0221"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(218479..218481)
                     /locus_tag="BAB2_0221"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(217870..218154)
                     /locus_tag="BAB2_0221"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(217882..217884,217888..217893,
                     217915..217917,217921..217923,217969..217980,
                     218047..218052,218056..218058,218062..218064,
                     218068..218070,218128..218130,218137..218139,
                     218149..218151))
                     /locus_tag="BAB2_0221"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(218137..218139)
                     /locus_tag="BAB2_0221"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(217972..217974,217978..217980,
                     218050..218052,218056..218058))
                     /locus_tag="BAB2_0221"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(219189..219866)
                     /locus_tag="BAB2_0222"
                     /db_xref="GeneID:3827216"
     CDS             complement(219189..219866)
                     /locus_tag="BAB2_0222"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver"
                     /protein_id="YP_418445.1"
                     /db_xref="GI:83269154"
                     /db_xref="GeneID:3827216"
                     /translation="MRIILIEDDPILGAAVRDHIAAEGHCVDWVSRLDTAHDYMESAR
                     YDLVLLDLMLPDGQGLSFLRDLRTKGCSTPVIILTALDQISDRIQGLNAGADDYLTKP
                     FDLSELSARLNAVARRYSGNPNPLIEIGGLQIDLAAKSVMRDGRALCLTAREWALLEA
                     FLQHPGQTLSKAQLEEHLYSFDTEVESNTMEVHVSRLRKKLGHAIIETVRGIGYRLGN
                     SKSKAAR"
     misc_feature    complement(219213..219866)
                     /locus_tag="BAB2_0222"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(219519..219857)
                     /locus_tag="BAB2_0222"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(219561..219566,219573..219575,
                     219630..219632,219690..219692,219714..219716,
                     219843..219848))
                     /locus_tag="BAB2_0222"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(219714..219716)
                     /locus_tag="BAB2_0222"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(219690..219698,219702..219707))
                     /locus_tag="BAB2_0222"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(219558..219566)
                     /locus_tag="BAB2_0222"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(219219..219488)
                     /locus_tag="BAB2_0222"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(219228..219230,219243..219245,
                     219264..219269,219291..219293,219300..219302,
                     219354..219359,219414..219416))
                     /locus_tag="BAB2_0222"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            220130..220402
                     /locus_tag="BAB2_0223"
                     /db_xref="GeneID:3827217"
     CDS             220130..220402
                     /locus_tag="BAB2_0223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418446.1"
                     /db_xref="GI:83269155"
                     /db_xref="GeneID:3827217"
                     /translation="MAASLGWNVKRIKIDDGCYEIKGLNEAGKPFKAKINPQSLAIMK
                     LKVKGMDDDRDHRRNRQQHGDAPGPLDGVPANKLIQKGSTPKVQVQ"
     misc_feature    <220130..220387
                     /locus_tag="BAB2_0223"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY_2; cl17877"
                     /db_xref="CDD:266904"
     gene            220570..221040
                     /locus_tag="BAB2_0224"
                     /db_xref="GeneID:3827218"
     CDS             220570..221040
                     /locus_tag="BAB2_0224"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418447.1"
                     /db_xref="GI:83269156"
                     /db_xref="GeneID:3827218"
                     /translation="MKSLLSALAITTALTFPGLALAQPVTLSTTLNNYGGDGAYIALY
                     VTDAQGAYAGSLWMAGGKSKYYQHLSGWYRATGGDTAEIDGITGASVGAGRKLEITLD
                     LADALFDAGYTLHVDAAVEDMQDSPDEIALPLTSKGSGVPVRGRRYIANFTYTK"
     misc_feature    220639..221025
                     /locus_tag="BAB2_0224"
                     /note="Predicted periplasmic protein (DUF2271); Region:
                     DUF2271; pfam10029"
                     /db_xref="CDD:255708"
     gene            221051..221356
                     /locus_tag="BAB2_0225"
                     /pseudo
                     /db_xref="GeneID:3827219"
     misc_feature    221051..221356
                     /locus_tag="BAB2_0225"
                     /note="oxidoreductase, FAD-binding, putative"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12391.1"
     gene            221331..223256
                     /locus_tag="BAB2_0226"
                     /pseudo
                     /db_xref="GeneID:3827220"
     misc_feature    221331..223256
                     /locus_tag="BAB2_0226"
                     /note="Phthalate dioxygenase reductase:Flavodoxin-like
                     domain:Phenol hydroxylase
                     reductase:Flavodoxin:Oxidoreductase FAD/NAD(P)-bind..."
                     /pseudo
                     /db_xref="PSEUDO:CAJ12392.1"
     gene            223237..224214
                     /locus_tag="BAB2_0227"
                     /db_xref="GeneID:3827221"
     CDS             223237..224214
                     /locus_tag="BAB2_0227"
                     /codon_start=1
                     /transl_table=11
                     /product="ApbE-like lipoprotein"
                     /protein_id="YP_418448.1"
                     /db_xref="GI:83269157"
                     /db_xref="GeneID:3827221"
                     /translation="MSKMFTDLKRHGLNGPTMRTRWSAIFYAAADFDIAPLRRALQQA
                     VDEVDMQMSTWKPDSDLMRLNRAPVGVWVEVPARLMEVLRLAIEIGRATGGAFDAAMG
                     DAVKAWGFGPMEADQRLISEALAGPRVAAHDALELDISAMRVRKRAAVTLDLNGIAKG
                     YGVDRLADTLESFGIHSGLVGIDGEMRALELRPDGTPWAIAVEMPDYNRRAPHSVLAL
                     HNGAVATSGDYRHWVVAGGHRLSHTMDPHRGAPLSTPPASVTVVAKTCAQADAFATAL
                     MVLGPIAGSKLAQSLGLDVLFLLRDGETIRPQPVGALFSGHPYPLQKLG"
     misc_feature    223273..224190
                     /locus_tag="BAB2_0227"
                     /note="Membrane-associated lipoprotein involved in
                     thiamine biosynthesis [Coenzyme metabolism]; Region: ApbE;
                     COG1477"
                     /db_xref="CDD:224394"
     gene            complement(224257..225207)
                     /locus_tag="BAB2_0228"
                     /pseudo
                     /db_xref="GeneID:3827222"
     misc_feature    complement(224257..225207)
                     /locus_tag="BAB2_0228"
                     /note="GGDEF"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12394.1"
     gene            225229..226473
                     /locus_tag="BAB2_0229"
                     /pseudo
                     /db_xref="GeneID:3828094"
     misc_feature    225229..226473
                     /locus_tag="BAB2_0229"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12395.1"
     gene            226577..227182
                     /locus_tag="BAB2_0230"
                     /db_xref="GeneID:3828095"
     CDS             226577..227182
                     /locus_tag="BAB2_0230"
                     /EC_number="2.5.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_418449.1"
                     /db_xref="GI:83269158"
                     /db_xref="GeneID:3828095"
                     /translation="MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYL
                     AINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVAAFKPAYGSLERARLQEALGFCS
                     DLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
                     ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI"
     misc_feature    226577..227179
                     /locus_tag="BAB2_0230"
                     /note="glutathionine S-transferase; Provisional; Region:
                     PRK10542"
                     /db_xref="CDD:182533"
     misc_feature    226577..226804
                     /locus_tag="BAB2_0230"
                     /note="GST_N family, Class Beta subfamily; GSTs are
                     cytosolic dimeric proteins involved in cellular
                     detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of endogenous and
                     xenobiotic alkylating agents, including carcinogens;
                     Region: GST_N_Beta; cd03057"
                     /db_xref="CDD:239355"
     misc_feature    order(226595..226600,226613..226615,226619..226621,
                     226631..226636,226787..226789,226799..226801)
                     /locus_tag="BAB2_0230"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239355"
     misc_feature    order(226604..226606,226727..226732,226769..226774)
                     /locus_tag="BAB2_0230"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239355"
     misc_feature    order(226727..226729,226766..226771,226775..226777,
                     226790..226792,226799..226801)
                     /locus_tag="BAB2_0230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239355"
     misc_feature    226841..227161
                     /locus_tag="BAB2_0230"
                     /note="C-terminal, alpha helical domain of Class Beta
                     Glutathione S-transferases; Region: GST_C_Beta; cd03188"
                     /db_xref="CDD:198297"
     misc_feature    order(226841..226843,226850..226855,226862..226864,
                     226871..226873,226880..226882,226892..226894,
                     226919..226921,226934..226936,226943..226945,
                     226955..226957)
                     /locus_tag="BAB2_0230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198297"
     misc_feature    order(226847..226849,226889..226891,227033..227035,
                     227054..227056,227066..227068,227138..227140,
                     227144..227146,227156..227158)
                     /locus_tag="BAB2_0230"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198297"
     misc_feature    order(226889..226894,226901..226906,226910..226912,
                     227057..227059,227066..227068,227075..227077)
                     /locus_tag="BAB2_0230"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198297"
     gene            227365..227751
                     /locus_tag="BAB2_0231"
                     /db_xref="GeneID:3828096"
     CDS             227365..227751
                     /locus_tag="BAB2_0231"
                     /EC_number="1.13.11.39"
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl-2,3-diol 1,2-dioxygenase III"
                     /protein_id="YP_418450.1"
                     /db_xref="GI:83269159"
                     /db_xref="GeneID:3828096"
                     /translation="MQISRIDHFVLTVQDIDVTCDFYSRACGMEVVTFAGGRKALSFG
                     QHKINLHQAGSEFLPKAASPTRGSGDFCLISSIPLDEVIAHLETENIAIEDGPVARTG
                     AMGPIRSIYFRDPDGNLVEISEYIDL"
     misc_feature    227371..227739
                     /locus_tag="BAB2_0231"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_2; cd07253"
                     /db_xref="CDD:176676"
     misc_feature    order(227371..227394,227443..227448,227491..227505,
                     227557..227592,227605..227610,227617..227619,
                     227644..227646,227665..227676,227701..227703,
                     227710..227715,227719..227721,227725..227727,
                     227737..227739)
                     /locus_tag="BAB2_0231"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176676"
     misc_feature    order(227386..227388,227572..227574,227725..227727)
                     /locus_tag="BAB2_0231"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:176676"
     gene            227904..228311
                     /locus_tag="BAB2_0232"
                     /db_xref="GeneID:3828097"
     CDS             227904..228311
                     /locus_tag="BAB2_0232"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418451.1"
                     /db_xref="GI:83269160"
                     /db_xref="GeneID:3828097"
                     /translation="MVKRGRLQHWAFVLRILCAVALVSVGLAHKIPVFASSSKGYFDL
                     SSYELPDGTFPVFCLMDNGDRTSKQPQSSRSDCDACRISCSVILPVPESGTVNRPLRA
                     NVPTVRKSYAACHEQRLPSNRSPRAPPFKLSIA"
     gene            228408..230438
                     /locus_tag="BAB2_0233"
                     /db_xref="GeneID:3828098"
     CDS             228408..230438
                     /locus_tag="BAB2_0233"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor protein"
                     /protein_id="YP_418452.1"
                     /db_xref="GI:83269161"
                     /db_xref="GeneID:3828098"
                     /translation="MRIKAVIRARTFRQSLLLSSALMSLAAMPAYAQEKPKSDEQSGV
                     ILNRIVITSAPQSTPFKVVTDPKAPRQPVPASDGADYLKTIPGFSTIRNGGTNGDLVF
                     RGMFGSRVNIRTDGGVILGACGGRMDNPTSYISPESYDRMSVIKGPQTVQWGPAGSAA
                     TVLFERDPQHFDKLTLKGDSSILFGSNGRFDARVDATVGDKPGYIRMMANKSRANDYK
                     DGDGNRVPSKWDKWNTDLYLGLTPDADTVLEISGGLGDGEARYAGRAMDGSQFERQSF
                     GLKFSKSNVSDYLEKIEAQLYYNYADHIMDNFRLRPPQKMPMESEVDRRSMGGRVSTT
                     WNFDEHRLVAGLDFQTDTHRGKEKVNMQLTDNWLKDAQFANYGVFGEWTWNFADNQRL
                     VAGGRIDRASVEDDRASSLTYGDKRNQAAFSGFIRHEQDWSSLPVNSYIGLGYVNRFP
                     DYWELFSPKGVTGSALNAFEGIESEKTVQVDFGAQYSEGDTDIWASGYFGVINDFILF
                     DYSNPGGSVATNVNARIMGAELGVSRQFANYWKAEASIAYAWGQNTTYDEPLPQIPPL
                     EGRLGLTYERDNWSVGALWRLVAAQTRIAENMGNVVGKDFDKSAGFGVFSVNGTYRFN
                     ESVRLSLGVDNLFNKEYTEHLNRDGDAGFGFSSNYQLREPGRTFWAKTDFKF"
     misc_feature    228591..230435
                     /locus_tag="BAB2_0233"
                     /note="TonB-dependent copper receptor; Region:
                     TonB-copper; TIGR01778"
                     /db_xref="CDD:233571"
     misc_feature    228591..230435
                     /locus_tag="BAB2_0233"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(228591..228611,228645..228674,228708..228713,
                     228714..228722,228741..228764,228813..228845,
                     228879..228902)
                     /locus_tag="BAB2_0233"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(229314..229316,229365..229367)
                     /locus_tag="BAB2_0233"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            230606..231787
                     /locus_tag="BAB2_0234"
                     /db_xref="GeneID:3828099"
     CDS             230606..231787
                     /locus_tag="BAB2_0234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418453.1"
                     /db_xref="GI:83269162"
                     /db_xref="GeneID:3828099"
                     /translation="MQFSMWTYPWDIQDLGLDMVCSDLREKVGGNTISLATSYHAGRF
                     FQPRSPQQKAYFPEDGTIYYTPDEALWEGKEIRPLVAKNCIERGDMLQRLIERRREGG
                     GLRVSCWTVGLHNSRLGELHPDHVTRNAFGNANYYNLCPSSPAARDYVVTLVADITSR
                     YQPDMVELESVNFMGFAHEHHHEKDGVGLTDEDDFFMSLCFCDHCKARAKAAGVDIDN
                     AQAVVKGFIAEACEREVPQKQFADFPQAGISAFAKWPSLYAFLQWRTEPVTSLIGEIR
                     AVADPASRIVLIDLKDGWLGGVDLEEAVRACDGIILCCYDMGAEQIEKTIRDARSRLP
                     ADKYVGLGLSLFYSLVKSKEEFAARVDAGKRAGVDGINFYNYGLIPQKRLEWIGAALA
                     R"
     misc_feature    230780..>231112
                     /locus_tag="BAB2_0234"
                     /note="Glycosyl hydrolase like GH101; Region: DUF187;
                     pfam02638"
                     /db_xref="CDD:251441"
     gene            complement(231881..232675)
                     /locus_tag="BAB2_0235"
                     /db_xref="GeneID:3828100"
     CDS             complement(231881..232675)
                     /locus_tag="BAB2_0235"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family regulatory protein"
                     /protein_id="YP_418454.1"
                     /db_xref="GI:83269163"
                     /db_xref="GeneID:3828100"
                     /translation="MDKLHIEPTAKRSRGLERAFEILDYLRVSRAPANPNEIAARIKA
                     PRSTVYELVNLLLSNGVLEYCDDEGRVYLGRKLYFLGVAYEDHFNFIRECDRALSKVA
                     EQTRETAQFCMLDENKYTVVRMHEGARPFRISSDVGQRVPIPWTASGRLLLSHLNDAE
                     ILAFIPPEDFQLPNGQWLAPEVFLREVHAAREARAFTFDSIVDSFTHCFAVPVENDHG
                     KFCATVCLVAPRDDGIRNHDMYLQSLREAALSLKGKVSAFQRDQSV"
     misc_feature    complement(231911..232636)
                     /locus_tag="BAB2_0235"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(232367..232636)
                     /locus_tag="BAB2_0235"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(231923..232291)
                     /locus_tag="BAB2_0235"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            232977..233516
                     /gene="rbsB-3"
                     /locus_tag="BAB2_0236"
                     /pseudo
                     /db_xref="GeneID:3827828"
     misc_feature    232977..233516
                     /gene="rbsB-3"
                     /locus_tag="BAB2_0236"
                     /note="ribose ABC transporter, periplasmic
                     D-ribose-binding protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12402.1"
     gene            233513..234043
                     /gene="rbsB-3"
                     /locus_tag="BAB2_0237"
                     /pseudo
                     /db_xref="GeneID:3827829"
     misc_feature    233513..234043
                     /gene="rbsB-3"
                     /locus_tag="BAB2_0237"
                     /note="ribose ABC transporter, periplasmic
                     D-ribose-binding protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12403.1"
     gene            234076..235584
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /db_xref="GeneID:3827826"
     CDS             234076..235584
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418455.1"
                     /db_xref="GI:83269164"
                     /db_xref="GeneID:3827826"
                     /translation="MDAPAPLLEARNVFKGFFGNPVLKGVSIALRPGRVHALLGENGA
                     GKSTLINLLSGALPPDSGNIVLEGAALSRLNPAQARKAGIAVIQQELSLTPELSIAEN
                     IGLGAYPRRFGLIDYKALHGEALAVCKRVGLTEPLETPVGTLSLGRRQMVEIAKALFR
                     KPRVLILDEPTSSLSAHEAGVLSSLVLKLRDEGVALLYISHRLNEIRSLCSHVTVLKD
                     GVVTADQSLSNSDPEELVRLMVGRDTGDLFPAWRTSATGEKRIHIRGMSAGMVQNVDM
                     DANAGEIIGIGGLVGQGQEDFLLGLYGALPTAAREAIVCGNNGLFKSVGAANAAGLAY
                     VPADRKREGLVLPHSIASNLLLPSLDRYTRHGLRNTANEQRVVAKLAERLTIRGDTAR
                     PVQALSGGNQQKVALAKWLPLEPTILLLNDPTRGVDIETKREIYLMLRRFADEGKLVV
                     LLSSDTPELVHLCDRVMVFREGRMVATLKHGDLSEEAIVGAAMGLKSSRKAA"
     misc_feature    234076..235557
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    234097..234747
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    234193..234216
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(234202..234207,234211..234219,234340..234342,
                     234577..234582,234676..234678)
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    234331..234342
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    234505..234534
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    234565..234582
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    234589..234600
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    234664..234684
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    234844..235497
                     /gene="rbsA-4"
                     /locus_tag="BAB2_0238"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            235584..236543
                     /gene="rbsC-5"
                     /locus_tag="BAB2_0239"
                     /db_xref="GeneID:3827831"
     CDS             235584..236543
                     /gene="rbsC-5"
                     /locus_tag="BAB2_0239"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418456.1"
                     /db_xref="GI:83269165"
                     /db_xref="GeneID:3827831"
                     /translation="MQQDMAGNLYIAVQRRRNRGLIGLYAVVGIFVLLYAWLFPGILS
                     VSGFSKFTQNWFPLALVTMAQALLMLNGGITLAIGPLVSLGAVIAATTMGSAFGVFGG
                     VAAVILSGFVIGALTGSIVAFMRLPAIIVTLAGSFIITGIALLILPRPGGYIPGWLSD
                     FLAGHSPSAFIILVLVILGWKLFLATPMGLGIYAAGENPVGAYRSGVPVEKVKVISFA
                     LSGVLATCAGLFVAAQTGSGDPVIGTPFTLNSIAAAVLGGVGFLGGKGTMRGAICGSL
                     LLSVMINVMFFLGFPPVAQYIAQGLIIVGAVALPEFAGKWRKS"
     misc_feature    235752..236510
                     /gene="rbsC-5"
                     /locus_tag="BAB2_0239"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    236181..236237
                     /gene="rbsC-5"
                     /locus_tag="BAB2_0239"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            236540..237493
                     /gene="rbsC-4"
                     /locus_tag="BAB2_0240"
                     /db_xref="GeneID:3827830"
     CDS             236540..237493
                     /gene="rbsC-4"
                     /locus_tag="BAB2_0240"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418457.1"
                     /db_xref="GI:83269166"
                     /db_xref="GeneID:3827830"
                     /translation="MNSLPLTGRRLLQSPPLLTLLLVALVWLVASLTLRGFGAYGHLR
                     YLLELAAVIGIVAAGQTLVIIVGGIDLSVGAVMTVTAILLPVISPDWDPTGLLGVVMV
                     LAIAAIIGAVNGIGAAWLRVPPIIMTLAMATFLQGLLVIVAGGSAVSVNNAAAIFLGS
                     ARPFGIPASIILWVAVTAVVLVLLHKMPTGARFLALGANPVATRLSGVNVNRNMVALY
                     ALSAFFAGLAGIVLLGMNRQGYVGIGEPYVLLSIAAVVLGGTSILGGRGTYAGTIPGA
                     ILLVTTTALITMVNASPGLRSILFGSLILGLLMISGREARR"
     misc_feature    236687..237472
                     /gene="rbsC-4"
                     /locus_tag="BAB2_0240"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    237140..237196
                     /gene="rbsC-4"
                     /locus_tag="BAB2_0240"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            237493..237912
                     /locus_tag="BAB2_0241"
                     /db_xref="GeneID:3828101"
     CDS             237493..237912
                     /locus_tag="BAB2_0241"
                     /codon_start=1
                     /transl_table=11
                     /product="YjgF-like protein:endoribonuclease L-PSP"
                     /protein_id="YP_418458.1"
                     /db_xref="GI:83269167"
                     /db_xref="GeneID:3828101"
                     /translation="MRLYSGPVIEPYPSNTPQNITRNASMIMRYQKGSRMSQAVSYGG
                     LVHIAGQVANDRKAGIEEQTRDVLGKIDVLLKEAGTDRSKLLAVNVFLPAIVDFDAMN
                     AVYDAWIDAENPPARACVEARLADPDLRVEMTAIAAL"
     misc_feature    237595..237906
                     /locus_tag="BAB2_0241"
                     /note="This group of proteins belong to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function.  The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence...; Region:
                     YjgF_YER057c_UK114_like_2; cd06150"
                     /db_xref="CDD:100007"
     misc_feature    order(237598..237603,237610..237612,237616..237618,
                     237625..237627,237631..237633,237637..237642,
                     237742..237744,237748..237753,237757..237759,
                     237763..237765,237796..237798,237805..237807,
                     237817..237819,237832..237858,237886..237888,
                     237892..237894,237898..237900)
                     /locus_tag="BAB2_0241"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100007"
     misc_feature    order(237598..237600,237784..237786,237796..237798,
                     237841..237843,237886..237888)
                     /locus_tag="BAB2_0241"
                     /note="putative active site [active]"
                     /db_xref="CDD:100007"
     gene            complement(238120..238782)
                     /locus_tag="BAB2_0242"
                     /db_xref="GeneID:3828102"
     CDS             complement(238120..238782)
                     /locus_tag="BAB2_0242"
                     /note="in Escherichia coli this inner membrane protein was
                     found to anchor the periplasmic catalytic oxidoreductase
                     YedY; sulfite oxidase activity not demonstrated; contains
                     heme"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfite oxidase subunit YedZ"
                     /protein_id="YP_418459.1"
                     /db_xref="GI:83269168"
                     /db_xref="GeneID:3828102"
                     /translation="MAAATGTRKKKTPRPGQWKLWLLYTAGFVPAVWTFYLGATGQLG
                     ADPVKTFEHLLGLWALRFLILTLLVTPIRDLTGITLLRYRRALGLLAFYYALMHFTTY
                     MVLDQGLNLSAIITDIVRRPFITIGMISLALLVPLALTSNNWSIRKLGRRWSSLHKLV
                     YIAIAGSAVHFLMSVKSWPAEPVIYAAIVAALLLWRLARPYLRTRKPALRPRGEAIAL
                     RK"
     misc_feature    complement(238147..238749)
                     /locus_tag="BAB2_0242"
                     /note="putative sulfite oxidase subunit YedZ; Reviewed;
                     Region: PRK05419"
                     /db_xref="CDD:235452"
     gene            complement(238784..239743)
                     /locus_tag="BAB2_0243"
                     /db_xref="GeneID:3828103"
     CDS             complement(238784..239743)
                     /locus_tag="BAB2_0243"
                     /note="in Escherichia coli this periplasmic enzyme was
                     found to encode the periplasmic catalytic subunit of an
                     oxidoreductase; sulfite oxidase activity not demonstrated;
                     requires inner membrane anchor protein YedZ"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfite oxidase subunit YedY"
                     /protein_id="YP_418460.1"
                     /db_xref="GI:83269169"
                     /db_xref="GeneID:3828103"
                     /translation="MSSFKPSRFSTARLTGDAVTPKSIYLRRREFMIGLGAIAATGAA
                     SSAFADPLEAKTTAYKVDEKLTPQNAVTTYNNFYEFGTDKSDPSANSGSFKPLPWKLT
                     VDGLVKQPKEFDVEELIAKMPLEERIYRMRCVEAWSMVIPWIGFPLSSLLSQVEPLGS
                     AKYIAFTGVVRPDEMPGQTGLFQALNWPYVEGLRLDEAMHPLTILSVGLYGETLPNAN
                     GAPIRLVVPWKYGFKGIKAITRISFVEKQPPTSWNRQAANEYGFYANVNPAVDHPRWS
                     QATERRIGEGGFFGSDRRPTLPFNGYGEEVASLYAGMDLKANY"
     misc_feature    complement(238877..239671)
                     /locus_tag="BAB2_0243"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(238877..239530)
                     /locus_tag="BAB2_0243"
                     /note="YedY_like molybdopterin cofactor (Moco) binding
                     domain, a subgroup of the sulfite oxidase (SO) family of
                     molybdopterin binding domains. Escherichia coli YedY has
                     been propsed to form a heterodimer, consisting of a
                     soluble catalytic subunit termed YedY; Region:
                     YedY_like_Moco; cd02107"
                     /db_xref="CDD:239025"
     misc_feature    complement(order(239036..239038,239042..239044,
                     239051..239053,239075..239077,239090..239092,
                     239177..239179,239240..239242,239345..239347,
                     239507..239521))
                     /locus_tag="BAB2_0243"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:239025"
     misc_feature    complement(239345..239347)
                     /locus_tag="BAB2_0243"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:239025"
     gene            240166..241032
                     /locus_tag="BAB2_0244"
                     /db_xref="GeneID:3828104"
     CDS             240166..241032
                     /locus_tag="BAB2_0244"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase/lipase/thioesterase, active site"
                     /protein_id="YP_418461.1"
                     /db_xref="GI:83269170"
                     /db_xref="GeneID:3828104"
                     /translation="MAVLAAAALMISAGLYLAEEQPVVAVKAQNRAANAIAASMKEDK
                     SAPKLGEGMTMREKKKMDTDVTPEQNFSRSKQFIYRFYKPENASNELIVLLHGSGGNE
                     TSLVPLATKIWPRATLLGIRGRVMQDGDTRWYRRITPVKFDQKDVKLEANAFVTFLTR
                     LADNKDLDLAHATFVGYSNGANLLAATMLLHPDLVKRAVLMRSMPVLDDAPVANLGKA
                     HVLTIAGEHDKLYSPYAPALSAILRASGARVDARTIDADHMLGEKDIATIRQWVDSLG
                     PDGGPTVSMKAR"
     misc_feature    240379..240996
                     /locus_tag="BAB2_0244"
                     /note="Predicted esterase [General function prediction
                     only]; Region: COG0400"
                     /db_xref="CDD:223477"
     misc_feature    240415..>240762
                     /locus_tag="BAB2_0244"
                     /note="putative hydrolase; Provisional; Region: PRK11460"
                     /db_xref="CDD:183144"
     gene            complement(241181..242155)
                     /locus_tag="BAB2_0245"
                     /db_xref="GeneID:3828105"
     CDS             complement(241181..242155)
                     /locus_tag="BAB2_0245"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding motif-containing protein"
                     /protein_id="YP_418462.1"
                     /db_xref="GI:83269171"
                     /db_xref="GeneID:3828105"
                     /translation="MPTVAPFDLEGHCLYARFIGGIPFFAMADGAVHRLDDGHQTSTV
                     HDGLLSAAMAVDGKSLVTGGEDGRVCRIDAKGVVTELANIPRKWITAVATGPNGTVGF
                     ASGKTAWSRAADGKVQEFTQERSVEGIAFAPKGQRLAIARYNGATLIWTGTAAKPVEL
                     EWKGAHIGITFSPDGRFLITSMQENALHGWRLEDNKHMRMTGYPAKVKDWSWSAKAKW
                     LATSGAPAAIVWPFAGKDGPMGKAPLELGLRGDSMVTSVACHPGEDIAAIGYNDGMIL
                     IVRFADQKEVLLRRPGKGAITSMAWDEDGYRLVFGSQAGDCGVVPLNE"
     misc_feature    complement(241217..242152)
                     /locus_tag="BAB2_0245"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    complement(241199..242041)
                     /locus_tag="BAB2_0245"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    complement(order(241208..241210,241226..241228,
                     241283..241288,241319..241324,241340..241342,
                     241355..241357,241403..241408,241448..241450,
                     241466..241468,241493..241495,241547..241552,
                     241583..241588,241604..241606,241619..241621,
                     241658..241660,241703..241708,241724..241726,
                     241739..241741,241787..241792,241826..241831,
                     241847..241849,241901..241903,241907..241909,
                     241943..241948,241958..241960,241970..241972,
                     242021..242023))
                     /locus_tag="BAB2_0245"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     gene            complement(242274..243413)
                     /locus_tag="BAB2_0246"
                     /db_xref="GeneID:3828106"
     CDS             complement(242274..243413)
                     /locus_tag="BAB2_0246"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthesis protein P47K"
                     /protein_id="YP_418463.1"
                     /db_xref="GI:83269172"
                     /db_xref="GeneID:3828106"
                     /translation="MAEAEATATTEAGRIPVTVLTGYLGSGKTTLLNRILTENHGKRY
                     AVIVNEFGEIGIDNDLIVESDEEIYEMNNGCICCTVRGDLIRVVEGLMRRPGRFDAIV
                     VETTGLADPVPVAQTFFMDDDVRAKTGLDAVVALVDAKHLPLRLKDSREAEDQIAFAD
                     VVLINKTDLVTPEELAAVEATVRAINPHAIIHRTERASIPLDRVLDRGAFDLKRVLDN
                     DPHFLDHDDPDHVCCPDCDHDHHHQGHHHHGHDHHHHDHHDHDHVCGPDCDHDHDHDH
                     ASPIHDVTVKSVSLRTGEIDPAKFFPWIQNITQTQGPNILRLKGIIAFKDDPDRYVVQ
                     GVHMIIEGDHQRAWKPEEKHESRLVFIGRELDPAALKAGFENCRA"
     misc_feature    complement(242277..243371)
                     /locus_tag="BAB2_0246"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    complement(242907..243368)
                     /locus_tag="BAB2_0246"
                     /note="The function of this protein family is unkown. The
                     amino acid sequence of YjiA protein in E. coli contains
                     several conserved motifs that characterizes it as a P-loop
                     GTPase. YijA gene is among the genes significantly induced
                     in response to DNA-damage...; Region: CobW_like; cd03112"
                     /db_xref="CDD:239386"
     misc_feature    complement(243327..243350)
                     /locus_tag="BAB2_0246"
                     /note="P-loop, Walker A motif; other site"
                     /db_xref="CDD:239386"
     misc_feature    complement(242910..242921)
                     /locus_tag="BAB2_0246"
                     /note="Base recognition motif; other site"
                     /db_xref="CDD:239386"
     misc_feature    complement(242280..242561)
                     /locus_tag="BAB2_0246"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; pfam07683"
                     /db_xref="CDD:254355"
     gene            complement(243649..244419)
                     /locus_tag="BAB2_0247"
                     /db_xref="GeneID:3828107"
     CDS             complement(243649..244419)
                     /locus_tag="BAB2_0247"
                     /EC_number="3.5.2.10"
                     /codon_start=1
                     /transl_table=11
                     /product="creatininase"
                     /protein_id="YP_418464.1"
                     /db_xref="GI:83269173"
                     /db_xref="GeneID:3828107"
                     /translation="MTDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVS
                     DALPADLNVNFLPAQPVGYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVM
                     LNAHGGNSPLMTIVATELRTRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETS
                     VMLALRPDLVDMAKARNFPNAQSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIA
                     ASAQAGEKLLAHAVSGFIDLLRDVDRFELARFNPKVMA"
     misc_feature    complement(243676..244407)
                     /locus_tag="BAB2_0247"
                     /note="Uncharacterized protein, putative amidase [General
                     function prediction only]; Region: COG1402"
                     /db_xref="CDD:224320"
     gene            244598..244825
                     /locus_tag="BAB2_0248"
                     /db_xref="GeneID:3828108"
     CDS             244598..244825
                     /locus_tag="BAB2_0248"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_418465.1"
                     /db_xref="GI:83269174"
                     /db_xref="GeneID:3828108"
                     /translation="MSKDNKAVVLYRLQSVARLTRTVLAARLLEQGLYAGQDAVMLQL
                     AAEDGLTPGILAQRLGVRPPTITKTITRLQG"
     misc_feature    244649..>244816
                     /locus_tag="BAB2_0248"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    244679..>244816
                     /locus_tag="BAB2_0248"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            244832..245089
                     /locus_tag="BAB2_0249"
                     /db_xref="GeneID:3828109"
     CDS             244832..245089
                     /locus_tag="BAB2_0249"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family regulatory protein"
                     /protein_id="YP_418466.1"
                     /db_xref="GI:83269175"
                     /db_xref="GeneID:3828109"
                     /translation="MVKRASETDQRQSHVYLTQAGLQTIKAIEKSIRKTEKDMLKGLD
                     KKDRKSLLKMLSRMEGNLVLRGAARVADEPETEPQEDDEAE"
     misc_feature    <244838..245014
                     /locus_tag="BAB2_0249"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            245236..246255
                     /locus_tag="BAB2_0250"
                     /db_xref="GeneID:3828110"
     CDS             245236..246255
                     /locus_tag="BAB2_0250"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LacI"
                     /protein_id="YP_418467.1"
                     /db_xref="GI:83269176"
                     /db_xref="GeneID:3828110"
                     /translation="MAQKIKLSTIADALGVSTATVSLALRDSPLVADQTREKIKEHAR
                     AIGYIYNRRAASLRTSRSGIVGVVVRDIMNPFFAEILKSIETELDRSRQTFILSNHYD
                     QLDKQRTFMDTLLQLGADGVIMSPAIGTPAEDIQLAEDNGLPVVLIARSVEGVHAPVF
                     RGDNAYGIGLATNHLISLGHTRIAMIGGTDQTSTGRDRYRGYVQAMEKAGLEVRPDWR
                     IPGSRTKQGGFEVAPQFLALKDKPTAAVCWNDLTAIGLMNGIARAGLVPGEDISVTGY
                     DDLEEAAIATPALTTVWNGQREVGRRAARALLDQLNGVEVSSTQELIRPELHIRQSTS
                     KPKHA"
     misc_feature    245248..246246
                     /locus_tag="BAB2_0250"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    245263..245412
                     /locus_tag="BAB2_0250"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(245281..245295,245299..245304,245311..245313,
                     245326..245331,245338..245340,245377..245379,
                     245386..245388,245395..245400,245404..245409)
                     /locus_tag="BAB2_0250"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    245377..245406
                     /locus_tag="BAB2_0250"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    245425..246228
                     /locus_tag="BAB2_0250"
                     /note="Ligand-binding domain of MalI, a transcription
                     regulator of the maltose system of Escherichia coli and
                     its close homologs from other bacteria; Region:
                     PBP1_MalI_like; cd06289"
                     /db_xref="CDD:107284"
     misc_feature    order(245425..245427,245464..245472,245479..245484,
                     245488..245493,245512..245526,245530..245532,
                     245563..245565,245572..245574,245581..245589,
                     245911..245913,245995..245997,246007..246009,
                     246016..246021)
                     /locus_tag="BAB2_0250"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107284"
     misc_feature    order(245461..245466,245473..245475,245608..245610,
                     245680..245682,245719..245721,245827..245829,
                     245902..245904,246064..246066,246115..246117)
                     /locus_tag="BAB2_0250"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107284"
     gene            246341..247315
                     /locus_tag="BAB2_0251"
                     /db_xref="GeneID:3828111"
     CDS             246341..247315
                     /locus_tag="BAB2_0251"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA potassium uptake protein"
                     /protein_id="YP_418468.1"
                     /db_xref="GI:83269177"
                     /db_xref="GeneID:3828111"
                     /translation="MTKRDTTILVLGNFDDYAVQRLSDEFNVQRMARGDTALLGSDWV
                     KDVKGIASMSKVSADLIDALPNLEIIGNFGVGYDAVDARHAGANNVMVTNTPDVLTEE
                     VADTTIGLLIDTVRELSKAQEFLRRGEWGKQVRYPLSKLSLRGRKVGIFGLGRIGKAV
                     ARRIEAFGLPIAYHNRRKAADVAYDYYPSLKELAGAVDTLILVAPGGAETTRAVNTEV
                     LQALGPEGVLINIGRGSVVDEEALAQALKDGTIAAAGLDVFANEPHVPQALLDAPNTV
                     LLPHIGSASVKTRRAMADLVVDNLIAWFDTGTAITPVPETVGVKAVRQ"
     misc_feature    246356..247252
                     /locus_tag="BAB2_0251"
                     /note="Hydroxy(phenyl)pyruvate Reductase,
                     D-isomer-specific 2-hydroxyacid-related dehydrogenase;
                     Region: HPPR; cd12156"
                     /db_xref="CDD:240633"
     misc_feature    246359..247288
                     /locus_tag="BAB2_0251"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    order(246500..246502,246560..246568,246635..246637,
                     247037..247039,247178..247180)
                     /locus_tag="BAB2_0251"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240633"
     misc_feature    order(246563..246568,246647..246649,246794..246808,
                     246860..246871,246947..246955,246968..246970,
                     247031..247039,247109..247111,247178..247180,
                     247184..247189)
                     /locus_tag="BAB2_0251"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240633"
     misc_feature    order(247037..247039,247124..247126,247178..247180)
                     /locus_tag="BAB2_0251"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240633"
     gene            complement(247401..248174)
                     /locus_tag="BAB2_0252"
                     /db_xref="GeneID:3828112"
     CDS             complement(247401..248174)
                     /locus_tag="BAB2_0252"
                     /EC_number="4.1.3.27"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="YP_418469.1"
                     /db_xref="GI:83269178"
                     /db_xref="GeneID:3828112"
                     /translation="MNPNIKKSSRPLVAVPTDVKPFENYVWHAAPEQYLAAAIEVAQV
                     TPLLVPSFGDKMDFDAILDAVDGLLVTGSKSNVHPSLYGVEPSEAFEPYDDARDATSL
                     PLIRAAIEKGVPVLAICRGLQELNVALGGTLATEIQGLAGRMDHRATDPESQAERFAI
                     RHPVKLNPNSCLAEILKEESVRVNSVHRQAIDKLAPRLEVEAVAEDGTVEAVSGKNAR
                     GFVVGVQWHPEYWVQSDAPSRRIFEAFGDAVREHRAVGQ"
     misc_feature    complement(247419..248153)
                     /locus_tag="BAB2_0252"
                     /note="Predicted glutamine amidotransferases [General
                     function prediction only]; Region: COG2071"
                     /db_xref="CDD:224982"
     misc_feature    complement(247437..248138)
                     /locus_tag="BAB2_0252"
                     /note="Subgroup of proteins having the Type 1 glutamine
                     amidotransferase (GATase1) domain; Region: GATase1_2;
                     cd01745"
                     /db_xref="CDD:153216"
     misc_feature    complement(order(247488..247490,247494..247496,
                     247818..247820))
                     /locus_tag="BAB2_0252"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153216"
     gene            248409..249158
                     /locus_tag="BAB2_0253"
                     /db_xref="GeneID:3827534"
     CDS             248409..249158
                     /locus_tag="BAB2_0253"
                     /EC_number="1.1.1.125"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase II"
                     /protein_id="YP_418470.1"
                     /db_xref="GI:83269179"
                     /db_xref="GeneID:3827534"
                     /translation="MTDDQLFSVRGKVIAVTGGSSGLGLRMVHVLAGHGARVISISRT
                     HAGESLCPSGGEVLEIMADVTRPEEIARAFDEGESRFGPISALFNNAGVAHMARALDT
                     TRDMLEHIFEVNVAGAFFTAQEVARRMIAQGQGGSIINVTSILGERPQKGAAAYSMSK
                     ACVSQMTRALALEWAAHDIRVNAISPGWFPTRINEEQLQGPAAGYLKGRNPMRRLGDP
                     NDLDGVVLLLASDASRYMTGSIITVDGGHQL"
     misc_feature    248409..249146
                     /locus_tag="BAB2_0253"
                     /note="gluconate 5-dehydrogenase; Provisional; Region:
                     PRK08213"
                     /db_xref="CDD:181295"
     misc_feature    248448..249140
                     /locus_tag="BAB2_0253"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(248460..248462,248466..248477,248532..248540,
                     248592..248600,248676..248684,248745..248747,
                     248829..248837,248874..248876,248886..248888,
                     248964..248975,248979..248984)
                     /locus_tag="BAB2_0253"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(248748..248750,248835..248837,248874..248876,
                     248886..248888)
                     /locus_tag="BAB2_0253"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            249139..249279
                     /locus_tag="BAB2_0254"
                     /db_xref="GeneID:3827535"
     CDS             249139..249279
                     /locus_tag="BAB2_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418471.1"
                     /db_xref="GI:83269180"
                     /db_xref="GeneID:3827535"
                     /translation="MVATSSDGNLPVHNPKAAMVAGVFAIVGDGSLPLSAFYVRLRRY
                     FP"
     gene            249524..251323
                     /locus_tag="BAB2_0255"
                     /pseudo
                     /db_xref="GeneID:3827536"
     misc_feature    249524..251323
                     /locus_tag="BAB2_0255"
                     /note="GGDEF:EAL domain"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12421.1"
     gene            251293..251820
                     /locus_tag="BAB2_0256"
                     /pseudo
                     /db_xref="GeneID:3827537"
     misc_feature    251293..251820
                     /locus_tag="BAB2_0256"
                     /note="EAL domain"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12422.1"
     gene            252073..253290
                     /locus_tag="BAB2_0257"
                     /db_xref="GeneID:3827538"
     CDS             252073..253290
                     /locus_tag="BAB2_0257"
                     /EC_number="3.5.1.46"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="YP_418472.1"
                     /db_xref="GI:83269181"
                     /db_xref="GeneID:3827538"
                     /translation="MKRLFRFALYLCVALIIFAGAGTVIFWKKINEYWAVYQYAQVFK
                     PDTINENFRSLYKKYPSVRVPHTGEVSPLPRGEQPLPETYTYKGETRKVADWLERTDT
                     TGFIVLKDGVVVHEQYERGNSETTQSIAMSLSKSFVSFLVGNAVRDGQIKLDQTVDHY
                     APLLKEGGYKEVTVKNVLQMSSGIGFNENYGDLNSDIVRYIVQMLTGSVDDFTAKLKN
                     EVPQGTINHYVSADTQVLAMVLEGATGVPFQKYFEDKLWSRLGAEADAYWLTDEKGDV
                     VAAGGLNAVLRDYARFGLLYMNEGRNYRGEQLVPAQWVHDSVTPDQPYLMPGRKDALG
                     KIPFGYGYQWWIPVEPEGDFCAVGIYGQFIYVNPAKHVVIAKTSAYPNYNIDGQKVKD
                     ESMYVFQAIANAL"
     misc_feature    252265..253287
                     /locus_tag="BAB2_0257"
                     /note="Beta-lactamase class C and other penicillin binding
                     proteins [Defense mechanisms]; Region: AmpC; COG1680"
                     /db_xref="CDD:224594"
     gene            253344..253454
                     /locus_tag="BAB2_0258"
                     /db_xref="GeneID:3827539"
     CDS             253344..253454
                     /locus_tag="BAB2_0258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418473.1"
                     /db_xref="GI:83269182"
                     /db_xref="GeneID:3827539"
                     /translation="MVPFQLTGKCKNGRNLRPFSCFPAAYLKRVYQRCAA"
     gene            253562..254308
                     /locus_tag="BAB2_0259"
                     /db_xref="GeneID:3827540"
     CDS             253562..254308
                     /locus_tag="BAB2_0259"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA recognition motif-containing protein"
                     /protein_id="YP_418474.1"
                     /db_xref="GI:83269183"
                     /db_xref="GeneID:3827540"
                     /translation="MTNRAVTGENPPLSNFARQLLQFLDRVEYRRIVHAEDLEEIGRL
                     RYRSYRTRNVMHEAEVPSIVDDIDRDSHAFVYGVHVDGQLVSTLRVHHITPDHRRGTS
                     YALFPDILDPLLNSGMHFVDPTRFAADPDLLSEYPAIPYITLRVAAMASEFFGADQCL
                     AAVKPEHMAFYKRIFGTTVMADAREHEGYGIKVGLGAAPIRNIRDAVAVRYPFFKSQP
                     HERRAMFADMHAGVVPLTILPTAKYTGLGA"
     misc_feature    253691..253954
                     /locus_tag="BAB2_0259"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_5; pfam13444"
                     /db_xref="CDD:257769"
     gene            254512..254736
                     /locus_tag="BAB2_0260"
                     /db_xref="GeneID:3827541"
     CDS             254512..254736
                     /locus_tag="BAB2_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418475.1"
                     /db_xref="GI:83269184"
                     /db_xref="GeneID:3827541"
                     /translation="MAEHHTTAPAELGAPMDYAEHEKTYAGFAGLVKWATVVLVALMI
                     AMAFGFFAGGFFSATVLFVLVCVVAWFLLS"
     misc_feature    254542..254643
                     /locus_tag="BAB2_0260"
                     /note="Bacterial aa3 type cytochrome c oxidase subunit IV;
                     Region: COX4_pro_2; pfam07835"
                     /db_xref="CDD:254461"
     gene            254960..256237
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /db_xref="GeneID:3828048"
     CDS             254960..256237
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RecA"
                     /protein_id="YP_418476.1"
                     /db_xref="GI:83269185"
                     /db_xref="GeneID:3828048"
                     /translation="MAQTLYIPKESDPNETRVAGSAETVKKFIALGFDVVVEKGAGEK
                     SRIPDAEFAAAGARIGTAVDAKTADVILKVRRPGDAELKAYKSGAALFAMLDPYGHED
                     AVAALARAGISAFTMEFMPRITRAQVMDVLSSQANLAGYQAVIDAAEVYDRAMPMMMT
                     AAGTVPAAKVFVMGAGVAGLQAIATARRLGAVVTATDVRPAAKEQVASLGAKFIAVED
                     DEFKAAETAGGYAKEMSKDYQAKQAALVADHIAKQDIVITTALIPGRPAPRLVSKEMV
                     ASMRPGSVLVDLAVERGGNVEGAVPGEIADVNGVKIVGYLNVPGRIAASASQLYARNL
                     IAFVETLVDKESKVLKIDPEEGLVKATLLTHQGRILHPAFAKAETAPAAVTEKAEKPK
                     AAPKAAAKPAKKAPAKAAKKPSSPKSPVDGGEA"
     misc_feature    254969..256063
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="NAD/NADP transhydrogenase alpha subunit [Energy
                     production and conversion]; Region: PntA; COG3288"
                     /db_xref="CDD:225826"
     misc_feature    254969..256060
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="Rubrum transdehydrogenase NAD-binding and catalytic
                     domains; Region: Rubrum_tdh; cd05304"
                     /db_xref="CDD:240629"
     misc_feature    order(255008..255010,255182..255184,255239..255241,
                     255830..255832,255908..255910,255914..255916)
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(255095..255097,255338..255343,255368..255373,
                     255380..255385,255392..255397,255401..255406,
                     255410..255427,255431..255433,255437..255445,
                     255452..255454,255521..255526,255800..255805,
                     255929..255934,255944..255946,255953..255958)
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(255323..255328,255338..255340,255347..255349,
                     255356..255358,255479..255490,255548..255556,
                     255650..255652,255683..255685,255734..255742,
                     255761..255763,255767..255769)
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(255329..255334,255338..255340,255368..255370,
                     255497..255502,255521..255523,255569..255574,
                     255578..255589)
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="trimer interface B [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(255428..255442,255449..255451,255458..255460,
                     255527..255529,255533..255535)
                     /gene="pntA"
                     /locus_tag="BAB2_0261"
                     /note="trimer interface A [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     gene            256237..256656
                     /gene="pntAB"
                     /locus_tag="BAB2_0262"
                     /db_xref="GeneID:3828049"
     CDS             256237..256656
                     /gene="pntAB"
                     /locus_tag="BAB2_0262"
                     /codon_start=1
                     /transl_table=11
                     /product="antifreeze protein"
                     /protein_id="YP_418477.1"
                     /db_xref="GI:83269186"
                     /db_xref="GeneID:3828049"
                     /translation="MADTNLDKALEGLNQAADAVRQAAENAGGFGDAAAAAAHAASGG
                     AIDPFIFRFAIFILSIFVGYYVVWSVTPALHTPLMAVTNAISSVIVVGALLAVGLSLS
                     GWATGFGFIALILASVNIFGGFLVTQRMLAMYKKKEK"
     misc_feature    256384..256644
                     /gene="pntAB"
                     /locus_tag="BAB2_0262"
                     /note="Domain of unknown function (DUF3814); Region:
                     DUF3814; pfam12769"
                     /db_xref="CDD:257285"
     gene            256669..258069
                     /gene="pntB"
                     /locus_tag="BAB2_0263"
                     /db_xref="GeneID:3828050"
     CDS             256669..258069
                     /gene="pntB"
                     /locus_tag="BAB2_0263"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="YP_418478.1"
                     /db_xref="GI:83269187"
                     /db_xref="GeneID:3828050"
                     /translation="MSVNLAAFLYLVSGVLFILALRGLSHPTTSRQGNMYGMIGMAIS
                     IVTTLLLARPSFGGLVLIIVGIAIGGGIGAVIARRIAMTAMPQLVAAFHSLIGLAAVL
                     VAAAALYSPHSFGIGEVGQIHGQALIEMSLGVAIGAITFTGSIIAFLKLDGRMSGKPI
                     MLPGRHVINAALAAAIVLLIVVLTNTESHFVFWLIVLLSLVFGVLIIVPIGGADMPVV
                     VSMLNSYSGWAAAGIGFTLGNLALIITGALVGSSGAILSYIMCKGMNRSFISVILGGF
                     GGDTSSAAGGEVEQRPVKQGSADDAAFILKNASKVIIVPGYGMAVAQAQHALREMADK
                     LKAEGVEVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINSEFATADVAFVIGA
                     NDVTNPAAKTDPKSPIFGMPILDVDKAGTVLFIKRGMGSGYAGVENELFFRDNTMMLF
                     ADAKKMVESIVKALDH"
     misc_feature    256669..258060
                     /gene="pntB"
                     /locus_tag="BAB2_0263"
                     /note="NAD/NADP transhydrogenase beta subunit [Energy
                     production and conversion]; Region: PntB; COG1282"
                     /db_xref="CDD:224201"
     gene            complement(258171..259487)
                     /locus_tag="BAB2_0264"
                     /db_xref="GeneID:3827542"
     CDS             complement(258171..259487)
                     /locus_tag="BAB2_0264"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_418479.1"
                     /db_xref="GI:83269188"
                     /db_xref="GeneID:3827542"
                     /translation="MTTNVALVGLARDLAARAETGKPIRIGLIGAGEMGTDIVTQVAR
                     MQGIEVGALSARRLPNTFKAIRTAYGDEENAREATTESAMTRAIEAGKIAVTDDNDLI
                     LSNPLIDVIIDATGIPEVGAETGIAAIRNGKHLVMMNVEADVTIGPYLKAQADKQGVI
                     YSLGAGDEPSSCMELIEFVSALGYEVVSAGKGKNNPLNFDATPDDYRQEADRRNMNVR
                     LLVEFIDGSKTMVEMAAIANATGLVPDIAGMHGPRASIDQLSHTLIPQAEGGVLSKSG
                     VVDYSIGKGVSPGVFVVAKMDHPRLNERLEDLKIGKGPYFTFHRPYHLTSLEVPLTVA
                     RVVLHGKTDMVPLPKPVAEVCAVAKKDMQPGEHLDAIGQYCYRSWIMTVPEARAAKAI
                     PCGLLQNGTVIAPIKKGELITYANAAPQPGSRIAELRALQDAMLGQ"
     misc_feature    complement(258174..259469)
                     /locus_tag="BAB2_0264"
                     /note="Predicted homoserine dehydrogenase [Amino acid
                     transport and metabolism]; Region: COG4091"
                     /db_xref="CDD:226576"
     misc_feature    complement(<259062..259400)
                     /locus_tag="BAB2_0264"
                     /note="Homoserine dehydrogenase, NAD binding domain;
                     Region: NAD_binding_3; pfam03447"
                     /db_xref="CDD:251960"
     misc_feature    complement(258189..258428)
                     /locus_tag="BAB2_0264"
                     /note="SAF domain of putative dehydrogenases or
                     oxidoreductases; Region: SAF_DH_OX_like; cd11616"
                     /db_xref="CDD:212161"
     gene            259683..260354
                     /locus_tag="BAB2_0265"
                     /db_xref="GeneID:3827543"
     CDS             259683..260354
                     /locus_tag="BAB2_0265"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="YP_418480.1"
                     /db_xref="GI:83269189"
                     /db_xref="GeneID:3827543"
                     /translation="MNSAYPFDLFIFDCDGVLVDSEPLSCRAFEQVYADYGMALPEGT
                     VAQGIGMKQADIMQMIEDMTGYRLPEEAGAAFWPATRTLFAQALQPTVGIADFLRDLP
                     QKRCVASSSQPERIAFSLQKTGLDQYFGDAVYSSSMVKRGKPAPDLFLFAADKMGVDP
                     ARCVVIEDSPFGIEGAVAAGMTAFGYTGGGHSYDGHAEKLMAKGARQVFAHWDEMVRE
                     ILAAA"
     misc_feature    259698..260351
                     /locus_tag="BAB2_0265"
                     /note="Predicted phosphatase/phosphohexomutase [General
                     function prediction only]; Region: COG0637"
                     /db_xref="CDD:223710"
     misc_feature    259707..260237
                     /locus_tag="BAB2_0265"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(259719..259727,260007..260012)
                     /locus_tag="BAB2_0265"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    259719..259736
                     /locus_tag="BAB2_0265"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    260007..260009
                     /locus_tag="BAB2_0265"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            260429..260905
                     /locus_tag="BAB2_0266"
                     /db_xref="GeneID:3827544"
     CDS             260429..260905
                     /locus_tag="BAB2_0266"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC-like dehydratase"
                     /protein_id="YP_418481.1"
                     /db_xref="GI:83269190"
                     /db_xref="GeneID:3827544"
                     /translation="MKNAITLDQLRESIGTEIGCSEWREVTQEMINQFADATDDHQFI
                     HVDPERAAKETPFGGTIAHGFLTLSLLSTLAYEALPMLEGATMGINYGFDKLRFVSPV
                     KTGARVRARFKLADADIRPSGRVVNHYDVTLEIENSLKPALTATWLIITMVEPPEA"
     misc_feature    260441..260887
                     /locus_tag="BAB2_0266"
                     /note="NodN (nodulation factor N) contains a single hot
                     dog fold similar to those of the peroxisomal
                     Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the
                     fatty acid synthase beta subunit.  Rhizobium and related
                     species form nodules on the roots of their...; Region:
                     NodN; cd03450"
                     /db_xref="CDD:239534"
     misc_feature    order(260531..260533,260546..260548,260552..260554,
                     260561..260563,260609..260611,260618..260623)
                     /locus_tag="BAB2_0266"
                     /note="putative active site [active]"
                     /db_xref="CDD:239534"
     misc_feature    order(260546..260548,260552..260554,260561..260563,
                     260618..260620)
                     /locus_tag="BAB2_0266"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:239534"
     gene            complement(260980..261879)
                     /locus_tag="BAB2_0267"
                     /pseudo
                     /db_xref="GeneID:3827545"
     misc_feature    complement(260980..261879)
                     /locus_tag="BAB2_0267"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12433.1"
     gene            complement(261876..262175)
                     /locus_tag="BAB2_0268"
                     /pseudo
                     /db_xref="GeneID:3827546"
     misc_feature    complement(261876..262175)
                     /locus_tag="BAB2_0268"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12434.1"
     gene            262528..262755
                     /gene="rpsU"
                     /locus_tag="BAB2_0269"
                     /db_xref="GeneID:3827547"
     CDS             262528..262755
                     /gene="rpsU"
                     /locus_tag="BAB2_0269"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="YP_418482.1"
                     /db_xref="GI:83269191"
                     /db_xref="GeneID:3827547"
                     /translation="MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRA
                     REKAEAVRRARKLARKRAQREGLIGGRTGAR"
     misc_feature    262528..262680
                     /gene="rpsU"
                     /locus_tag="BAB2_0269"
                     /note="30S ribosomal protein S21; Reviewed; Region: rpsU;
                     PRK00270"
                     /db_xref="CDD:234707"
     gene            complement(263034..263195)
                     /locus_tag="BAB2_0270"
                     /db_xref="GeneID:3827548"
     CDS             complement(263034..263195)
                     /locus_tag="BAB2_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418483.1"
                     /db_xref="GI:83269192"
                     /db_xref="GeneID:3827548"
                     /translation="MSVPALCWFEPADKNSKEAAGKEITPPADAQPQSQAPFFVLHKM
                     MLEKSRNFS"
     gene            263289..264176
                     /locus_tag="BAB2_0271"
                     /db_xref="GeneID:3827549"
     CDS             263289..264176
                     /locus_tag="BAB2_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418484.1"
                     /db_xref="GI:83269193"
                     /db_xref="GeneID:3827549"
                     /translation="MLQLAMRLKVMQLSETEVSGIEASGGAGRNGLIIAAALLALTVA
                     GCQSTNSTLSTVDRAQGSSENISSLTSVIQSNPRDPEGYNVRGSAYGKAGRYKEAMRD
                     FDQAIALNPNFYQAYANRALVDRYMGDNNKAVQDYSRAIQLNPQYDAAYIGRGNVYRQ
                     AGHLDQALNDFNQAIALRTTDGRAYHNRGLIYQAKGLHKQAIEDFSKAISLNSTAPEP
                     YNGRGISYVALGDYDNAFDDFNTAITLDQNVAESWANQALVYEHNGDKAKAANSYARA
                     VQLDPKYKPAKDGLARTRG"
     misc_feature    263412..264101
                     /locus_tag="BAB2_0271"
                     /note="type IV pilus biogenesis/stability protein PilW;
                     Region: type_IV_pilW; TIGR02521"
                     /db_xref="CDD:131573"
     misc_feature    263544..263819
                     /locus_tag="BAB2_0271"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(263547..263549,263583..263585,263595..263597,
                     263604..263606,263649..263651,263685..263687,
                     263697..263699,263706..263708,263751..263753,
                     263787..263789,263799..263801,263808..263810)
                     /locus_tag="BAB2_0271"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(263550..263555,263640..263645,263649..263654,
                     263661..263666,263742..263747,263754..263759,
                     263766..263771)
                     /locus_tag="BAB2_0271"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    263736..264032
                     /locus_tag="BAB2_0271"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(263736..263738,263742..263747,263754..263759,
                     263844..263849,263853..263858,263865..263870,
                     263946..263951,263958..263963,263970..263975)
                     /locus_tag="BAB2_0271"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(263751..263753,263787..263789,263799..263801,
                     263808..263810,263853..263855,263889..263891,
                     263901..263903,263910..263912,263955..263957,
                     263991..263993,264003..264005,264012..264014)
                     /locus_tag="BAB2_0271"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    263943..>264161
                     /locus_tag="BAB2_0271"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(263946..263951,263958..263963,264048..264053,
                     264057..264062,264069..264074,264150..264155)
                     /locus_tag="BAB2_0271"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(263955..263957,263991..263993,264003..264005,
                     264012..264014,264057..264059,264093..264095,
                     264105..264107,264114..264116,264159..264161)
                     /locus_tag="BAB2_0271"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            264268..264675
                     /locus_tag="BAB2_0272"
                     /db_xref="GeneID:3827550"
     CDS             264268..264675
                     /locus_tag="BAB2_0272"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418485.1"
                     /db_xref="GI:83269194"
                     /db_xref="GeneID:3827550"
                     /translation="MSLFDHIGFKARDINRSLSFYESCMPELGLDVIARSGSGFFVSG
                     GERAPVPFLWIYGGDPAGEHGEDRPGDRLHLMFTAGSREEVEAFYKAAIRAGGKDSGS
                     PSYQGPEEMGYYAALVFDPDGNTLEAGFRERKR"
     misc_feature    264277..264651
                     /locus_tag="BAB2_0272"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_19; cd07262"
                     /db_xref="CDD:176683"
     gene            complement(264688..265353)
                     /locus_tag="BAB2_0273"
                     /db_xref="GeneID:3827551"
     CDS             complement(264688..265353)
                     /locus_tag="BAB2_0273"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418486.1"
                     /db_xref="GI:83269195"
                     /db_xref="GeneID:3827551"
                     /translation="MSQAMLDLLWRSFWETIIMTGFSSLISLVVGLPLALIMILTERG
                     GLAQNLTLNTILGAIINGFRSVPFIILLVALIPVTRFIVGTSIGTWASIVPLSIAAIP
                     YYARIAEVSLREVDHGLIEAARSMGANRWTIVREVLIPEALPGIIAGFTVTVITLIGA
                     SAMAGAIGAGGLGDLAIRYGYQRFETQVMIAVVIILIIMVCGIQWVGDRLVNRLDKRN
                     LRA"
     misc_feature    complement(264697..265344)
                     /locus_tag="BAB2_0273"
                     /note="ectoine/hydroxyectoine ABC transporter, permease
                     protein EhuC; Region: ectoine_ehuC; TIGR03004"
                     /db_xref="CDD:132049"
     misc_feature    complement(264754..265317)
                     /locus_tag="BAB2_0273"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264754..264759,264766..264771,
                     264775..264780,264787..264792,264817..264819,
                     264856..264861,264868..264879,264898..264900,
                     264907..264912,264952..264954,265003..265005,
                     265012..265017,265027..265029,265033..265038,
                     265045..265047,265051..265053,265057..265062,
                     265126..265128,265132..265137,265144..265173,
                     265177..265188,265237..265239,265252..265257,
                     265264..265269))
                     /locus_tag="BAB2_0273"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264862..264879,265126..265170))
                     /locus_tag="BAB2_0273"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264790..264792,264823..264825,
                     264859..264861,265075..265077,265126..265128))
                     /locus_tag="BAB2_0273"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264931..264933,264943..264948,
                     264964..265002))
                     /locus_tag="BAB2_0273"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(265334..266392)
                     /locus_tag="BAB2_0274"
                     /db_xref="GeneID:3827552"
     CDS             complement(265334..266392)
                     /locus_tag="BAB2_0274"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418487.1"
                     /db_xref="GI:83269196"
                     /db_xref="GeneID:3827552"
                     /translation="MTIEKPPATSAPIVEMKDVRRMFGETAAINGVSLSVARGEILGI
                     IGRSGAGKSTLIRCVNGLEKPDTGSIHIEGREITSLDEDALRPVRRRIGMVFQHFNLL
                     SAKTAAQNIALPLKIAGMPKAERIKRVAELLELVGLSDKASHYPAQLSGGQKQRVGIA
                     RALAAEPAVLLSDEATSALDPETTQSILALLKDINAKLGLTILLITHEMDVIRRIADR
                     VIVLDHGLIAEEGPVWKVFANPQSPVTQSMLQVLTPELPAIWRNRLEKKGDQAILRVK
                     LSGMAAKGAFFNDVAAATSLAPQLIHGGMDTIQGEPVGTLFIGLPAEDKTKLKAAIGY
                     LNTHADATEVLGYVSGNA"
     misc_feature    complement(265352..266356)
                     /locus_tag="BAB2_0274"
                     /note="ABC-type metal ion transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: AbcC; COG1135"
                     /db_xref="CDD:224058"
     misc_feature    complement(265670..266356)
                     /locus_tag="BAB2_0274"
                     /note="ATP-binding cassette domain of methionine
                     transporter; Region: ABC_MetN_methionine_transporter;
                     cd03258"
                     /db_xref="CDD:213225"
     misc_feature    complement(266234..266257)
                     /locus_tag="BAB2_0274"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(order(265772..265774,265871..265876,
                     266102..266104,266231..266239,266243..266248))
                     /locus_tag="BAB2_0274"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(266102..266113)
                     /locus_tag="BAB2_0274"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(265919..265948)
                     /locus_tag="BAB2_0274"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(265871..265888)
                     /locus_tag="BAB2_0274"
                     /note="Walker B; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(265853..265864)
                     /locus_tag="BAB2_0274"
                     /note="D-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(265766..265786)
                     /locus_tag="BAB2_0274"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(265358..265588)
                     /locus_tag="BAB2_0274"
                     /note="This domain is found at the C-terminus of ABC
                     transporter proteins involved in D-methionine transport as
                     well as a number of ferredoxin-like proteins; Region: NIL;
                     smart00930"
                     /db_xref="CDD:197998"
     gene            complement(266857..267693)
                     /locus_tag="BAB2_0275"
                     /db_xref="GeneID:3827553"
     CDS             complement(266857..267693)
                     /locus_tag="BAB2_0275"
                     /codon_start=1
                     /transl_table=11
                     /product="YaeC family lipoprotein"
                     /protein_id="YP_418488.1"
                     /db_xref="GI:83269197"
                     /db_xref="GeneID:3827553"
                     /translation="MSSVLSRYALTRRAGLKALLFTAAALTVGFASAPSHAEDKTIKV
                     GIMGGEDEDVWKVVAEEGKKHGLNIERITFNDYNQPNETLERKEIDANAFQHKPYLDE
                     QIKQHGYKISVAGYTAVWPIGIYSRKVKKLEELKDGATVGVPNDPTNEGRALRVLEEQ
                     GLIKLKPDAGILATPIDIVENPKKLEIKELDAGVVGRSIDDLDAAIVNNDWAAKAGLK
                     KEDAIGWESKENNPYNNFIAVRTDDLDQPWVKALVASFQNDAVKTELERAYKGTGIPA
                     WN"
     misc_feature    complement(266863..267648)
                     /locus_tag="BAB2_0275"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface antigen [Inorganic ion transport and
                     metabolism]; Region: NlpA; COG1464"
                     /db_xref="CDD:224381"
     gene            complement(267787..267930)
                     /locus_tag="BAB2_0276"
                     /db_xref="GeneID:3827763"
     CDS             complement(267787..267930)
                     /locus_tag="BAB2_0276"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418489.1"
                     /db_xref="GI:83269198"
                     /db_xref="GeneID:3827763"
                     /translation="MNGFSIAAAAEMAIRSPLRERNFKIADLTFSEIIFLVYYPTKRN
                     YRH"
     gene            complement(267927..269525)
                     /locus_tag="BAB2_0277"
                     /db_xref="GeneID:3827764"
     CDS             complement(267927..269525)
                     /locus_tag="BAB2_0277"
                     /EC_number="1.1.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-methanol-choline oxidoreductase"
                     /protein_id="YP_418490.1"
                     /db_xref="GI:83269199"
                     /db_xref="GeneID:3827764"
                     /translation="MTDTYDYIVVGAGTAGCALANRLSADQNRSVLLLEAGGKDNYAW
                     IHIPVGYLYCIGNPRTDWCFTTEAEPGLNGRSLNYPRGKVLGGCSSINGMIYMRGQAC
                     DYDLWRQAGCDGWGWDDVLPLFKKSEDYFAGASALHGMGGEWRVENARLHWDILDAFR
                     DAALAAGIPATDDFNRGDNEGVSYFKVNQKHGIRWNTAKAFLRPALDRKNLTVETGAH
                     VRCIEIEGLRATGVTFDQDGNIRTVKARREVILAAGAVGSPQILELSGIGRGDVLQQA
                     GIPLKLERRQLGENLQDHLQLRCAYKVTGIATLNEKASTLVGKAMIGLEYLLRRSGPM
                     AMAPSQLGVFTRSDPSYETANLQYHVQPLSLEKFGDAVHPFPTFTASVCNLRPESRGS
                     IHIKSPDHRAQPAIRPNYLATETDRRIAADAIRLTRHIVSQAPLQKYRPEEFKPGPNY
                     ATQEDLEKAAGDIGTTIFHPVGTCRMGQDAEAIVDPRLRFNGIAGLRVADASIMPAIT
                     SGNTNSPTLMIAEKAAQMIIADNR"
     misc_feature    complement(267945..269525)
                     /locus_tag="BAB2_0277"
                     /note="choline dehydrogenase; Validated; Region: PRK02106"
                     /db_xref="CDD:235000"
     misc_feature    complement(<269394..269510)
                     /locus_tag="BAB2_0277"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(268641..269309)
                     /locus_tag="BAB2_0277"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(267963..268367)
                     /locus_tag="BAB2_0277"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(269589..270572)
                     /locus_tag="BAB2_0278"
                     /db_xref="GeneID:3827765"
     CDS             complement(269589..270572)
                     /locus_tag="BAB2_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418491.1"
                     /db_xref="GI:83269200"
                     /db_xref="GeneID:3827765"
                     /translation="MVDTTLKANAAYSKAPALNSLSAIVLGIALVGLIAAPFMVYPIF
                     LMKMLCFALFASAFNLLLGYTGILSFGHAAFFGGAAYVTAHAVKEWGVSPELGLVLGI
                     LAAAALGLVIGYLAIRRQGIYSTMITLALAQMFFFFCLQASFTHGEDGLQGVPRGFLF
                     GFIDLNQPMNMYYFVLAVFVLGVFAIWRITNSPFGMILKSVRENENRAISLGFSVNHY
                     KLAAFVMSAGLAGLAGGMKALVFQFATLTDVSWQMSGEVILMTLLGGIGTLIGPIVGA
                     AFVVALQNWLATSDFPVTIVTGLIFMACVLLFRKGIIGEFYASRIGKKLFG"
     misc_feature    complement(269631..270431)
                     /locus_tag="BAB2_0278"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(269901..269957)
                     /locus_tag="BAB2_0278"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(270574..271461)
                     /locus_tag="BAB2_0279"
                     /db_xref="GeneID:3827766"
     CDS             complement(270574..271461)
                     /locus_tag="BAB2_0279"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418492.1"
                     /db_xref="GI:83269201"
                     /db_xref="GeneID:3827766"
                     /translation="MVMIFGIPLQALLGQLLVGLINGSFYAMLSLGLAIIFGLLRIIN
                     FAHGAQYMLGAFVGYLLLSWLGISYWPALVLAPLIVGLGGAIIERVALSRLYNLDPLY
                     GLLFTFGLALVIEGTFRYYYGAAGQPYAVPPSLAGGRNLGFMFLPNYRAWVVVASLFV
                     CLGTWLLIEKTKLGAYLRAATENPTLVKAFGINVPLLLTFTYALGSALAGLAGIMAAP
                     IYQVSPLMGSNIIIVVFAVVVVGGMGSILGAIITGYVLGIAEGLTKVFYPEASSIVVF
                     VIMAIVLLVRPAGLFGKEA"
     misc_feature    complement(270589..271407)
                     /locus_tag="BAB2_0279"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    complement(270853..270909)
                     /locus_tag="BAB2_0279"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            complement(271466..272191)
                     /locus_tag="BAB2_0280"
                     /db_xref="GeneID:3827767"
     CDS             complement(271466..272191)
                     /locus_tag="BAB2_0280"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="YP_418493.1"
                     /db_xref="GI:83269202"
                     /db_xref="GeneID:3827767"
                     /translation="MNKRQPLLSVRGLYAWYGESHALQGVDLDIWPGETITLLGRNGV
                     GKTTTLRAIMGIIRKRTGTITLDGKDIMRVPLHRIAYEGLGFVPEERGIFASLNVHEN
                     LLLPPVVAKGGGSQGAMSLDEIYELFPNLYERRNSPGTKLSGGEQQMLAIARILRTGV
                     KVLLLDEPTEGLAPVIVQRIGDVLVELKKRGMTVLLVEQNFRFAAKVADRFYLMDHGV
                     VTDNFPTTELPARMAALTQALGV"
     misc_feature    complement(271469..272179)
                     /locus_tag="BAB2_0280"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    complement(271508..272170)
                     /locus_tag="BAB2_0280"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(272051..272074)
                     /locus_tag="BAB2_0280"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(271595..271597,271691..271696,
                     271925..271927,272048..272056,272060..272065))
                     /locus_tag="BAB2_0280"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(271925..271936)
                     /locus_tag="BAB2_0280"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(271739..271768)
                     /locus_tag="BAB2_0280"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(271691..271708)
                     /locus_tag="BAB2_0280"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(271673..271684)
                     /locus_tag="BAB2_0280"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(271589..271609)
                     /locus_tag="BAB2_0280"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(272184..272999)
                     /locus_tag="BAB2_0281"
                     /db_xref="GeneID:3827768"
     CDS             complement(272184..272999)
                     /locus_tag="BAB2_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418494.1"
                     /db_xref="GI:83269203"
                     /db_xref="GeneID:3827768"
                     /translation="MNTASGAIPVLHEAGPGTSQTASGIVLSARGLGKSFGGFHAVKN
                     VDLDVEHARVHALIGPNGAGKTTVFNLLTKFLQPTSGEITLLGETITKTDPARVARKG
                     LVRSFQISATFPHLTVLENVKVALQRPNGLATQFWRSLSALDRLDAQAVELLERVGLA
                     DARHALAADLSYGRKRALEIATTLALDPKVLLLDEPLAGMGHEDVHTIAALITDVAKD
                     RAVLMVEHNLKVVADIAHHVTVLQRGEILASGDYATVSKDERVRTAYMGTEHE"
     misc_feature    complement(272196..272927)
                     /locus_tag="BAB2_0281"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(272217..272921)
                     /locus_tag="BAB2_0281"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(272802..272825)
                     /locus_tag="BAB2_0281"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(272322..272324,272415..272420,
                     272676..272678,272799..272807,272811..272816))
                     /locus_tag="BAB2_0281"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(272676..272687)
                     /locus_tag="BAB2_0281"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(272463..272492)
                     /locus_tag="BAB2_0281"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(272415..272432)
                     /locus_tag="BAB2_0281"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(272397..272408)
                     /locus_tag="BAB2_0281"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(272316..272336)
                     /locus_tag="BAB2_0281"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(273012..274217)
                     /locus_tag="BAB2_0282"
                     /db_xref="GeneID:3827769"
     CDS             complement(273012..274217)
                     /locus_tag="BAB2_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding family protein"
                     /protein_id="YP_418495.1"
                     /db_xref="GI:83269204"
                     /db_xref="GeneID:3827769"
                     /translation="MKCLALATAALLAATAFSSAAEISDGKVKIGILNDQSGVYADFG
                     GKWSYEAAKMAAEDFGGTVLGAPIEIITADHQNKPDVASNIARQWYDTEQVDSIMELT
                     TSSVGLAVQALSKEKKKITINTGAATSELTGKQCTPYGFHWAYDTHALAVGTGGSLVQ
                     QGGDTWYFLTADYAFGYSLEEQTTKFVESKGGKVLGSVRHPLSTTDYSSFLLQAQASG
                     AKVVGLANAGLDTSNAIKQAAEFGIVAGGQRLAALLFTLAEVHGLGLEAAQGLTLTEG
                     FYWDRDDESRAFGKRFFDRTGRMPNMIQAGTYSAVLQYLKAIKEAGTDETEAVAKKLH
                     EMPVEDVFARHGKVGPNGRMIYDMYLMEVKKPEESKAPWDYYKVLATIPGDQAYMTPE
                     ESGCPLVKQ"
     misc_feature    complement(273135..274133)
                     /locus_tag="BAB2_0282"
                     /note="Periplasmic solute-binding domain of active
                     transport proteins that belong to the type I periplasmic
                     binding fold protein family; Region: PBP1_SBP_like_1;
                     cd06327"
                     /db_xref="CDD:107322"
     misc_feature    complement(order(273456..273458,273537..273539,
                     273693..273695,273837..273845,273906..273914))
                     /locus_tag="BAB2_0282"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107322"
     gene            274482..275396
                     /locus_tag="BAB2_0283"
                     /db_xref="GeneID:3827770"
     CDS             274482..275396
                     /locus_tag="BAB2_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_418496.1"
                     /db_xref="GI:83269205"
                     /db_xref="GeneID:3827770"
                     /translation="MRPFTWDDLQYFLAVARTGQLSTAARQLRTSHVTVLRRIDRLEQ
                     ALSTKLFERNPRGYLLTPMGERLVEPAEVMEREAMKFQTEATGNLAALSGVVRLSTLE
                     GFGNFFLADRLPVLAQSYPSLFVEVVTIQQIMSLSRRETELSITLHMPRNGPYHSEKL
                     MPYRLFIYGHRDYLARHPPIRTREDMTGHPFIGYIDDMVFTPGLDYMREILPGQRCTY
                     QSSSIHAQLIATQTGYGLCVLPYFIASKYPELVPVLPREMHLVREYWMSCHVDVMAAP
                     RIRVISDFMIRAVRESSSMFLGELLLQP"
     misc_feature    274491..275366
                     /locus_tag="BAB2_0283"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    274497..274676
                     /locus_tag="BAB2_0283"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    274749..275351
                     /locus_tag="BAB2_0283"
                     /note="LysR substrate binding domain; Region:
                     LysR_substrate; pfam03466"
                     /db_xref="CDD:251977"
     misc_feature    order(274809..274814,274818..274823,274830..274832,
                     274842..274844,274848..274868,275133..275147,
                     275163..275168,275172..275177)
                     /locus_tag="BAB2_0283"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(275612..276052)
                     /locus_tag="BAB2_0284"
                     /db_xref="GeneID:3827771"
     CDS             complement(275612..276052)
                     /locus_tag="BAB2_0284"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_418497.1"
                     /db_xref="GI:83269206"
                     /db_xref="GeneID:3827771"
                     /translation="MRELDQKDREILAILSKEARIPLKTLAGRIGLSRSATGERVANL
                     EKSGVIRGYRADIGQIDSNIIRAMILVSLKRTPALGLLDELARHAEVRRVSSVSGQLD
                     LIVEVEVPTIDRLNRLRDVLATHETAEDLTTAIVLRRDIERENA"
     misc_feature    complement(275624..276052)
                     /locus_tag="BAB2_0284"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(275732..276043)
                     /locus_tag="BAB2_0284"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            276303..279374
                     /locus_tag="BAB2_0285"
                     /db_xref="GeneID:3827772"
     CDS             276303..279374
                     /locus_tag="BAB2_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418498.1"
                     /db_xref="GI:83269207"
                     /db_xref="GeneID:3827772"
                     /translation="MTDLSHPAPEFTTKDAERLAECHFGVSASASPLDSERDCNFRLK
                     VANGSVNGSAGSADWILKIVNASEPRVESEFQTALLQHLVDTNPAAAVPHLKPSLSGD
                     VLASAQGPDGKPHALRMASWLPGTPLAEGKRTKTLLKNLGRALGELDRALQGFIHPGA
                     LRDFDWDLRHAGRARERLHFIDKPEDRAVIEHFLARFERNVAPQLPFSRAQVIHNDAN
                     DWNVLVDDDDGERIAGLIDFGDAVHTVLIAEVAIACAYSILDMDDPIGAAGALAAGFH
                     EKFPLQAQEIDILFDLIAMRLVTSVTLSASRREKTGDNPYLAISEAPAWRLLHRLDAL
                     NPRFATAILRKACGFDAVEGAGAVRTWLDANRGAFAPIVKPHPATLTKALVPYGDAAH
                     VITVDSAGRRPETATAWWDDFCARNHIQLGLGPWGEKRTVYTDEAFRSRFVEGERRVH
                     HLGLDLFMPAGTPVYTPLAATVRSVEIEAVPLGYGGLIALEHEPEGCPPFITLWGHMA
                     HEAVSRLKPGDRLAAGELVGHMGDMHENGGWTPHLHFQISTDTSLSATEILGVGESAY
                     LDVWADIFPDAAPLAGIPAEAFQQSGRTRAEIISVRKEMLLPNLSISYSDPIKFVRGD
                     GVWLIDNRGRAYLDCFNNVCHLGHAHPEVVEAIARQAAILNTNTRYLHDTIVSYAERL
                     TATLPEGLTVASFACSGSEANSLALRMARTHSGQRDALVLDWAYHGTTQELIDLSPYK
                     YKRKGGKGRPDHVFEATIPDSYRAPESWPLAEHGRRFAESIAEQIEKMKAQGRAPAFF
                     IAESIPSVAGQVFLPEGYLREVYAMVRAAGGVCIADEVQVGFGRVGSHWWAFEMQGVV
                     PDIVTMGKPIGNGHPMSAVVTTREVADSFNNGMEYFNTFGGNPVSCVAGLAVLDVIEH
                     NDLRRNALEIGNYLIAGFRSMQDRFDIIGDVRGQGLFLGIELVMDRKTKEPATAIARK
                     INDGARERGILMGTEGPFDNVLKMRPPMIFTRANADHLLSVLEDSFAAALK"
     misc_feature    276303..279371
                     /locus_tag="BAB2_0285"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06148"
                     /db_xref="CDD:180426"
     misc_feature    276303..277373
                     /locus_tag="BAB2_0285"
                     /note="Putative homoserine kinase type II (protein kinase
                     fold) [General function prediction only]; Region: COG2334"
                     /db_xref="CDD:225213"
     misc_feature    order(276447..276449,276480..276482,276486..276488,
                     276579..276581,276660..276671,276948..276950,
                     276957..276959,276963..276965,276969..276971,
                     277008..277013,277068..277070)
                     /locus_tag="BAB2_0285"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    order(276447..276449,276948..276950,277068..277070)
                     /locus_tag="BAB2_0285"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     misc_feature    order(276480..276482,276486..276488,276579..276581,
                     276660..276671,276948..276950,276957..276959,
                     276963..276965,276969..276971,277008..277013)
                     /locus_tag="BAB2_0285"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     misc_feature    277653..277943
                     /locus_tag="BAB2_0285"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     misc_feature    278145..279356
                     /locus_tag="BAB2_0285"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(278394..278402,278478..278483,278487..278489,
                     278703..278705,278802..278804,278808..278813,
                     278892..278894)
                     /locus_tag="BAB2_0285"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(278397..278402,278478..278483,278703..278705,
                     278802..278804,278811..278813,278892..278894)
                     /locus_tag="BAB2_0285"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    278892..278894
                     /locus_tag="BAB2_0285"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     STS             276929..277450
                     /locus_tag="BAB2_0285"
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     gene            279478..280497
                     /locus_tag="BAB2_0286"
                     /db_xref="GeneID:3827773"
     CDS             279478..280497
                     /locus_tag="BAB2_0286"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-binding protein"
                     /protein_id="YP_418499.1"
                     /db_xref="GI:83269208"
                     /db_xref="GeneID:3827773"
                     /translation="MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGV
                     AGFSSPDDQGKWTGFDIDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSC
                     QTTWTLSRDAGMGIHFVGTAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNV
                     ADYCGAHNIKYEPVVIDSADGILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLP
                     EVISKEPLGPAVRQGDDKWFNIVRWTLFALLEAEELGITQKTVAADLDSRKPDIRRFL
                     GSEGDNGQQLGLEPKWAYNIVASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMY
                     APPVK"
     misc_feature    279484..280410
                     /locus_tag="BAB2_0286"
                     /note="lysine-arginine-ornithine-binding periplasmic
                     protein; Region: 3A0103s03R; TIGR01096"
                     /db_xref="CDD:233269"
     misc_feature    279583..280254
                     /locus_tag="BAB2_0286"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(279607..279609,279730..279732,279805..279807,
                     279940..279942,280066..280068)
                     /locus_tag="BAB2_0286"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(280015..280017,280027..280029,280045..280047)
                     /locus_tag="BAB2_0286"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    280147..280164
                     /locus_tag="BAB2_0286"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(280528..282084)
                     /locus_tag="BAB2_0287"
                     /db_xref="GeneID:3827774"
     CDS             complement(280528..282084)
                     /locus_tag="BAB2_0287"
                     /EC_number="3.4.11.19"
                     /note="intracellular enzymes acting on low molecular
                     weight D-amino acid amides, esters and oligopeptides
                     containing D-amino acids; these proteases release the
                     N-terminal D-amino acid from a peptide, and show higher
                     affinity for D-Ala, D-Ser or D-Thr; no preference for the
                     stereochemistry of the second amino acid"
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminopeptidase"
                     /protein_id="YP_418500.1"
                     /db_xref="GI:83269209"
                     /db_xref="GeneID:3827774"
                     /translation="MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFA
                     DLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRD
                     LCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI
                     LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDTALFNECTGYEGDTVRGFLPAIN
                     RIHWLGDAGICASLDDMIAWEQFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKF
                     EETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNASDAALKMMNAALGIPP
                     AKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGRMKARFGTGPEIMDISGENEAQSSM
                     TTLRRDGDMIHLARKDENLHLAMHRLKGEARQDIAGRYRSDELEADLLLVSEGGAIYG
                     AFEGFLGKSDMYPLYAAGPDVWLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCW
                     LARGVEYKRL"
     misc_feature    complement(280531..282084)
                     /locus_tag="BAB2_0287"
                     /note="D-aminopeptidase; Reviewed; Region: PRK13128"
                     /db_xref="CDD:171868"
     misc_feature    complement(281095..282060)
                     /locus_tag="BAB2_0287"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:249626"
     misc_feature    complement(280822..281085)
                     /locus_tag="BAB2_0287"
                     /note="D-aminopeptidase, domain B; Region: DAP_B;
                     pfam07930"
                     /db_xref="CDD:254523"
     misc_feature    complement(280531..280821)
                     /locus_tag="BAB2_0287"
                     /note="D-aminopeptidase, domain C; Region: DAP_C;
                     pfam07932"
                     /db_xref="CDD:149163"
     gene            complement(282109..282276)
                     /locus_tag="BAB2_0288"
                     /db_xref="GeneID:3827775"
     CDS             complement(282109..282276)
                     /locus_tag="BAB2_0288"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418501.1"
                     /db_xref="GI:83269210"
                     /db_xref="GeneID:3827775"
                     /translation="MQAAIARRAAKHDAAHPRQYCPQHLSLYRQRLQTIQSAYGHRLD
                     RTVKITLQGSH"
     gene            282500..284185
                     /locus_tag="BAB2_0289"
                     /db_xref="GeneID:3827776"
     CDS             282500..284185
                     /locus_tag="BAB2_0289"
                     /EC_number="2.2.1.6"
                     /note="catalyzes the formation of 2-acetolactate from
                     pyruvate, leucine sensitive; also known as acetolactate
                     synthase large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate protein"
                     /protein_id="YP_418502.1"
                     /db_xref="GI:83269211"
                     /db_xref="GeneID:3827776"
                     /translation="MTSKPNVRTGGQILVDALRIHGADRVFCVPGESYLAALDAFHDA
                     SDAIDLIVCRQEGGASYMAEAYGKLTGKPGICFVTRGPGATNASIGVHTAFQDSTPML
                     LFIGQVASDQVEREAFQEIDYRRMFGQMAKWVVQIDDAARIPELVSQAFHRAVNGRPG
                     PVVVALPEDMLTSYAAVSDAPAYKQVAMHPGGEQLQAMRALIEKAERPLMIVGGGGWT
                     QDAVRDLRQFAENMSLPVAASFRCQDMFDNTHPLYAGEMGTSISARLVQRVKDSDLLV
                     VVGARLGEMTTQGYELVTIPVPQQKLVHIHPGAEELGRVYHADVPINAGMPAFCAAAA
                     KLAPVADPRWKAWADSANADYRDNIKSPVIPGEVQMGEVMEWLRAHLPADAIITNGAG
                     NYSAWPHRFYQYRTYRSQLAPTNGSMGYGVPAAVAAKLTAPERTAVAFAGDGCFLMNG
                     QELATAAQYGANAIFIVVNNGMYGTIRMHQERTYPARISGTALANPDFAALARAYGLH
                     GEVVEKTADFAPAFKRCEQSGKPALIEIRIDPEALSPKMSLSQMREQGFAKQR"
     misc_feature    282500..284173
                     /locus_tag="BAB2_0289"
                     /note="thiamine pyrophosphate protein; Validated; Region:
                     PRK08199"
                     /db_xref="CDD:181285"
     misc_feature    282533..283003
                     /locus_tag="BAB2_0289"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(282572..282574,282587..282592,282602..282604,
                     282614..282616,282644..282664,282671..282673,
                     282680..282685,282692..282697,282701..282709,
                     282743..282745,282764..282766,282776..282778,
                     282785..282790)
                     /locus_tag="BAB2_0289"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(282587..282595,282602..282604,282614..282616,
                     282647..282649,282653..282664,282668..282670,
                     282743..282745,282752..282757,282761..282766,
                     282773..282775,282875..282877,282884..282886)
                     /locus_tag="BAB2_0289"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(282587..282589,282665..282667,282743..282745,
                     282755..282757)
                     /locus_tag="BAB2_0289"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    283082..283465
                     /locus_tag="BAB2_0289"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    283613..284113
                     /locus_tag="BAB2_0289"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cd00568"
                     /db_xref="CDD:238318"
     misc_feature    order(283751..283753,283823..283834,283907..283909,
                     283913..283915)
                     /locus_tag="BAB2_0289"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(284198..284923)
                     /locus_tag="BAB2_0290"
                     /db_xref="GeneID:3827777"
     CDS             complement(284198..284923)
                     /locus_tag="BAB2_0290"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418503.1"
                     /db_xref="GI:83269212"
                     /db_xref="GeneID:3827777"
                     /translation="MGLLETAITGRKRHNSHAVVVGELGRGMVAGTIPEGSILPGDHE
                     LSLRFGVSRTVLREAMKTLAAKRLIEPKAKVGTRVLGHASWNFFDPDVLSWRFEAGFD
                     EPFVDHLAEMRMALEPAAAAAAAERATSDEIVELYALAAKFDNPDHTPESIAKVDLEF
                     HLAIARMSGNPFMRSVSGLIEAALAVSFQLSSPAASQEGIAECAANHLRIAHAIASRD
                     PQKARLAMESVIKLGVKRIRDVI"
     misc_feature    complement(284201..284905)
                     /locus_tag="BAB2_0290"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(284687..284875)
                     /locus_tag="BAB2_0290"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(284693..284704,284708..284713,
                     284741..284743,284750..284755,284759..284773,
                     284795..284800,284804..284806,284873..284875))
                     /locus_tag="BAB2_0290"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(284243..284602)
                     /locus_tag="BAB2_0290"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(284948..285241)
                     /locus_tag="BAB2_0291"
                     /db_xref="GeneID:3827778"
     CDS             complement(284948..285241)
                     /locus_tag="BAB2_0291"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418504.1"
                     /db_xref="GI:83269213"
                     /db_xref="GeneID:3827778"
                     /translation="MLHNDEARRTGSETGAAEQEAEIPVMLFDREISTREPLPAFLHR
                     VGANTGPVQTYIVFGGTLSSWWTKTVISILLFPSITLQQIARACLPKAGAGFG"
     misc_feature    complement(284990..>285094)
                     /locus_tag="BAB2_0291"
                     /note="Transmembrane subunit (TM) of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which are involved in the uptake of
                     branched-chain amino acids (AAs), as well as TMs of
                     transporters involved in the uptake of...; Region:
                     TM_PBP1_branched-chain-AA_like; cl00454"
                     /db_xref="CDD:260432"
     gene            285511..286503
                     /locus_tag="BAB2_0292"
                     /db_xref="GeneID:3827779"
     CDS             285511..286503
                     /locus_tag="BAB2_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter"
                     /protein_id="YP_418505.1"
                     /db_xref="GI:83269214"
                     /db_xref="GeneID:3827779"
                     /translation="MLRLVQFRDERGEAHVAACDDEGAAHVVGGVATTYELASAAISA
                     GISLEEQVACSGKGEAVDIDAALASGRVGLPVSHADSAHLIVTGTGLTHLGSADGRDK
                     MHKAMQSAEKPTDSMRMFLMGVESGKPKPGETGVQPEWFYKGDGSVLVATGGELVSPA
                     FAEDGGEEPELAGIYLIGPDGTPFRLGFCLANEFSDHVTEKQNYLWLAHSKLRQAALG
                     PELYVGALPDHVEGVSRIRRGGEVIFEKPFLSGEANMSHAIANLEHHHFKYALFRRPG
                     DIHVHFFGTATLSFSDGVKTEAGDQFEICAKPFRYPLVNRLGQAAAEKITVRAL"
     misc_feature    285511..286500
                     /locus_tag="BAB2_0292"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: GguC; COG3802"
                     /db_xref="CDD:226324"
     gene            286512..287447
                     /locus_tag="BAB2_0293"
                     /db_xref="GeneID:3827780"
     CDS             286512..287447
                     /locus_tag="BAB2_0293"
                     /EC_number="1.1.1.48"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_418506.1"
                     /db_xref="GI:83269215"
                     /db_xref="GeneID:3827780"
                     /translation="MTTSPDIALAIVGLGKIARDQHLPAIASVDGVALAAVASRNAGL
                     DGTPSFHDIEQLLASDVMFDAVSLCTPPQGRFNQAHAALKAGKHVMLEKPPGATISEV
                     HALERLAERQGVSLYATWHSREAAAVGPAREFLKDALIRSVSVAWKEDVRHWHPGQQW
                     IWEPGGLGVFDPGINALSIVTHILPEAFFLTRSDLYFPANRAAPIAADLRFHTGSGIP
                     VSFELDWRQTGPQTWDICVETDKGTLLLSHGGSRMTVAGEEKMAEPDREYQRLYRNFV
                     QLVRERRSDVDLAPLTHVADAFLLGKRHLVEAFDD"
     misc_feature    286530..287435
                     /locus_tag="BAB2_0293"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    286536..286862
                     /locus_tag="BAB2_0293"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     gene            287544..289349
                     /locus_tag="BAB2_0294"
                     /db_xref="GeneID:3827781"
     CDS             287544..289349
                     /locus_tag="BAB2_0294"
                     /EC_number="4.2.1.9"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_418507.1"
                     /db_xref="GI:83269216"
                     /db_xref="GeneID:3827781"
                     /translation="MNKPVTPKTPKLRSRAWFDNPDDVDMTALYLERYMNYGLSQEEL
                     QSGRPIIGIAQTGSDLSPCNRHHLELAKRVRDGVREAGGIVIEFPVHPIQETGKRPTA
                     GLDRNLAYLGLVEVLYGYPLDGVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNG
                     WFRGERTGSGTIVWKARELLAKGEIDYQGFVKLVASSAPSTGYCNTMGTATTMNSLAE
                     ALGMQLPGSAAIPAPYRDRQEVAYLTGRRIVEMVHEDLKPSDILTKEAFINAIRVNSA
                     IGGSTNAPIHLNALARHIGVELTVDDWQKYGEEIPLLVNLQPAGEYLGEDYYHAGGVP
                     AVVNQLMGQGLIHEDAITVNGKTIGENCKNATIEDGNVIKTYDQPLKKHAGFRVLRGN
                     LFSSAIMKLSVISDEFRNRYLSDAKDPNAFEGKAVVFDGPEDYHHRIDDPALEIDEHT
                     VLFMRGAGPIGYPGAAEVVNMRAPDYLLKKGITSLPCIGDGRQSGTSGSPSILNASPE
                     AAAGGGLAILKTGDRVRIDLGRGTADILISDEELAERRKALEAVGGYKYPESQTPWQE
                     IQRAVIGQMETGAVLENAVKYQDIAHTRGLPRDNH"
     misc_feature    287544..289346
                     /locus_tag="BAB2_0294"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK13017"
                     /db_xref="CDD:237272"
     gene            289346..290293
                     /locus_tag="BAB2_0295"
                     /db_xref="GeneID:3827124"
     CDS             289346..290293
                     /locus_tag="BAB2_0295"
                     /EC_number="2.7.1.58"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxy-galactonokinase"
                     /protein_id="YP_418508.1"
                     /db_xref="GI:83269217"
                     /db_xref="GeneID:3827124"
                     /translation="MKPEMPMGAGKKPFAAVADWGTTRFRLWTLDADGAVLGESRGDD
                     GLLHAKEAGFEPTLERHLARLGAPDDLPVVICGMAGSRAGWVEAPYMNLPAGLDGIVK
                     AAVRVPARRHVIMLPGVARQDETAPDVMRGEETKLLGLVHRGTRDAIVVMPGTHAKWV
                     KIANGELADYRTFMTGELFALLKEKSVLAGALEGAGTVDPNHDAFAAGVRASLEAPEL
                     VSNRLFSIRAGWLVHDRKPTDQLARLSGLLIGLEIAGGRTLYGGAKDILLPSDGTMGG
                     LYASALATAGLNVKRLQADELVRDGLFMAAKHTFQGAVS"
     misc_feature    289379..290284
                     /locus_tag="BAB2_0295"
                     /note="2-keto-3-deoxy-galactonokinase [Carbohydrate
                     transport and metabolism]; Region: DgoK; COG3734"
                     /db_xref="CDD:226257"
     gene            290290..290922
                     /locus_tag="BAB2_0296"
                     /db_xref="GeneID:3827125"
     CDS             290290..290922
                     /locus_tag="BAB2_0296"
                     /EC_number="4.1.2.21"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and pyruvate from
                     2-dehydro-3-deoxy-D-galactonate 6-phosphate; functions in
                     galactonate metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
                     /protein_id="YP_418509.1"
                     /db_xref="GI:83269218"
                     /db_xref="GeneID:3827125"
                     /translation="MSGHIAWPKLRYPLVAILRGIRPEETEAIVSALIETGFEAIEIP
                     LNSPAPFTSIEKAAKLAPKNVLIGAGTVLSVDDVDRLNDVGGRLLVSPNVEPEVIRRA
                     GSHGMVTMPGVFTPTEAFSAIRAGASALKFFPASVLGAEGIKAVCAVLPKDIPVGAVG
                     GVSQNDFATYAAAGVTCFGLGSSLYKAGFSAADVQERAQQAVAAWDKIAG"
     misc_feature    290326..290898
                     /locus_tag="BAB2_0296"
                     /note="Entner-Doudoroff aldolase; Region: eda; TIGR01182"
                     /db_xref="CDD:162241"
     misc_feature    290326..290886
                     /locus_tag="BAB2_0296"
                     /note="KDPG and KHG aldolase; Region: KDPG_aldolase;
                     cd00452"
                     /db_xref="CDD:188632"
     misc_feature    order(290338..290340,290413..290415,290425..290427,
                     290500..290502,290680..290682,290686..290688,
                     290764..290766)
                     /locus_tag="BAB2_0296"
                     /note="active site"
                     /db_xref="CDD:188632"
     misc_feature    order(290425..290427,290500..290502,290506..290508,
                     290563..290574,290632..290643,290647..290649,
                     290659..290661,290686..290691,290722..290724,
                     290734..290739)
                     /locus_tag="BAB2_0296"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:188632"
     misc_feature    290680..290682
                     /locus_tag="BAB2_0296"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188632"
     gene            291071..291418
                     /locus_tag="BAB2_0297"
                     /pseudo
                     /db_xref="GeneID:3827126"
     misc_feature    291071..291418
                     /locus_tag="BAB2_0297"
                     /note="multiple sugar-binding periplasmic receptor chvE
                     precursor"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12463.1"
     gene            291475..292131
                     /locus_tag="BAB2_0298"
                     /pseudo
                     /db_xref="GeneID:3827127"
     misc_feature    291475..292131
                     /locus_tag="BAB2_0298"
                     /note="sugar ABC transporter, periplasmic sugar-binding
                     protein KO: K02058 simple sugar transport system
                     substrate-binding protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12464.1"
     gene            292277..293866
                     /locus_tag="BAB2_0299"
                     /db_xref="GeneID:3827128"
     CDS             292277..293866
                     /locus_tag="BAB2_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-length control protein"
                     /protein_id="YP_418510.1"
                     /db_xref="GI:83269219"
                     /db_xref="GeneID:3827128"
                     /translation="MNLANPVSLDERGALPDTFGKPLLEMRGINKSFGVVKALSDVNF
                     TVMPGEIHAFVGENGAGKSTLMKVLSGVYPHGSYEGAIYYDGEERQFRDINDSEALGI
                     VIIHQELALIPLMSIAENIFLVNPPASRGVIDRSAVHKRTRELLKKVGLAETPDTLIT
                     DIGIGKQQLVEIAKALSKRVRLLILDEPTASLNENDSAALLALLREFRAQGITSILIS
                     HKLNEIREVADKITVLRDGKAVATLDCHAGEVEEDDIIRKMVDRDLESRYPKRDPKIG
                     NVIFEVDNWSVYHPLHPDRHSVKNVSFKVRAGEIVGIAGLMGAGRTEFAMSLFGRSWG
                     TNITGEARINGKTVDISTVARAIKAGLAYVTEDRKKLGLVLGQNISRNISLAHLRGVS
                     PKGIIDDIREMKIANSYRDQMRIRCHNVYQETGTLSGGNQQKVVLSKWLFTGPDVLIL
                     DEPTRGIDVGAKYDIYTIINSLAESGKGVVVISSEMPELIGICDRIVVMHEGAFVGEV
                     AGEEATQENIMRAIMRNKGKG"
     misc_feature    292334..293848
                     /locus_tag="BAB2_0299"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    292346..293002
                     /locus_tag="BAB2_0299"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    292442..292465
                     /locus_tag="BAB2_0299"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(292451..292456,292460..292468,292595..292597,
                     292832..292837,292931..292933)
                     /locus_tag="BAB2_0299"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    292586..292597
                     /locus_tag="BAB2_0299"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(292619..292633,292775..292789)
                     /locus_tag="BAB2_0299"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    292820..292837
                     /locus_tag="BAB2_0299"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    292844..292855
                     /locus_tag="BAB2_0299"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    292919..292939
                     /locus_tag="BAB2_0299"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    293102..293788
                     /locus_tag="BAB2_0299"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            293866..295056
                     /locus_tag="BAB2_0300"
                     /db_xref="GeneID:3827129"
     CDS             293866..295056
                     /locus_tag="BAB2_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418511.1"
                     /db_xref="GI:83269220"
                     /db_xref="GeneID:3827129"
                     /translation="MSENVIQSGQQSSVGRYLKNNLRESGMLLSLVAIMIFFQIVTGG
                     VLMKPLNLTNLVLQNSYIVIMALGMLLIIVTGHIDLSVGSVCGFIGALAAVMMVKLGI
                     PFPIAAILCLIVGGLIGAIQGFWVAYFNIPSFIVTLAGMLVFKGMMLAVLGGQSVGPF
                     PVVFQKLSSGFIPEVIGTFDGVYLTSLIIGVLLAVFLIWQSMRSRARHIAHEVETEPF
                     GLFVVKCILYFAAIAYLSLLISSHRGMPNVLIIMAVLIAAYAFLTNRTVIGRQIYAVG
                     GNRHAAKLSGVKTERLTFLTFVNMGVLAALAGLVFAARLNTATPKAGIGFELDVIAAC
                     FIGGASAYGGVGRVTGAVIGALIMGVMNNGMSILGIGIDYQQVIKGIVLLGAVCIDVY
                     NQKR"
     misc_feature    294040..295035
                     /locus_tag="BAB2_0300"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    294703..294759
                     /locus_tag="BAB2_0300"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(295207..296088)
                     /locus_tag="BAB2_0301"
                     /db_xref="GeneID:3827130"
     CDS             complement(295207..296088)
                     /locus_tag="BAB2_0301"
                     /EC_number="2.6.1.21"
                     /note="catalyzes the transamination of D-amino acids and
                     their alpha-keto acids"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid aminotransferase"
                     /protein_id="YP_418512.1"
                     /db_xref="GI:83269221"
                     /db_xref="GeneID:3827130"
                     /translation="MAASAAELENRIVYVNGEYVAARDARISIFDRGFLFGDGIYEVT
                     AVLEGKLVNSEPHMQRLRRSTGEIGIAMPMSEDEIVTIERELIRRNKLTEGLVYLQVT
                     RGNGGDRDFVPAANMKPSVVLFTQEANLLDKPALKTGAHVLSLDDLRWKRRDIKTVCL
                     LPQALTKEIAKNAGCDEAWMIEDGYVTEGASSTAYIVTRDDVIVTRPNSNFTLPGCTR
                     LSLLQLITETGMKLEERLFTIDEAYAAKEAFLTSAGTFVTPITVIDGKTIGDGKPGPI
                     ARRLREVYLDHARRTAI"
     misc_feature    complement(295237..296049)
                     /locus_tag="BAB2_0301"
                     /note="D-Alanine aminotransferase (D-AAT_like): D-amino
                     acid aminotransferase catalyzes transamination between
                     D-amino acids and their respective alpha-keto acids. It
                     plays a major role in the synthesis of bacterial cell wall
                     components like D-alanine and...; Region: D-AAT_like;
                     cd01558"
                     /db_xref="CDD:238799"
     misc_feature    complement(order(295516..295518,295573..295575,
                     295585..295590,295597..295602,295606..295620,
                     295717..295719,295729..295731,295783..295785,
                     295789..295791,295795..295797,295966..295968,
                     295975..296004,296008..296013))
                     /locus_tag="BAB2_0301"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238799"
     misc_feature    complement(order(295330..295332,295438..295443,
                     295525..295527,295609..295611,295621..295623,
                     295909..295911,295966..295968,295981..295983))
                     /locus_tag="BAB2_0301"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238799"
     misc_feature    complement(order(295330..295332,295438..295440,
                     295621..295623,295909..295911,295966..295968))
                     /locus_tag="BAB2_0301"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238799"
     misc_feature    complement(295621..295623)
                     /locus_tag="BAB2_0301"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238799"
     gene            complement(296176..296799)
                     /locus_tag="BAB2_0302"
                     /db_xref="GeneID:3827131"
     CDS             complement(296176..296799)
                     /locus_tag="BAB2_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418513.1"
                     /db_xref="GI:83269222"
                     /db_xref="GeneID:3827131"
                     /translation="MAITILKAENHRRMPWKNGGGLTAEIAVHPQGASVEDFDWRISM
                     ATIASDGPFSVFPGIDRTLSVLAGDGIVLDIEGQATTLTRECAPLAFAADACCDARLI
                     GSAITDLNVMTRRGRFAHMVRRLPVNGTTLTQVHGNPVLLFCAEGRMDLVSSEQTIKF
                     EEHDCAVMTGCDALPLKLTGKGTTYLISIRAFPAENKSKSHCASAPD"
     misc_feature    complement(296224..296799)
                     /locus_tag="BAB2_0302"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3758"
                     /db_xref="CDD:226281"
     gene            complement(296806..298479)
                     /locus_tag="BAB2_0303"
                     /db_xref="GeneID:3827132"
     CDS             complement(296806..298479)
                     /locus_tag="BAB2_0303"
                     /EC_number="4.2.1.49"
                     /note="catalyzes the formation of
                     4-imidazolone-5-propanoate from urocanate during histidine
                     metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="urocanate hydratase"
                     /protein_id="YP_418514.1"
                     /db_xref="GI:83269223"
                     /db_xref="GeneID:3827132"
                     /translation="MSNPRHNEREVRSPRGDELNAKSWLTEAPLRMLMNNLDPDVAER
                     PHELVVYGGIGRAARTWDDFDRIVATLKTLNDNETLLVQSGKPVGVFRTHKDAPRVLI
                     ANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIVQGTYETFVEAGRQHY
                     GGNLKGRWILTGGLGGMGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSL
                     DEALAKIDAWTKAGEAKSIALIGNAAEIFPELVKRGVKPDIVTDQTSAHDPVHGYLPL
                     GWTVAEWRAKQENDPKAVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG
                     LENAFAFPGFVPAYIRPLFCRGIGPYRWAALSGDPEDIAKTDAKVKELLPDNKHLHNW
                     LDMAKERIAFQGLPARICWVGLGDRHRLGLAFNEMVRNGELKAPIVIGRDHLDSGSVA
                     SPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHAGMVICCD
                     GTEDADRRLERVLWNDPATGVMRHADAGYDIALDWARKQGLRLPAILGN"
     misc_feature    complement(296818..298479)
                     /locus_tag="BAB2_0303"
                     /note="urocanate hydratase; Provisional; Region: PRK05414"
                     /db_xref="CDD:235448"
     gene            complement(298490..299290)
                     /locus_tag="BAB2_0304"
                     /db_xref="GeneID:3827133"
     CDS             complement(298490..299290)
                     /locus_tag="BAB2_0304"
                     /EC_number="3.5.3.8"
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="YP_418515.1"
                     /db_xref="GI:83269224"
                     /db_xref="GeneID:3827133"
                     /translation="MRAVETRQGNSPVILGLPHTGTDVPDDIWSRLNDNGKILADTDW
                     HIHKLYDGLIDGATFVRATFHRYCIDANRDPAGVSLYPGQNTTTLIPETDFDGLSIWK
                     DGEAPTEADIADRIARFHRPYHDALAAEIERVKAIHGVAILYDCHSIRSHIPFLFEGK
                     LPDFNIGTDMGKTCDPGIEAAAVEVTAKAKGYTSILNGRFKGGWTTRHYGRSQTGVHA
                     IQMELAQSTHLATEAVPFAYDEAKADTLRVHLKTLLQRLETIAAELKS"
     misc_feature    complement(298502..299287)
                     /locus_tag="BAB2_0304"
                     /note="N-formylglutamate amidohydrolase; Region:
                     hutG_amidohyd; TIGR02017"
                     /db_xref="CDD:131072"
     gene            complement(299292..300827)
                     /gene="hutH"
                     /locus_tag="BAB2_0305"
                     /db_xref="GeneID:3827170"
     CDS             complement(299292..300827)
                     /gene="hutH"
                     /locus_tag="BAB2_0305"
                     /EC_number="4.3.1.3"
                     /note="catalyzes the degradation of histidine to urocanate
                     and ammmonia"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="YP_418516.1"
                     /db_xref="GI:83269225"
                     /db_xref="GeneID:3827170"
                     /translation="MTIILKPGSVPLETLEKIYREGLPVRIDPAFHAGIEKAAARIAE
                     IAAGDAPVYGINTGFGKLASIRIAAGDVATLQRNLILSHCCGVGEPLSENIVRLIMAL
                     KLVSLGRGASGVRLEVITLIEAMLEKGVIPMIPEKGSVGASGDLAPLAHMTAAMIGEG
                     EAFYRGERLSGAKALGKAGLKPVVLAAKEGLALINGTQTSTALALAGLFRAHRAARTA
                     LITGALSTDAAMGSDAPFHEEIHQLRGHKGQIDAGRALRTLLEGSAIRRSHLEGDQRV
                     QDPYCIRCQPQVDGACLDILRQAARTLEIEANAVTDNPLVLSDGRAVSGGNFHAEPVA
                     FAADQIALAVCEIGAISQRRIALLVDPSLSFGLPAFLARKPGLNSGLMIAEVTSAALM
                     SENKQMAHPASVDSTPTSANQEDHVSMACHGARRLLQMTANLNAIIGIEALTGALGVE
                     LRKPLTTSAELAKVIAALRAKVATLEEDRYMADDLKAAAELVADGTLSGVISAGILPD
                     LEA"
     misc_feature    complement(299397..300821)
                     /gene="hutH"
                     /locus_tag="BAB2_0305"
                     /note="Aromatic amino acid lyase; Region: Lyase_aromatic;
                     pfam00221"
                     /db_xref="CDD:249692"
     misc_feature    complement(299472..300806)
                     /gene="hutH"
                     /locus_tag="BAB2_0305"
                     /note="Phenylalanine ammonia-lyase (PAL) and histidine
                     ammonia-lyase (HAL); Region: PAL-HAL; cd00332"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(299856..299858,299889..299891,
                     299979..299981,299988..299990,300243..300245,
                     300255..300269,300591..300593,300600..300602,
                     300651..300653,300657..300659,300663..300671))
                     /gene="hutH"
                     /locus_tag="BAB2_0305"
                     /note="active sites [active]"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(299529..299534,299541..299543,
                     299550..299555,299571..299573,299580..299600,
                     299631..299642,299646..299663,299667..299669,
                     299673..299684,299688..299693,299697..299702,
                     299739..299741,299748..299750,299757..299759,
                     299769..299771,299781..299783,299790..299792,
                     299811..299813,299823..299825,299832..299837,
                     299841..299861,299865..299867,299877..299885,
                     299898..299903,299910..299915,299922..299927,
                     299934..299936,299943..299948,299964..299969,
                     299976..299981,299985..299993,299997..299999,
                     300081..300083,300090..300092,300096..300101,
                     300108..300113,300366..300368,300375..300377,
                     300414..300419,300501..300503,300564..300587,
                     300594..300596,300651..300656))
                     /gene="hutH"
                     /locus_tag="BAB2_0305"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176460"
     gene            complement(300852..302069)
                     /locus_tag="BAB2_0306"
                     /db_xref="GeneID:3827134"
     CDS             complement(300852..302069)
                     /locus_tag="BAB2_0306"
                     /EC_number="3.5.2.7"
                     /note="catalyzing the hydrolysis of
                     4-imidazolone-5-propionate to N-formimidoyl-L-glutamate,
                     the third step in the histidine degradation pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazolonepropionase"
                     /protein_id="YP_418517.1"
                     /db_xref="GI:83269226"
                     /db_xref="GeneID:3827134"
                     /translation="MTKNSSTVFTHARIATLEEKAANLGLIEEAALVVKDARIVYAGP
                     ENKLPDEYASFEKIDCGNRLITPGLIDCHTHLVHAGNRAHEFELRLQGATYEEVARAG
                     GGIVSSVRNLRAASEDDLVRETLPRLDALIAEGVTTVEVKSGYGLDRDSEIKSLKAAR
                     RLGEERDVAIRTTFLGAHALPPEMNGDKAAYIDRVINDMLPAIAEQGLADAVDGFCEG
                     IAFLPDEIARVFDAAKAHDIPVKLHADQLSNLHGAALAASYGALSADHLEYTDADGAA
                     AMASAGTVAVLLPGAYYFIRETQKPPVEAFRAAGTKMALATDNNPGTSPLTSLLLTMN
                     MGATLFRMTVEECIAGVTREAARALGILDQTGTLEIGKDADLAIWDIERPAELVYRIG
                     FNPLWKRVFKGQI"
     misc_feature    complement(300855..302051)
                     /locus_tag="BAB2_0306"
                     /note="imidazolonepropionase; Validated; Region: PRK09356"
                     /db_xref="CDD:236478"
     misc_feature    complement(300861..301976)
                     /locus_tag="BAB2_0306"
                     /note="Imidazolonepropionase/imidazolone-5-propionate
                     hydrolase (Imidazolone-5PH) catalyzes the third step in
                     the histidine degradation pathway, the hydrolysis of
                     (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to
                     N-formimidoyl-L-glutamate. In bacteria; Region:
                     Imidazolone-5PH; cd01296"
                     /db_xref="CDD:238621"
     misc_feature    complement(order(301116..301118,301272..301274,
                     301332..301334,301341..301343,301845..301847,
                     301851..301853))
                     /locus_tag="BAB2_0306"
                     /note="active site"
                     /db_xref="CDD:238621"
     gene            302200..303564
                     /locus_tag="BAB2_0307"
                     /db_xref="GeneID:3827135"
     CDS             302200..303564
                     /locus_tag="BAB2_0307"
                     /note="catalyzes the deimination of
                     N-formimino-L-glutamate to ammonia and
                     N-formyl-L-glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="N-formimino-L-glutamate deiminase"
                     /protein_id="YP_418518.1"
                     /db_xref="GI:83269227"
                     /db_xref="GeneID:3827135"
                     /translation="MSDQSSQHFIHARQALLPDGWAENVRIGIAGGVICSIETGVLAG
                     PDDERQSVVVAGMANLHSHAFQYGMAGLAERRGPSADSFWSWREIMYKFALTMTPEQA
                     EAVALRLYVDMLEAGFTRVGEFHYLHHDCDGTPYANLSEMADRIAAAATTAGMGLTLL
                     PVFYAHSGFGGAAANEGQRRFINDPERFARLIEGCRKTLEGFEGAVLGVAPHSLRAVT
                     PDELDSVTQLLPDAPVHIHVAEQVKEVEDCIAWSGKRPVEWLLDHQDVTARWCLIHAT
                     HMSDEETKHMAKAGAIAGLCPVTEANLGDGTFNATEFAAAGGKFGIGSDSNVLIGIGD
                     ELRQLEYSQRLYHRARNVLAANEGSTGRALFDGAVLGGNIAMGRPEDGLKKGASADFV
                     SLDVERLPHAKGDVVLDGWIFAGRAHVCDVWVRGVKQVEGGRHRLRDEAERAFQKALG
                     ELLA"
     misc_feature    302218..303561
                     /locus_tag="BAB2_0307"
                     /note="formiminoglutamate deiminase; Region: hutF;
                     TIGR02022"
                     /db_xref="CDD:233688"
     misc_feature    302242..303480
                     /locus_tag="BAB2_0307"
                     /note="Metallo-dependent hydrolases, subgroup D is part of
                     the superfamily of metallo-dependent hydrolases, a large
                     group of proteins that show conservation in their
                     3-dimensional fold (TIM barrel) and in details of their
                     active site. The vast majority of the...; Region:
                     Met_dep_hydrolase_E; cd01313"
                     /db_xref="CDD:238638"
     misc_feature    order(302380..302382,302386..302388,302908..302910,
                     303019..303021,303172..303174)
                     /locus_tag="BAB2_0307"
                     /note="active site"
                     /db_xref="CDD:238638"
     gene            303576..304319
                     /gene="hutC"
                     /locus_tag="BAB2_0308"
                     /db_xref="GeneID:3827169"
     CDS             303576..304319
                     /gene="hutC"
                     /locus_tag="BAB2_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418519.1"
                     /db_xref="GI:83269228"
                     /db_xref="GeneID:3827169"
                     /translation="MAGEDSIAKDVPALSLHQRILDDIESRILSGEWLPGHRIPFEHE
                     LTEYYGCSRMTVNKALTQLSKAGLIERKRRSGSFVSFPQSQAAILEIHDIREEVAALG
                     LPYRFELMNRWERLSGPADARRLDIARHTPLVELLCRHYAGKRVFALEERIINLEAVP
                     AAAETDFAQNSPGPWLVACVPWSSAKHTIRAIAATQEAAAKLDIAPGSPCLVIERQTW
                     NADQPVTHVRFTYPGDSHALVARFTPSRG"
     misc_feature    303618..304307
                     /gene="hutC"
                     /locus_tag="BAB2_0308"
                     /note="histidine utilization repressor, proteobacterial;
                     Region: his_ut_repres; TIGR02018"
                     /db_xref="CDD:188194"
     misc_feature    303618..303815
                     /gene="hutC"
                     /locus_tag="BAB2_0308"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(303618..303620,303624..303626,303693..303695,
                     303699..303704,303726..303740,303744..303749,
                     303756..303758,303786..303791,303795..303806)
                     /gene="hutC"
                     /locus_tag="BAB2_0308"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    303873..304283
                     /gene="hutC"
                     /locus_tag="BAB2_0308"
                     /note="UTRA domain; Region: UTRA; pfam07702"
                     /db_xref="CDD:254372"
     gene            complement(304390..305718)
                     /locus_tag="BAB2_0309"
                     /db_xref="GeneID:3827136"
     CDS             complement(304390..305718)
                     /locus_tag="BAB2_0309"
                     /EC_number="2.6.1.18"
                     /note="catalyzes the formation of pyruvate and
                     beta-alanine from L-alanine and 3-oxopropanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="beta alanine--pyruvate transaminase"
                     /protein_id="YP_418520.1"
                     /db_xref="GI:83269229"
                     /db_xref="GeneID:3827136"
                     /translation="MLTKTNAPSLDNFWMPFTANRQFKAAPRLLASASGMYYTDVDGN
                     QVLDGTAGLWCCNAGHGRKRITEAVERQISTMDFAPIFQMGHNVAFDFAEKLAAIAPG
                     GAEAKLDRVFFTNSGSESVDTALKIAIAYQRAIGQGTRTMVLGREKGYHGVGFGGISV
                     GGLVNNRCVFPQIPADHLRHTLDIEKNAFSKGLPANGIELADDLERLVQLHGAEKIAA
                     VIVEPMSGSAGVILPPKGYLERIRATADKYGILLIFDEVITGFGRLGTPFAVDYFGVV
                     PDLVTTAKGLTNGAIPMGAVFAARKVYDGLMTGPENAIELFHGYTYSGHPVASAAGLA
                     TLEIYAEEGLLTRGAGLADYWQEALHSLKGAPNVIDIRNLGLVGAVELASRKDAPGAR
                     AYDIFVECFKKGLLIRVTGDVIALSPPLIIEKEQIDTIISVLGDAIKRAA"
     misc_feature    complement(304393..305718)
                     /locus_tag="BAB2_0309"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    complement(304405..305685)
                     /locus_tag="BAB2_0309"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(304867..304869,304945..304950,
                     304954..304956,305053..305055,305260..305262,
                     305266..305271,305365..305373))
                     /locus_tag="BAB2_0309"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(304867..304869,304945..304947,
                     304954..304956,305053..305055,305266..305271,
                     305365..305370))
                     /locus_tag="BAB2_0309"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(304867..304869)
                     /locus_tag="BAB2_0309"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            305864..306412
                     /locus_tag="BAB2_0310"
                     /db_xref="GeneID:3827137"
     CDS             305864..306412
                     /locus_tag="BAB2_0310"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-hairpin-helix DNA-binding
                     domain-containing protein"
                     /protein_id="YP_418521.1"
                     /db_xref="GI:83269230"
                     /db_xref="GeneID:3827137"
                     /translation="MSIDIGGRLRYVRMRQNLSQREFAKRAGVTNSTISLIEANQSNP
                     SVGALKRILDGIPIGMAEFFALEPDAPHRVFYQAEELVEIGKGPISYRQVGDHLFSRA
                     LQILKERYEPGSDTGKVLLMHEGEEGGIVISGRIEVTVGAERRILGPGDAYYFSSKLP
                     HRFRCVGPAPCEIVSACTPPSF"
     misc_feature    305867..306409
                     /locus_tag="BAB2_0310"
                     /note="DNA-binding transcriptional repressor PuuR;
                     Provisional; Region: PRK09943"
                     /db_xref="CDD:182158"
     misc_feature    305879..306052
                     /locus_tag="BAB2_0310"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(305891..305893,305903..305905,305978..305980)
                     /locus_tag="BAB2_0310"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(305900..305902,305975..305977)
                     /locus_tag="BAB2_0310"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(305921..305926,305957..305959,305966..305968,
                     305978..305983)
                     /locus_tag="BAB2_0310"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    306185..306394
                     /locus_tag="BAB2_0310"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            complement(306455..307705)
                     /locus_tag="BAB2_0311"
                     /db_xref="GeneID:3827138"
     CDS             complement(306455..307705)
                     /locus_tag="BAB2_0311"
                     /EC_number="1.4.99.1"
                     /note="catalyzes the oxidative deamination of D-amino
                     acids"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="YP_418522.1"
                     /db_xref="GI:83269231"
                     /db_xref="GeneID:3827138"
                     /translation="MQITILGSGVIGVTTAYYLAKLGHEVTVIDREEGPALETSFANA
                     GQVSPGYASPWAAPGIPLKAAKWLFQKHAPLILRLTTDPVQYRWLLQMLANCTDSRYK
                     INKTRMVRVAEYSRDCLIELRKDTGIEYDQRSQGTLQLFREQYQLDGIGKDIEVLRQD
                     GVPFEVLDRDGCVNVEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKF
                     RFGVNIKSLLMSGGKISGVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGY
                     SITAPIVDESRAPVSTVLDESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDL
                     SVTDLFPGGDLKAATFWSGLRPMTPDSTPIIGGTRYDNLFINAGHGTLGWTMACGSGR
                     LLADLISGNKADIRADDLGIARYN"
     misc_feature    complement(306461..307705)
                     /locus_tag="BAB2_0311"
                     /note="D-amino acid dehydrogenase small subunit;
                     Validated; Region: PRK00711"
                     /db_xref="CDD:234819"
     misc_feature    complement(<307613..307705)
                     /locus_tag="BAB2_0311"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(306500..307657)
                     /locus_tag="BAB2_0311"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(307721..308911)
                     /locus_tag="BAB2_0312"
                     /db_xref="GeneID:3827139"
     CDS             complement(307721..308911)
                     /locus_tag="BAB2_0312"
                     /EC_number="5.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_418523.1"
                     /db_xref="GI:83269232"
                     /db_xref="GeneID:3827139"
                     /translation="MSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAV
                     VKADAYGLGASRVAPAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEA
                     ACAREGILPVLNSLEQVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENV
                     TLLSRIDIKFAISHLANGDEPGNAVNARQLAKMTALLARLPKLPAALANSGGTFLGKT
                     YYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGA
                     TVGYGGTYVANGPMRIATIAVGYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLD
                     VTSLPEGTLKLGSLVELIGPHQRLEDVARDCDTIPYEILTALGNRYARVYVYVNGGGT
                     STTA"
     misc_feature    complement(307754..308878)
                     /locus_tag="BAB2_0312"
                     /note="Alanine racemase [Cell envelope biogenesis, outer
                     membrane]; Region: Alr; COG0787"
                     /db_xref="CDD:223858"
     misc_feature    complement(307757..308863)
                     /locus_tag="BAB2_0312"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Alanine Racemase; Region: PLPDE_III_AR; cd00430"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(307802..307804,307928..307933,
                     308015..308017,308072..308074,308228..308239,
                     308282..308287,308390..308392,308477..308479,
                     308498..308500,308633..308635,308762..308764,
                     308774..308776,308780..308782))
                     /locus_tag="BAB2_0312"
                     /note="active site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(307802..307804,308228..308239,
                     308282..308287,308390..308392,308477..308479,
                     308633..308635,308762..308764,308774..308776,
                     308780..308782))
                     /locus_tag="BAB2_0312"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(307775..307777,307799..307804,
                     307811..307816,307922..307927,307997..307999,
                     308015..308017,308030..308032,308069..308077,
                     308081..308086,308096..308098,308102..308113,
                     308384..308386,308390..308392,308474..308485,
                     308567..308572,308684..308689,308696..308698,
                     308771..308776))
                     /locus_tag="BAB2_0312"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(307802..307804,307928..307933,
                     308015..308017,308072..308074,308390..308392,
                     308477..308479,308762..308764,308774..308776))
                     /locus_tag="BAB2_0312"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(308072..308074,308774..308776))
                     /locus_tag="BAB2_0312"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143481"
     gene            309161..309628
                     /locus_tag="BAB2_0313"
                     /db_xref="GeneID:3827140"
     CDS             309161..309628
                     /locus_tag="BAB2_0313"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_418524.1"
                     /db_xref="GI:83269233"
                     /db_xref="GeneID:3827140"
                     /translation="MSTLDGIDRNIIRCLRRDGRMTNSQLAAQVGLSQSACLRRVHIL
                     EESGVIRGYTAIVGSSDGDERLVAIVRITLDRQTEEYLNRFEEAVRRHPEVQECYLMT
                     GDADYILRVEAENAAAYEIIHKEILSRLPGVARIHSSFAIRTVLLSKALSPRS"
     misc_feature    309161..309613
                     /locus_tag="BAB2_0313"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    309173..>309319
                     /locus_tag="BAB2_0313"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(309176..309184,309224..309232,309257..309268,
                     309272..309277,309284..309289,309293..309298,
                     309314..309319)
                     /locus_tag="BAB2_0313"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(309224..309226,309233..309235)
                     /locus_tag="BAB2_0313"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    309368..309592
                     /locus_tag="BAB2_0313"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            complement(309776..310630)
                     /locus_tag="BAB2_0314"
                     /db_xref="GeneID:3827141"
     CDS             complement(309776..310630)
                     /locus_tag="BAB2_0314"
                     /codon_start=1
                     /transl_table=11
                     /product="heat resistant agglutinin 1"
                     /protein_id="YP_418525.1"
                     /db_xref="GI:83269234"
                     /db_xref="GeneID:3827141"
                     /translation="MKRGCAIAVMICGLITSVSAASAADLIVQEPVFEPLPQPALAGW
                     YLRGDIGYNFKSKTGGKWDFWNQFEEPYRGVDDTFNYDDFSLKGGASYGVGVGYRFND
                     MLRTDLTLDYFRASINGRTNCRSYVKSSHGLNPVEDNCHYEDNSKASVWTAMANAYVD
                     LPRVGPLTPYLGAGIGAAYVKYDTWKTSEICPTCTLQSDKDGFDSWRFAMALMAGVSY
                     DLTDQLKLDLGYRYLRVNGGNAYGYDEQDRQVINQYGQGAGADGPQAKDNGFNIHTVR
                     AGLRYEFR"
     misc_feature    complement(309782..310630)
                     /locus_tag="BAB2_0314"
                     /note="Opacity protein and related surface antigens [Cell
                     envelope biogenesis, outer membrane]; Region: COG3637"
                     /db_xref="CDD:226163"
     gene            complement(310909..312054)
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /db_xref="GeneID:3827175"
     CDS             complement(310909..312054)
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /EC_number="1.1.2.3"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
                     /protein_id="YP_418526.1"
                     /db_xref="GI:83269235"
                     /db_xref="GeneID:3827175"
                     /translation="MSNIVEIADLKRLARRRVPKMFFDYADSGAWTESTYRANEDDFK
                     KIKLRQRVLVDMTNRSLETTMIGEKVAMPVALAPTGLTGMQHANGEMLAAQAAEAFGV
                     PFTLSTMSICSIEDVASVTKKPFWFQLYVMRDRDFVKNLIGRAKAAGCSALVLTLDLQ
                     ILGQRHKDIRNGLSAPPKFTPKHIWQMATCPAWCLGMLGTQRRTFRNIAGHAKNVTDL
                     SSLSSWTAEQFDPQLNWSDVEWIKEQWGGKLILKGILDVEDAKMAAKSGADAIIVSNH
                     GGRQLDGAPSSISMLQPIVEAVGDRIEVHVDGGIRSGQDVLKARALGAQGVYIGRPFL
                     YGLGAMGKEGVTLALEIIRKEMDITMALCGKRDINEIDKSIIHSIDF"
     misc_feature    complement(310936..312033)
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /note="Family of homologous FMN-dependent
                     alpha-hydroxyacid oxidizing enzymes. This family occurs in
                     both prokaryotes and eukaryotes. Members of this family
                     include flavocytochrome b2 (FCB2), glycolate oxidase
                     (GOX), lactate monooxygenase (LMO), mandelate...; Region:
                     alpha_hydroxyacid_oxid_FMN; cd02809"
                     /db_xref="CDD:239203"
     misc_feature    complement(310924..312012)
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /note="FMN-dependent dehydrogenase; Region: FMN_dh;
                     pfam01070"
                     /db_xref="CDD:250340"
     misc_feature    complement(order(311062..311064,311218..311220,
                     311227..311229,311299..311301,311560..311562,
                     311581..311583,311665..311667,311734..311736,
                     311980..311982))
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /note="active site"
                     /db_xref="CDD:239203"
     misc_feature    complement(order(311218..311220,311227..311229,
                     311560..311562,311665..311667,311980..311982))
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239203"
     misc_feature    complement(order(311062..311064,311218..311220,
                     311227..311229,311299..311301,311581..311583,
                     311665..311667,311734..311736))
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239203"
     misc_feature    complement(order(311227..311229,311560..311562,
                     311665..311667))
                     /gene="lldD"
                     /locus_tag="BAB2_0315"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239203"
     gene            312259..314571
                     /locus_tag="BAB2_0316"
                     /db_xref="GeneID:3827142"
     CDS             312259..314571
                     /locus_tag="BAB2_0316"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="YP_418527.1"
                     /db_xref="GI:83269236"
                     /db_xref="GeneID:3827142"
                     /translation="MSKGKKTGFIGKRSSAAGGWGALKSCGQQLLASGAPLAGARALL
                     KANQPDGFDCPGCAWGDPEHGSSFEFCENGVKAVAWEATDRRTTPAFFREHTVSKLRE
                     WTDYDLENTGRLTHPMRYNTATDKYEAVEWDEAFQAIGGILKSFDTPDRVEFYTSGRA
                     SNEAAFLYQLFVRAYGTNNFPDCSNMCHEASGVALTQSVGVGKGTVLLEDFEQADAIF
                     VVGQNPGTNHPRMLGDLRRAAERGARIVAFNPVRERGLERFADPQDKLEMLHGGSEPI
                     TSDYFQPRLGGDLAAFRGMAKAVFAADDAALAAGRPSVLDRAFLAAHTAELEAYRAAV
                     DATSWDEIEDQSGLLRQSLERAAEIYMQAGRVICTWAMGITQHRHSVITIREITNFML
                     LRGNIGKPGAGLCPVRGHSNVQGDRTVGINEHPPVAFLDALEREFGFKPPREPGHNVL
                     GAIGAMLDGTAQAFVALGGNFARATPDSPIISRALSSQRLTVHIATKLNHSHLVPGRD
                     SFILPCLGRTEIDLNSKGVAQIVTVEDSMSMVHGSGGINQPASPLLRSEVAIIAGMAN
                     ATLGPKPVDWLALADDYDLIREHIARVLPDFHDYNRRVRVPRGFHLRNAARDLEWNTP
                     TGKATFWTGALPQAIEHQQVRDKPGRYVLQTFRSHDQYNTTIYGMNDRYRGVYGERHV
                     VFMNPLDMADLGVEAGDRADIVGEFDDGVERVAANFRFVPYDIPRGCIAGYYPEMNVL
                     VPLGSAGDESDTPTSKSIIVSFRLNRTKAA"
     misc_feature    312304..314538
                     /locus_tag="BAB2_0316"
                     /note="oxidoreductase alpha (molybdopterin) subunit;
                     Region: Fdhalpha-like; TIGR01701"
                     /db_xref="CDD:233538"
     misc_feature    312409..314148
                     /locus_tag="BAB2_0316"
                     /note="The MopB_ydeP CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative molybdopterin
                     cofactor binding site. These members belong to the
                     molybdopterin_binding (MopB) superfamily of proteins;
                     Region: MopB_ydeP; cd02767"
                     /db_xref="CDD:239168"
     misc_feature    order(312541..312543,312808..312810,312814..312822,
                     312916..312921,312925..312927,312934..312939,
                     313000..313008,313120..313122,313369..313380,
                     313483..313488,313660..313668,313738..313746,
                     313753..313755,313798..313803,313861..313863)
                     /locus_tag="BAB2_0316"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239168"
     misc_feature    314209..314544
                     /locus_tag="BAB2_0316"
                     /note="The MopB_CT_ydeP CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative molybdopterin
                     cofactor binding site. This CD is of the conserved
                     molybdopterin_binding C-terminal (MopB_CT) region...;
                     Region: MopB_CT_ydeP; cd02787"
                     /db_xref="CDD:239188"
     misc_feature    order(314221..314235,314239..314250,314458..314460,
                     314470..314472,314521..314526)
                     /locus_tag="BAB2_0316"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239188"
     gene            314568..314858
                     /locus_tag="BAB2_0317"
                     /db_xref="GeneID:3827143"
     CDS             314568..314858
                     /locus_tag="BAB2_0317"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418528.1"
                     /db_xref="GI:83269237"
                     /db_xref="GeneID:3827143"
                     /translation="MMDEDEAEYMRLVEALKAEAGRLSGLGAGIVAGLALDIASDSRT
                     FARVFGLAHALVLRELTALAQTGDYVRIRQRDARTHYELGQAGHRLVEEVKG"
     gene            314874..315089
                     /locus_tag="BAB2_0318"
                     /db_xref="GeneID:3828190"
     CDS             314874..315089
                     /locus_tag="BAB2_0318"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418529.1"
                     /db_xref="GI:83269238"
                     /db_xref="GeneID:3828190"
                     /translation="MNYLDFEFCAAAPKPSAMPILGRFHGKPEQFLCILSKSIVAITM
                     IHDVLKACFSLHAFDCILTATKQTRIV"
     gene            315144..316262
                     /locus_tag="BAB2_0319"
                     /db_xref="GeneID:3828191"
     CDS             315144..316262
                     /locus_tag="BAB2_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein DnaJ"
                     /protein_id="YP_418530.1"
                     /db_xref="GI:83269239"
                     /db_xref="GeneID:3828191"
                     /translation="MQRAARTGKYLILGAFAGLATCIQILSAGSPAYADSLNVVPVAV
                     REAKLVDYQPKLTLSGAVAARSLVNVSFRVNGQVVERLVDIGQHVEKGQLLARIDDVE
                     QRANMRVAQASMDAAEAQLVQADANFKRQQALLKQGFTTRSQYDQADQALRTAQSALS
                     SAQSQLGNARDELSYTELHAPVSGVVTARNIETGQVVQAAQTAFSIAEDGSRDAIFDV
                     QETLVNHARIGMGVTVALLADPSIEAEGNIRELSPVVDAQTGTVRVKVGIAQATAQMA
                     LGAIVTGTVHMDARQVIVLPWSAMTSEAGRTAVWRVDRDTHVATLVPIKVLAYEKERV
                     IVESGLNNGELIVTKGAQMLRSGEPVEIMQGPEGAGSQ"
     misc_feature    315267..316229
                     /locus_tag="BAB2_0319"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    315345..315479
                     /locus_tag="BAB2_0319"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    <315432..315668
                     /locus_tag="BAB2_0319"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    315672..315953
                     /locus_tag="BAB2_0319"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     misc_feature    <316020..316154
                     /locus_tag="BAB2_0319"
                     /note="putative membrane fusion protein; Region:
                     TIGR02828"
                     /db_xref="CDD:131875"
     gene            316259..317278
                     /locus_tag="BAB2_0320"
                     /pseudo
                     /db_xref="GeneID:3828192"
     misc_feature    316259..317278
                     /locus_tag="BAB2_0320"
                     /note="secretion protein, putative"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12486.1"
     gene            317275..320349
                     /locus_tag="BAB2_0321"
                     /db_xref="GeneID:3828193"
     CDS             317275..320349
                     /locus_tag="BAB2_0321"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="YP_418531.1"
                     /db_xref="GI:83269240"
                     /db_xref="GeneID:3828193"
                     /translation="MKKGFNLSDWALNHRSLVWYFMLVFLVAGLVSYLDLGREEDPEF
                     TVKTMVVQANWPGASIDETLNQVTDRLEKKLEELDTLDYTRSVTTAGKSVVFVFLKDT
                     TRAQDVKKSWTEVCHLLTDIQNTLPQGVYGPYFNDQFGDVFGNIYAFTADGLSMRQLR
                     DYAEDVRTKILTIPNAGKVELIGAQDEAIYLEFSTRQVAALGLDQQAILKALQDQNAI
                     TPSGVVQAGPERISVRVSGQFNSEADLRAVNLRVNNRFFRLSDVATITRGYVDPPTSI
                     FRVNGEDAIGLGIGMKPNGNLLEFGAELDKMMDQVTAELPVGVKVFKVADQPQVVKEA
                     VSGFTQALFEAVVIVLAVSFVSLGLRAGFVVSLSIPLVLAITFLSMSLMDISLQRVSL
                     GALIIALGLLVDDAMIAVEMMVARLEHGDPINKAATYVYSHTAFPMLTGTLVTIAGFI
                     PIGLNNSQAGEYTFTLFVVIAVSLLVSWVVAVLFAPLLGVTFLPKKMKPHEEKRSRFF
                     EAFSRVLLLSMRHKWTTIITTIVLFVISVFGMGFIERQFFPQSDRPELVLDWTLPQNS
                     SIADTKAQMERFEETMLKDNPDVEHWSTYVGQGAIRFVLSFDVQPANPYFGQMVVVAR
                     DVEARDRLKAKFEAAFRKDYVGTDVYVKYLELGPPVGRPVQYRISGPDVQKLRGIAQD
                     FAGILSADKRLGVVNYNWNEPGRVIRVDVMQDKARKLGISSKDIATTLNGVVGGITIT
                     QVRDSIYLIDVIARAQAHERDSIDTLQSLQIATGNGTSVPLAAIANFRYELEQPVIYR
                     RSRIPTITVAAGIIDKTMPDTIARDLGPAIKTFADRLPAGYYIQTAGTVEESGKSQGP
                     IAAVVPLMLFVMATVLMVQLQSFQRLFLVVAVAPLGLIGVVAALLPSGKPLGFVAILG
                     VLALIGILIRNSVILIVQVEEDIQEGLHPWDAVMKASQHRMRPIALTAAAASLALIPI
                     AREVFWGPMAYAMMGGIIAGTAITLLFLPALYVAWFRIKEPEHSPDEPHPAS"
     misc_feature    317290..320304
                     /locus_tag="BAB2_0321"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    <318259..318903
                     /locus_tag="BAB2_0321"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     cl10482"
                     /db_xref="CDD:245312"
     gene            320494..321219
                     /locus_tag="BAB2_0322"
                     /db_xref="GeneID:3828194"
     CDS             320494..321219
                     /locus_tag="BAB2_0322"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418532.1"
                     /db_xref="GI:83269241"
                     /db_xref="GeneID:3828194"
                     /translation="MRDPQLAGPLYRSLARILGELIEEGQLAPAVGLPPERDLAEQLG
                     IGRITVRKAYKELLTQGFVESRRGSGTFVAERPVRISQHLWRLTSFSQDMISRGKEPG
                     ARVVTNRIDKPSPDEAFRLGIGVDASVVRLDRLRLADGVPMAFERAVVPRHYLDQDRV
                     DETSLYEALARRGHKPVRALQRLTAVTLDPGTAHLLGVHHGAPALLIERVSHLEDDRI
                     VEYTRSHYRADAYDFVAELKIGE"
     misc_feature    320500..321204
                     /locus_tag="BAB2_0322"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    320518..320715
                     /locus_tag="BAB2_0322"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(320518..320520,320524..320526,320593..320595,
                     320599..320604,320626..320640,320644..320649,
                     320656..320658,320686..320691,320695..320706)
                     /locus_tag="BAB2_0322"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    320779..321189
                     /locus_tag="BAB2_0322"
                     /note="UTRA domain; Region: UTRA; pfam07702"
                     /db_xref="CDD:254372"
     gene            321222..322253
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /db_xref="GeneID:3827923"
     CDS             321222..322253
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /EC_number="3.5.99.6"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar isomerase"
                     /protein_id="YP_418533.1"
                     /db_xref="GI:83269242"
                     /db_xref="GeneID:3827923"
                     /translation="MNSPSSLMLQETEQSPAVVAKLLEKEAGTFAEIARIFRKNDPAV
                     ITTAARGSSDHAATFFKYLIEIATGVPVASIGPSIASVYGSRLKLKNGLHFTVSQSGA
                     SPDIIAAQEAAKKGGATTIAVVNVVESPLARDADIVLALHAGEEKSVAATKSFIASVA
                     ALSGVVAASSGDAGLRGGLERLPEALAATRPEGREVVENLLFNARSLYTGGRGTAFAI
                     SLEAALKAKETANIHAEAFSLAELMHGPMRLIEEGFPIVSFLPRDEAFDTNIAALKRL
                     HSFGASIVTLSDAQTPGFRLPSASTGSPHLDPLVSLINYYRVIEAVTRRKGFDPDKPR
                     NLNKVTVTV"
     misc_feature    321231..322247
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="Predicted phosphosugar isomerases [Cell envelope
                     biogenesis, outer membrane]; Region: AgaS; COG2222"
                     /db_xref="CDD:225132"
     misc_feature    321354..321707
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    order(321369..321374,321402..321407,321414..321419,
                     321438..321440,321444..321446,321459..321461,
                     321468..321470,321534..321536)
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    order(321375..321380,321513..321521)
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    321792..322244
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    order(321858..321860,321900..321902,321912..321914,
                     321918..321920,321924..321926,321930..321932,
                     321942..321944,321948..321956,321960..321971,
                     322020..322025,322035..322037,322041..322046,
                     322221..322226,322239..322241)
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    order(321894..321896,321903..321905)
                     /gene="nagB"
                     /locus_tag="BAB2_0323"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            322250..323416
                     /locus_tag="BAB2_0324"
                     /db_xref="GeneID:3828195"
     CDS             322250..323416
                     /locus_tag="BAB2_0324"
                     /EC_number="3.5.1.25"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate
                     deacetylase:amidohydrolase"
                     /protein_id="YP_418534.1"
                     /db_xref="GI:83269243"
                     /db_xref="GeneID:3828195"
                     /translation="MMKKSAIAGARIFDGERFHDQSALVFSDGQIEAIVPEASLAEGH
                     EIERLKGGVLAPGFIDAQVNGGGGRMLNDEPTPETMFVIAGGHRKYGTTSLLPTLITD
                     TMPVRDRAIEAAIEAVKADRGVAGLHLEGPHLAPARKGAHLAELMRPVNDADIALYIH
                     TARQIGTLLVTLAAEQVTPEQVRRLSDGGVIVSIGHSDTTAEEAFRRFDAGARSVTHL
                     YNAMSQIGHRAPGLAGAALDHPDIWCGIVADGHHVDPMALRLALRAKRGDAHLFLVTD
                     AMALVGSDAESFEINGRSVRRVPGGICSKLVLPDGTIAGSDLDMASAVRFAVAELELT
                     LAEALRMASLYPARYLRLNDRGRFRPGMRMDAVHLDDGLFAKSTWLSGEKQIAG"
     misc_feature    322259..323401
                     /locus_tag="BAB2_0324"
                     /note="N-acetylglucosamine-6-phosphate deacetylase
                     [Carbohydrate transport and metabolism]; Region: NagA;
                     COG1820"
                     /db_xref="CDD:224733"
     misc_feature    322265..323395
                     /locus_tag="BAB2_0324"
                     /note="N-acetylglucosamine-6-phosphate deacetylase, NagA,
                     catalyzes the hydrolysis of the N-acetyl group of
                     N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to
                     glucosamine 6-phosphate and acetate. This is the first
                     committed step in the biosynthetic pathway to...; Region:
                     NagA; cd00854"
                     /db_xref="CDD:238434"
     misc_feature    order(322433..322435,322439..322441,322637..322639,
                     322670..322672,322835..322837,322898..322900,
                     322907..322912,323003..323005,323075..323077,
                     323186..323188)
                     /locus_tag="BAB2_0324"
                     /note="active site"
                     /db_xref="CDD:238434"
     misc_feature    order(322904..322906,322922..322924,322928..322933,
                     322937..322939,322958..322963,323000..323011,
                     323015..323020,323024..323029,323036..323038)
                     /locus_tag="BAB2_0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238434"
     gene            323424..324152
                     /locus_tag="BAB2_0325"
                     /db_xref="GeneID:3828196"
     CDS             323424..324152
                     /locus_tag="BAB2_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418535.1"
                     /db_xref="GI:83269244"
                     /db_xref="GeneID:3828196"
                     /translation="MTEITDRYFNDVIARLSGLRDRLAAQMEKAADLIAAAARADRRV
                     YVFGTGHSHMMAEELHYRAGGLAITVPILCGSIMLQDGAVASSHFERIEGAVRPILDR
                     YGIRDGDVLVVVSNSGVNAAPIEAARYAREKGAAIIALTSVAYSNTIARGRTQLLSLA
                     DVVLDNDAPSGDAVLEIAGSALKVGPVSTALGVTILNAVFADVAARLVGEGDAPIYLS
                     ANMPGSGDINRSLVERYRDHNPHL"
     misc_feature    323553..323939
                     /locus_tag="BAB2_0325"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    <323553..323915
                     /locus_tag="BAB2_0325"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    order(323577..323579,323766..323768)
                     /locus_tag="BAB2_0325"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            324296..325180
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /db_xref="GeneID:3827822"
     CDS             324296..325180
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /EC_number="3.5.1.10"
                     /note="produces formate from formyl-tetrahydrofolate which
                     is the major source of formate for PurT in de novo purine
                     nucleotide biosynthesis; has a role in one-carbon
                     metabolism; forms a homohexamer; activated by methionine
                     and inhibited by glycine"
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="YP_418536.1"
                     /db_xref="GI:83269245"
                     /db_xref="GeneID:3827822"
                     /translation="MLNFVLTVTCKSTRGIVATISGYLAGKGCNIIDSAQFDDLDTGR
                     FFMRVSFISEEGVLLDELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDL
                     LYRWKIGALPIDIVGVVSNHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDT
                     NTELVVLARYMQVLSDEFCQKMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATA
                     HYVTANLDEGPIIEQDVARITHAQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGN
                     RTVVFPASPGSFASERMG"
     misc_feature    324296..325141
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="formyltetrahydrofolate deformylase; Reviewed;
                     Region: PRK13011"
                     /db_xref="CDD:237266"
     misc_feature    324308..324526
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="N-terminal ACT domain of formyltetrahydrofolate
                     deformylase (F4HF-DF; formyltetrahydrofolate hydrolase);
                     Region: ACT_F4HF-DF; cd04875"
                     /db_xref="CDD:153147"
     misc_feature    324554..325138
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="Formyltetrahydrofolate deformylase (Formyl-FH4
                     hydrolase), C-terminal hydrolase domain; Region:
                     FMT_core_Formyl-FH4-Hydrolase_C; cd08648"
                     /db_xref="CDD:187717"
     misc_feature    order(324569..324571,324584..324589,324794..324817,
                     324830..324832,324857..324868,324890..324892,
                     324950..324952,324956..324961,324968..324973)
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="putative active site [active]"
                     /db_xref="CDD:187717"
     misc_feature    order(324584..324589,324797..324802,324860..324862,
                     324866..324868,325058..325060)
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187717"
     misc_feature    order(324794..324796,324803..324805,324809..324817,
                     324830..324832,324857..324859,324956..324961,
                     324968..324973)
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187717"
     misc_feature    order(324857..324859,324863..324865,324971..324973)
                     /gene="purU"
                     /locus_tag="BAB2_0326"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187717"
     gene            complement(325404..326906)
                     /locus_tag="BAB2_0327"
                     /db_xref="GeneID:3828197"
     CDS             complement(325404..326906)
                     /locus_tag="BAB2_0327"
                     /EC_number="1.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="YP_418537.1"
                     /db_xref="GI:83269246"
                     /db_xref="GeneID:3828197"
                     /translation="MNTAVRKIDVKKEAADLLSKLGVDASAYTGGDLTGFSPVSGEEI
                     ASIKTHSKEDAEKIIAKADEAFRAWRTVPAPKRGELIRLLGEELRASKEDLGRLVSLE
                     AGKIPSEGLGEVQEMIDICDFAVGLSRQLYGLTIATERAGHRMMETWHPLGVVGVISA
                     FNFPVAVWSWNAALAIVCGNAVVWKPSEKTLLTALACDAIFKRALKRFGDAPEGISQL
                     LLGDREIGEVLVDSPKVPVVSATGSTRMGREVGPRLAKRFARAILELGGNNAGIVCPS
                     ADLDMALRAIAFGAMGTAGQRCTTLRRLFVHESVYDALVPRLQKAYASVSVGSPLETS
                     ALVGPLIDKQAFDNMQKALKEAAAHGGKVQGGERVDTGYENAYYVRPAIVEMPRQEGP
                     VLEETFAPILYVMKYSDFDDVLASHNAVGAGLSSSIFTLNLQEAERFLSAEGSDCGIA
                     NVNIGTSGAEIGGGRESGSDAWKAYMRRATNTINYSKALPLAQGVSFDID"
     misc_feature    complement(325449..326819)
                     /locus_tag="BAB2_0327"
                     /note="NAD+-dependent alpha-aminoadipic semialdehyde
                     dehydrogenase, ALDH family members 7A1 and 7B; Region:
                     ALDH_F7_AASADH; cd07130"
                     /db_xref="CDD:143448"
     misc_feature    complement(order(325452..325457,325461..325478,
                     325488..325490,325497..325502,325512..325514,
                     325527..325532,325548..325559,325563..325565,
                     325572..325574,325584..325589,325605..325607,
                     325674..325676,325899..325901,325935..325937,
                     326043..326045,326124..326129,326142..326144,
                     326151..326156,326163..326165,326457..326459,
                     326463..326468,326487..326498,326502..326504,
                     326508..326510,326514..326516,326520..326525,
                     326640..326642,326661..326663,326679..326681,
                     326688..326690,326706..326708))
                     /locus_tag="BAB2_0327"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143448"
     misc_feature    complement(order(325719..325721,326013..326015,
                     326109..326117,326160..326162,326169..326171,
                     326178..326189,326226..326231,326343..326348,
                     326352..326354,326421..326432))
                     /locus_tag="BAB2_0327"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143448"
     misc_feature    complement(order(326013..326015,326022..326024,
                     326115..326117,326421..326423))
                     /locus_tag="BAB2_0327"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143448"
     gene            complement(326980..328380)
                     /locus_tag="BAB2_0328"
                     /db_xref="GeneID:3828198"
     CDS             complement(326980..328380)
                     /locus_tag="BAB2_0328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418538.1"
                     /db_xref="GI:83269247"
                     /db_xref="GeneID:3828198"
                     /translation="MKDQKFVSPDAIRSAFSAAMSAMYREEVPAYGTLMDLVADVNAK
                     VLADDSHLHERLAETDALDRISEERHGAIRLGTAAELSMMRRVFAVMGMFPVGYYDLS
                     AAGVPVHSTAFRPVNDAALKHNPFRVFTSLLRLDLITDEKLRAQSQDVLSKRNIFMAG
                     AVALVEKAEAEGGLLEEDAKTFVAEVLETFRWHDRANVSAELYHRLHDAHRLIADVVS
                     FKGPHINHLTPRTLDIDAVQEQMPQRGINPKAVVEGPPTRNCPILLRQTSFKALEEEV
                     SFIGDNGEWTPGSHTARFGEIEQRGVALTPKGRALYDKLLNDTRAIVRPAPDGSNASD
                     YVKALGDTFAAFPDTWAGIREEGLGYFAYSVKDAAKLASFRPGTDIEVLIEAGAVQFD
                     PITYEDFLPVSAAGIFQSNLGDDETQEFVESPNQKRFEDDLGAKVLNEFEHYARIERE
                     SIEALQAGLKGLEAAE"
     misc_feature    complement(326983..328374)
                     /locus_tag="BAB2_0328"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5383"
                     /db_xref="CDD:227673"
     gene            328528..329460
                     /locus_tag="BAB2_0329"
                     /db_xref="GeneID:3828199"
     CDS             328528..329460
                     /locus_tag="BAB2_0329"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_418539.1"
                     /db_xref="GI:83269248"
                     /db_xref="GeneID:3828199"
                     /translation="MNLSRRLIPDIATLQAFECAARHGSFTQAAHELNLTQSAVSRQI
                     KDLESQLGVLLFERIRQRILLSDAGRKFLPEVRRLLNQTEDTMLRAMASAQSTSSFSI
                     ATLPTFGTRWLMPRIPDFVEKHPGIALNVASRSGVFDFEEQPFDLAIHYGQPVWAHAT
                     CTFLCSEVIVPVASPSLLKTRRPASPEELENEPLLHLATRPKMWAQWFESCGVEGQSA
                     YRGHRFEQFSMVIGAALAGLGFALLPLYLIEQELRSGELVLLFEKPMRTENEYYLVVP
                     EGKLENPLTQVFCQWIAGQVGNTDYSSLVHSKPE"
     misc_feature    328537..329427
                     /locus_tag="BAB2_0329"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    328567..328737
                     /locus_tag="BAB2_0329"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    328831..329403
                     /locus_tag="BAB2_0329"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators GcdR-like, contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_GcdR_like; cd08481"
                     /db_xref="CDD:176170"
     misc_feature    order(328831..328845,328849..328902,328906..328926)
                     /locus_tag="BAB2_0329"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176170"
     misc_feature    order(328840..328845,328849..328851,329200..329208,
                     329266..329268)
                     /locus_tag="BAB2_0329"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176170"
     gene            329560..330843
                     /locus_tag="BAB2_0330"
                     /db_xref="GeneID:3828200"
     CDS             329560..330843
                     /locus_tag="BAB2_0330"
                     /EC_number="1.5.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit beta"
                     /protein_id="YP_418540.1"
                     /db_xref="GI:83269249"
                     /db_xref="GeneID:3828200"
                     /translation="MLNDPRSHGLWEKTAPAAPKTTALQGDLAADVVIVGGGFTGLST
                     ALHLAEKGVCAIVLEGIEIGYGGSGRNVGLVNAGMWVMPDDLPGVLGQKYGDRLLDVL
                     GNAPKLVFEIIEKHKIACEVEKQGTLHCAVGQKGLKELEDRHEQWARRGANVKLLDAR
                     ETEARVGTRAYTGSLLDLRAGTVQPLAYVRGLAHAAIAAGATVFTGSPVIGAEEKNGK
                     WVVRTARGSVTANWVVVATNAYTNAPWAEVRAELVHLPYFNMATKPLSDNLKKSILPE
                     RQGVWDTKEVLSSFRFDQQGRLVFGSVGALRNTGAAVHKAWAKKSLKRLFPQIGAVEF
                     EAEWYGKIGMTNDSLPKFHRLARNVVGFSGYNGRGNAPGTVFGKLLSQLVSGEISEAD
                     LPLPVSDLKEQNFRGLREAYYEAGAQVAHVAEMVI"
     misc_feature    329593..330720
                     /locus_tag="BAB2_0330"
                     /note="putative aminophosphonate oxidoreductase; Region:
                     Phn_aa_oxid; TIGR03329"
                     /db_xref="CDD:132372"
     misc_feature    329635..330777
                     /locus_tag="BAB2_0330"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     gene            complement(330938..331585)
                     /locus_tag="BAB2_0331"
                     /pseudo
                     /db_xref="GeneID:3828201"
     misc_feature    complement(330938..331585)
                     /locus_tag="BAB2_0331"
                     /note="Ribosomal protein S1:RNA binding S1"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12497.1"
     gene            complement(331633..333069)
                     /locus_tag="BAB2_0332"
                     /pseudo
                     /db_xref="GeneID:3828202"
     misc_feature    complement(331633..333069)
                     /locus_tag="BAB2_0332"
                     /note="Ribonuclease RNase H fold containing"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12498.1"
     gene            complement(333136..333231)
                     /locus_tag="BAB2_0333"
                     /pseudo
                     /db_xref="GeneID:3828203"
     misc_feature    complement(333136..333231)
                     /locus_tag="BAB2_0333"
                     /note="tex protein, putative"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12499.1"
     gene            333449..333757
                     /locus_tag="BAB2_0334"
                     /db_xref="GeneID:3828204"
     CDS             333449..333757
                     /locus_tag="BAB2_0334"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription regulator ArsR"
                     /protein_id="YP_418541.1"
                     /db_xref="GI:83269250"
                     /db_xref="GeneID:3828204"
                     /translation="MSDVQPIPLDEILKALANPVRLDILSWLKEPEKHFSGQHMPLEM
                     GVCAGQFERCGLSQSSVSAHLSVLTKAGLIMPHRVGQWTFYKRDEEAIAAAIKALSAL
                     "
     misc_feature    333485..333715
                     /locus_tag="BAB2_0334"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(333485..333490,333494..333496,333503..333505,
                     333512..333517,333524..333529,333536..333538,
                     333662..333664)
                     /locus_tag="BAB2_0334"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(333488..333493,333503..333511,333548..333556,
                     333617..333628,333632..333637,333644..333649,
                     333653..333658,333674..333682,333695..333703)
                     /locus_tag="BAB2_0334"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(333548..333550,333575..333577)
                     /locus_tag="BAB2_0334"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            333801..334916
                     /locus_tag="BAB2_0335"
                     /db_xref="GeneID:3828205"
     CDS             333801..334916
                     /locus_tag="BAB2_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="YP_418542.1"
                     /db_xref="GI:83269251"
                     /db_xref="GeneID:3828205"
                     /translation="MASLFDPITIGDLKLANRIVMAPLTRNRSPHAVPNDLNVIYYEQ
                     RASAGLIITEATPISQQGQGYADVPGLYSAEQLAGWRRVSDAVHNAGGKIVAQMWHVG
                     RISHNSLQPNGEKPVAPSAITAKSKTYLVHPDGAGEFVPTSEPRALEKSELPGIVADY
                     ARAAKDAVETAGFDGVEIHAANGYLIDQFLRGGSNQRTDEYGGSIENRARFLFEVVDA
                     VTKAIGAGKVGIRLSPVTPANDASDPDPQPLFDYVIGKLAACGLAYIHIIEGATGGPR
                     DFQQGPQPFDYARFKQVYRDAGGKAAWMVNNGYDRKMAEEEVEAGRADLVAFGKPFIA
                     NPDLVRRLKENAPLNELDQKHMYGGGAKGYTDYPVLA"
     misc_feature    333810..334859
                     /locus_tag="BAB2_0335"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    order(333867..333869,333873..333875,333963..333965,
                     334089..334091,334491..334493,334719..334721,
                     334779..334781,334785..334793)
                     /locus_tag="BAB2_0335"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    order(333867..333869,333873..333875,333963..333965,
                     334089..334091,334095..334097,334116..334118,
                     334335..334337,334344..334346,334350..334352,
                     334491..334493,334512..334514,334719..334721,
                     334779..334781,334785..334790)
                     /locus_tag="BAB2_0335"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    order(333873..333875,334095..334097,334335..334337,
                     334344..334346,334350..334352,334788..334790)
                     /locus_tag="BAB2_0335"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    334350..334352
                     /locus_tag="BAB2_0335"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
     gene            complement(334954..335391)
                     /locus_tag="BAB2_0336"
                     /db_xref="GeneID:3828206"
     CDS             complement(334954..335391)
                     /locus_tag="BAB2_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_418543.1"
                     /db_xref="GI:83269252"
                     /db_xref="GeneID:3828206"
                     /translation="MDDLDEKLITLLRHNGRRSISDIAIDLGVSRATVRARMERLERS
                     GDILGYTVILRSDAVDLPVRGIMMIEIEGHVADRVVKALGGFSEISAIHTTNGRFDLV
                     VELGAATLTDFDAVLRRIRLVPGIKASETNLLLATPRSTRARL"
     misc_feature    complement(334963..335391)
                     /locus_tag="BAB2_0336"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(335077..335391)
                     /locus_tag="BAB2_0336"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            335522..336442
                     /gene="rocF"
                     /locus_tag="BAB2_0337"
                     /db_xref="GeneID:3827836"
     CDS             335522..336442
                     /gene="rocF"
                     /locus_tag="BAB2_0337"
                     /EC_number="3.5.3.1"
                     /codon_start=1
                     /transl_table=11
                     /product="arginase:arginase/agmatinase/formiminoglutamase"
                     /protein_id="YP_418544.1"
                     /db_xref="GI:83269253"
                     /db_xref="GeneID:3827836"
                     /translation="MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTD
                     LGNLAPAAQRPLQHPNHAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGT
                     VPGIARRAAEKGRKQFVLWLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKL
                     AAPIDPHNVCMLGIRSVDPAEREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAED
                     GLLHVSLDVDFLDPSIAPAVGTTVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFL
                     DERGRTAAVMVDLMASLLGRSVMDRPTISY"
     misc_feature    335531..336400
                     /gene="rocF"
                     /locus_tag="BAB2_0337"
                     /note="Arginase family; Region: Arginase; cd09989"
                     /db_xref="CDD:212515"
     misc_feature    order(335807..335809,335888..335890,335894..335896,
                     335900..335902,335906..335908,335939..335944,
                     336053..336055,336062..336064,336197..336199,
                     336203..336205,336332..336334)
                     /gene="rocF"
                     /locus_tag="BAB2_0337"
                     /note="active site"
                     /db_xref="CDD:212515"
     misc_feature    order(335807..335809,335888..335890,335894..335896,
                     335900..335902,336197..336199,336203..336205)
                     /gene="rocF"
                     /locus_tag="BAB2_0337"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:212515"
     misc_feature    order(336044..336046,336050..336052,336065..336067,
                     336074..336079,336101..336109,336113..336124,
                     336131..336136,336143..336145,336248..336271,
                     336287..336289)
                     /gene="rocF"
                     /locus_tag="BAB2_0337"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212515"
     gene            336481..337557
                     /locus_tag="BAB2_0338"
                     /db_xref="GeneID:3828207"
     CDS             336481..337557
                     /locus_tag="BAB2_0338"
                     /EC_number="4.3.1.12"
                     /note="catalyzes the formation of L-proline from
                     L-ornithine"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="YP_418545.1"
                     /db_xref="GI:83269254"
                     /db_xref="GeneID:3828207"
                     /translation="MTQPNLNIVPFVSVDHMMKLVLRVGVETFLKELAGYVEEDFRRW
                     QNFDKTPRVASHSKEGVIELMPTSDGTLYGFKYVNGHPKNTRDGLQTVTAFGVLADVG
                     SGYPMLLTEMTILTALRTAATSAVAAKHLAPKNARTMAIIGNGAQSEFQALAFKAILG
                     VDKLRLYDLDPQATAKCIRNLQGAGFNIVACKSVEEAVEGADIITTVTADKANATILT
                     DNMVGAGVHINAVGGDCSGKTELHGDILRRSDIFVEYPPQTRIEGEIQQLPEDYPVNE
                     LWEVITGRIAGRKDARQITLFDSVGFATEDFSALRYVRDKLKDTGLYEQLDLLADPDE
                     PRDLYGMLLRHEKLLQSESTKPAA"
     misc_feature    336496..337467
                     /locus_tag="BAB2_0338"
                     /note="Predicted ornithine cyclodeaminase, mu-crystallin
                     homolog [Amino acid transport and metabolism]; Region:
                     COG2423"
                     /db_xref="CDD:225280"
     misc_feature    336502..337521
                     /locus_tag="BAB2_0338"
                     /note="ornithine cyclodeaminase; Validated; Region:
                     PRK07589"
                     /db_xref="CDD:236064"
     gene            complement(337570..337995)
                     /locus_tag="BAB2_0339"
                     /db_xref="GeneID:3828208"
     CDS             complement(337570..337995)
                     /locus_tag="BAB2_0339"
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent protein translocase protein
                     TatC"
                     /protein_id="YP_418546.1"
                     /db_xref="GI:83269255"
                     /db_xref="GeneID:3828208"
                     /translation="MTILINQPHPSIDRDSIDRLVEIFYGRAREDEIIGPIFNRTVKD
                     WDHHLARISEFWSSVILKTGGYDGRPMPPHLALNLENEHFDLWLELFEQTAQEIFPPE
                     AAIIFVDRARRIADSFEMAIATHSGRIRAPRHSRLPLIS"
     misc_feature    complement(337636..337956)
                     /locus_tag="BAB2_0339"
                     /note="Truncated hemoglobins (trHbs) are a family of
                     oxygen-binding heme proteins found in cyanobacteria,
                     eubacteria, unicellular eukaryotes, and plants. The
                     truncated hemoglobins have a characteristic two-over-two
                     alpha helical folding pattern that is distinct...; Region:
                     Trunc_globin; cd00454"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(337663..337665,337672..337674,
                     337702..337704,337711..337713,337723..337725,
                     337732..337734,337816..337818,337825..337830,
                     337924..337926,337933..337938,337945..337950))
                     /locus_tag="BAB2_0339"
                     /note="apolar tunnel; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(337642..337644,337654..337656,
                     337735..337737,337744..337746,337765..337767,
                     337774..337779,337783..337785,337789..337791,
                     337798..337800,337828..337833,337840..337842,
                     337852..337854,337882..337887,337921..337923))
                     /locus_tag="BAB2_0339"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(337699..337707,337717..337719,
                     337726..337728,337903..337908,337915..337917))
                     /locus_tag="BAB2_0339"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238256"
     gene            338067..338576
                     /locus_tag="BAB2_0340"
                     /db_xref="GeneID:3827554"
     CDS             338067..338576
                     /locus_tag="BAB2_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418547.1"
                     /db_xref="GI:83269256"
                     /db_xref="GeneID:3827554"
                     /translation="MKLCAIVTGWRRYWSGSVETGPLSSHVLNLRSDEHHHRDPADDD
                     ENKPANQHGREGASGGIATARLIAAERDRFLGGRVVLVHHISPSREYPMINMLRLVCD
                     SANKPDAELICVGQFFCVNSIRFPSGPQPACCSCAFRRSAMQPIAAAILLVLKSKNPG
                     RSRDFVAYT"
     gene            complement(338585..338659)
                     /gene="tRNA-Gly2"
                     /locus_tag="BAB2_1167"
                     /db_xref="GeneID:3827789"
     tRNA            complement(338585..338659)
                     /gene="tRNA-Gly2"
                     /locus_tag="BAB2_1167"
                     /product="tRNA-Gly"
                     /note="anticodon GCC, Cove Score=86.28"
                     /db_xref="GeneID:3827789"
     gene            338791..338982
                     /locus_tag="BAB2_0341"
                     /db_xref="GeneID:3827555"
     CDS             338791..338982
                     /locus_tag="BAB2_0341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418548.1"
                     /db_xref="GI:83269257"
                     /db_xref="GeneID:3827555"
                     /translation="MFSVCFGLRRWLVIRENQAEKAVICLWSKRIGRAGCSLKTAFCT
                     IFCCEVSEGEAMLYKPVRN"
     gene            338990..339532
                     /locus_tag="BAB2_0342"
                     /db_xref="GeneID:3827556"
     CDS             338990..339532
                     /locus_tag="BAB2_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418549.1"
                     /db_xref="GI:83269258"
                     /db_xref="GeneID:3827556"
                     /translation="MKTTGGIMPLTPKEFHDLLHKLGIGVTTVEHPPLFTVADSQNLR
                     GEIPGGHTKNLFLKDKKDNFFLVTVEEDAVVDLKSIHQLIGAASRVSFGKPEKLMEYL
                     GVIPGSVTVFGAANDTNHRVQVILDAGLMKYDIINGHPLTNEATTSIRREDLIAFLKS
                     TGHEPRILAVSEGAKLAATV"
     misc_feature    339023..339493
                     /locus_tag="BAB2_0342"
                     /note="This CD includes bacterial (Agrobacterium
                     tumefaciens and Caulobacter crescentus ProX, and
                     Clostridium sticklandii PrdX) and eukaryotic (Plasmodium
                     falciparum N-terminal ProRS editing domain) sequences. The
                     C. sticklandii PrdX protein, a homolog of the...; Region:
                     PrdX_deacylase; cd04335"
                     /db_xref="CDD:239827"
     misc_feature    order(339146..339148,339308..339313,339404..339406)
                     /locus_tag="BAB2_0342"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239827"
     gene            339780..340754
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /db_xref="GeneID:3827798"
     CDS             339780..340754
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin domain-containing protein"
                     /protein_id="YP_418550.1"
                     /db_xref="GI:83269259"
                     /db_xref="GeneID:3827798"
                     /translation="MTSQDNPYGGAYGGPASQMTANVSFGQPSAPANGGDLIKDTTTA
                     GFQADVITESRKQPVLVDFWAPWCGPCKQLTPIIEKAVREARGAVKLVKMNIDEHPAI
                     AGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEAIATVK
                     ELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQN
                     EAPVRALEARLALADQVKLIGDPVELERRLAADPGDYQARFDLAQVRNAQGRRDDAAN
                     ELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTARRKLSSLLFS"
     misc_feature    339810..340748
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="Thioredoxin domain-containing protein
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG3118"
                     /db_xref="CDD:225660"
     misc_feature    339915..340199
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(339981..339983,339990..339992)
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     misc_feature    340257..>340475
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(340257..340262,340347..340352,340356..340361,
                     340368..340373,340458..340463,340470..340475)
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(340290..340292,340302..340304,340311..340313,
                     340356..340358,340392..340394,340404..340406,
                     340419..340421,340467..340469)
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    340494..340748
                     /gene="trx-2"
                     /locus_tag="BAB2_0343"
                     /note="Tetratricopeptide repeat; Region: TPR_20;
                     pfam14561"
                     /db_xref="CDD:258699"
     gene            340818..341522
                     /locus_tag="BAB2_0344"
                     /db_xref="GeneID:3827557"
     CDS             340818..341522
                     /locus_tag="BAB2_0344"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease La"
                     /protein_id="YP_418551.1"
                     /db_xref="GI:83269260"
                     /db_xref="GeneID:3827557"
                     /translation="MQVGNARYRTAADIPDVVPVFPLKGALLLPGGQLPLNIFEPRYL
                     SMVENALAGKRIIGMIQPKIDSETDDTDEPVDALDESLRPELSQVGCLGRITTFAETG
                     DGRLLITLQGICRFRVQEELHCRQPYRQCRIMPFLADLEQAQDAGDIDREALLRAFRD
                     YLEAHNLEADWESIARAGNETLVNAFSIMSPFGPAEKQALLEAPDLKTRAATLIAITE
                     MVLAKVKDDDFGSRLQ"
     misc_feature    340836..341519
                     /locus_tag="BAB2_0344"
                     /note="Uncharacterized protein, similar to the N-terminal
                     domain of Lon protease [General function prediction only];
                     Region: COG2802"
                     /db_xref="CDD:225362"
     gene            341699..341893
                     /locus_tag="BAB2_0345"
                     /db_xref="GeneID:3827558"
     CDS             341699..341893
                     /locus_tag="BAB2_0345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418552.1"
                     /db_xref="GI:83269261"
                     /db_xref="GeneID:3827558"
                     /translation="MDDKVETGNIDVRLLELLVCPLTKGPLEYDAERSELVSRKARLA
                     YPVRGGIPIMLPSEARSLTE"
     misc_feature    341726..341890
                     /locus_tag="BAB2_0345"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2835"
                     /db_xref="CDD:225391"
     gene            342193..343305
                     /locus_tag="BAB2_0346"
                     /db_xref="GeneID:3827559"
     CDS             342193..343305
                     /locus_tag="BAB2_0346"
                     /EC_number="1.1.1.85"
                     /note="catalyzes the oxidation of 3-isopropylmalate to
                     3-carboxy-4-methyl-2-oxopentanoate in leucine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="YP_418553.1"
                     /db_xref="GI:83269262"
                     /db_xref="GeneID:3827559"
                     /translation="MASRKLLLLPGDGIGPEAMAEVRKVIAFLNSDLNLGFETEEGLV
                     GGCAYDAHGQAISDADMEKALAADSVLFGAVGGPKWDSVPYEVRPEAGLLRLRKDMQL
                     YANLRPAICYPALAHSSSLKPEVIEGLDILILRELTGGVYFGEPKEIIDLGNGQKRGI
                     DTQVYDTYEIERIADVAFELARTRRNKVTSMEKRNVMKSGVLWNQGVTARHKEKHADV
                     QLEHMLADAGGMQLVRWPKQFDVILTDNLFGDLLSDVAAMLTGSLGMLPSASLGAADS
                     KTGKRKALYEPVHGSAPDIAGKGIANPIAMIASLAMCLRYSFGLVAEADRLEAAIAGV
                     LDDGIRTADIWSEGNTKVGTTEMGDAILAKFKALSA"
     misc_feature    342199..343296
                     /locus_tag="BAB2_0346"
                     /note="3-isopropylmalate dehydrogenase; Provisional;
                     Region: PRK00772"
                     /db_xref="CDD:234832"
     gene            343446..344498
                     /locus_tag="BAB2_0347"
                     /db_xref="GeneID:3827560"
     CDS             343446..344498
                     /locus_tag="BAB2_0347"
                     /EC_number="2.1.1.63"
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA-protein cysteine
                     S-methyltransferase"
                     /protein_id="YP_418554.1"
                     /db_xref="GI:83269263"
                     /db_xref="GeneID:3827560"
                     /translation="MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPAR
                     KPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEAEILVKKLLNALETDPERRWSEE
                     DVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHGFQVLAGGGCVIDAQVDAGFESP
                     EAFRSAFVRIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPA
                     ELKKLHAACRGDIGIGRFETHDLVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWREL
                     QNIRAGETRSYSEIARAIEKPLAVRAVARANGANQIAIVIPCHRVIGADGALTGYGGG
                     LWRKQKLIEIEAQYRR"
     misc_feature    343446..344006
                     /locus_tag="BAB2_0347"
                     /note="Adenosine deaminase [Nucleotide transport and
                     metabolism]; Region: Ada; COG2169"
                     /db_xref="CDD:225080"
     misc_feature    343470..343661
                     /locus_tag="BAB2_0347"
                     /note="Metal binding domain of Ada; Region:
                     Ada_Zn_binding; pfam02805"
                     /db_xref="CDD:251541"
     misc_feature    343716..343838
                     /locus_tag="BAB2_0347"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    343995..344486
                     /locus_tag="BAB2_0347"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    344247..344480
                     /locus_tag="BAB2_0347"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    order(344247..344252,344304..344309,344331..344333,
                     344340..344342,344346..344351,344355..344357,
                     344364..344369,344373..344375,344397..344399,
                     344412..344414,344433..344435)
                     /locus_tag="BAB2_0347"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    order(344304..344306,344397..344402,344406..344408,
                     344478..344480)
                     /locus_tag="BAB2_0347"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            complement(344556..346454)
                     /locus_tag="BAB2_0348"
                     /db_xref="GeneID:3827561"
     CDS             complement(344556..346454)
                     /locus_tag="BAB2_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="YP_418555.1"
                     /db_xref="GI:83269264"
                     /db_xref="GeneID:3827561"
                     /translation="MAVSSSAAAGAQKMTGEERKVIFASSLGTVFEWYDFYLYGTLAS
                     FIGAAFFNEYPEATRNIFVLLAFAAGFLVRPFGALVFGRIGDLVGRKYTFLVTIVIMG
                     GSTFLVGLLPGSASLGIFAPIILIALRMLQGLALGGEYGGAATYVAEHAPNNRRGFFT
                     SWIQTTATLGLFLSLLVILGAQTLLSKDAFAAWGWRIPFLVSVLLLGISVWIRMQMSE
                     SPAFKRMKEEGKTSKAPLSEAFGQWKNAKIALIALFGLTAGQAVVWYCGQFYALFFLQ
                     NVLKVENQSANIMVAIALLIGTGFFVIFGWLSDKIGRKPIIMAGLILAAVTYFPLFKA
                     LTNAANPALAQAEQTVKATVTAAPGDCNFQFNATGTSKFTTSCDVATSFLAKSSVPYE
                     TVQTAAPGTPATITIGDTTIQSYDAVQAGADAAAKQAALAHGVNLALQQAGFPLVRDT
                     AKVPDSKLDAFVAANPELQLNADAIRAGDAKTMVSAADLVKQKLLTQSEAESLGVSSE
                     QAVYSIPNAGAFKMVADPAQVNWVLTIAILTILVIYVTMVYGPIAAILVEMFPTRIRY
                     NGMSLPYHIGNGWFGGLLPAGVFALSAAKGDIYYGLWYPIIIASVTFVIGMLFVKETK
                     GVDLNKVD"
     misc_feature    complement(<345459..346391)
                     /locus_tag="BAB2_0348"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(345552..345554,345564..345566,
                     345573..345575,345585..345587,345597..345599,
                     345639..345641,345648..345653,345660..345665,
                     345672..345674,345942..345944,345960..345965,
                     345972..345977,346011..346013,346020..346025,
                     346032..346037,346044..346049,346209..346214,
                     346218..346223,346233..346235,346242..346247,
                     346254..346256,346323..346328,346332..346340,
                     346347..346349))
                     /locus_tag="BAB2_0348"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            346977..348011
                     /locus_tag="BAB2_0349"
                     /db_xref="GeneID:3827562"
     CDS             346977..348011
                     /locus_tag="BAB2_0349"
                     /EC_number="1.2.1.11"
                     /note="catalyzes the formation of 4-aspartyl phosphate
                     from aspartate 4-semialdehyde"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="YP_418556.1"
                     /db_xref="GI:83269265"
                     /db_xref="GeneID:3827562"
                     /translation="MGFKVAVAGATGNVGREMLNILEERGFPADEVVPLASRRSQGTE
                     VSYGDKTLKVRALDTYDFSDTDICLMSAGGSVSQEWSPKIGRQGCVVIDNSSAWRYDA
                     DVPLIVPEVNPDAIAGFTKKNIIANPNCSTAQLVVALKPLHDAAKIKRVVVSTYQSVS
                     GAGKEGMDELFEQSRAVFVADPISTKKFTKRIAFNVIPHIDVFMEDGYTKEEWKMVAE
                     TKKMLDPKIKLTATAVRVPVFIGHSEAVNIEFENPITPEEAREILREAPGCQVIDKHE
                     NGGYITPYESAGEDATFISRIREDITVENGLAMWVVSDNLRKGAALNAIQIAELLVAR
                     GLIKPKALAA"
     misc_feature    346980..347972
                     /locus_tag="BAB2_0349"
                     /note="aspartate-semialdehyde dehydrogenase; Provisional;
                     Region: PRK14874"
                     /db_xref="CDD:237845"
     misc_feature    346986..347330
                     /locus_tag="BAB2_0349"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    347391..347930
                     /locus_tag="BAB2_0349"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            complement(348075..348530)
                     /locus_tag="BAB2_0350"
                     /db_xref="GeneID:3827563"
     CDS             complement(348075..348530)
                     /locus_tag="BAB2_0350"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family regulatory protein"
                     /protein_id="YP_418557.1"
                     /db_xref="GI:83269266"
                     /db_xref="GeneID:3827563"
                     /translation="MMHKKPDTNLDLADMLCFAVYSTANALSRAYQPILAPLDLTYPQ
                     FLVMLVLWERDDCTVSEIGARLNLDSGTLTPLLKRLEAAGRITRRRDPRDERQVRITL
                     TDEGRKLREQAESVPEQIMCATGQPVSELQDLRNRLMKIRNHLTADGKK"
     misc_feature    complement(348096..348461)
                     /locus_tag="BAB2_0350"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(348216..>348371)
                     /locus_tag="BAB2_0350"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(348216..348218,348348..348350,
                     348357..348359))
                     /locus_tag="BAB2_0350"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(348237..348245,348261..348269,
                     348285..348290,348294..348299,348306..348311,
                     348315..348326,348351..348359))
                     /locus_tag="BAB2_0350"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            348736..349158
                     /gene="ohr"
                     /locus_tag="BAB2_0351"
                     /db_xref="GeneID:3828035"
     CDS             348736..349158
                     /gene="ohr"
                     /locus_tag="BAB2_0351"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418558.1"
                     /db_xref="GI:83269267"
                     /db_xref="GeneID:3828035"
                     /translation="MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGT
                     NPEQLFASGYAACFLGALKFAAAKEKISIPAESTVTATVGIGPREDGTGFGLDVALSI
                     ALPGIDKAKAEELVQAAHIVCPYSHATRGNLDVRLSVA"
     misc_feature    348745..349152
                     /gene="ohr"
                     /locus_tag="BAB2_0351"
                     /note="peroxiredoxin, Ohr subfamily; Region:
                     organ_hyd_perox; TIGR03561"
                     /db_xref="CDD:234259"
     gene            complement(349209..349631)
                     /locus_tag="BAB2_0352"
                     /db_xref="GeneID:3827564"
     CDS             complement(349209..349631)
                     /locus_tag="BAB2_0352"
                     /codon_start=1
                     /transl_table=11
                     /product="neutral zinc metallopeptidases, zinc-binding
                     region"
                     /protein_id="YP_418559.1"
                     /db_xref="GI:83269268"
                     /db_xref="GeneID:3827564"
                     /translation="MAREDQSGDWAGRFSPSLDEIESIAIDALAHLPQEFRALCGDII
                     IQIGDFPEDQIIEDMGLETPFDLLGLFEGRGIGERFSLQTGEGPNRITLYRRAILDYW
                     AEHDETLGDIISHVLIHEIGHHFGLSDDDMENIESQAE"
     misc_feature    complement(349233..349583)
                     /locus_tag="BAB2_0352"
                     /note="Minimal MMP-like domain found in Acidothermus
                     cellulolyticus hypothetical protein ACEL2062 and similar
                     protein; Region: MMP_ACEL2062; cd12952"
                     /db_xref="CDD:240572"
     gene            complement(349717..350322)
                     /gene="leuD"
                     /locus_tag="BAB2_0353"
                     /db_xref="GeneID:3827173"
     CDS             complement(349717..350322)
                     /gene="leuD"
                     /locus_tag="BAB2_0353"
                     /EC_number="4.2.1.33"
                     /note="catalyzes the isomerization between
                     2-isopropylmalate and 3-isopropylmalate in leucine
                     biosynthesis; forms a heterodimer of LeuC/D"
                     /codon_start=1
                     /transl_table=11
                     /product="isopropylmalate isomerase small subunit"
                     /protein_id="YP_418560.1"
                     /db_xref="GI:83269269"
                     /db_xref="GeneID:3827173"
                     /translation="MDKFTKLTGVAAPLPIVNIDTDMIIPKDYLKTIKRTGLGKGLFA
                     EMRFNEDGSENPDFVLNKPGYRKAQILVAGDNFGCGSSREHAPWALLDYGIRCVISTS
                     FADIFYNNCFKNGILPIKVAQEDLDKLMDDASRGANATLTIDLETKQIHGPDGGTISF
                     DLDDFKRHCLLNGLDDIGLTMEKAKSIDTFEAKNAEERPWA"
     misc_feature    complement(349888..350283)
                     /gene="leuD"
                     /locus_tag="BAB2_0353"
                     /note="Aconatase-like swivel domain of 3-isopropylmalate
                     dehydratase and related uncharacterized proteins.
                     3-isopropylmalate dehydratase catalyzes the isomerization
                     between 2-isopropylmalate and 3-isopropylmalate, via the
                     formation of 2-isopropylmaleate...; Region: IPMI_Swivel;
                     cd01577"
                     /db_xref="CDD:238809"
     misc_feature    complement(350074..350082)
                     /gene="leuD"
                     /locus_tag="BAB2_0353"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238809"
     gene            complement(350387..350593)
                     /locus_tag="BAB2_0354"
                     /db_xref="GeneID:3827565"
     CDS             complement(350387..350593)
                     /locus_tag="BAB2_0354"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418561.1"
                     /db_xref="GI:83269270"
                     /db_xref="GeneID:3827565"
                     /translation="MLTGSDDAPDNCAKTIFDASFRKVDGFSRQDYSSGLTGRLSERS
                     RKGLGALSGGLPVATYWASCGLKR"
     gene            350618..351622
                     /locus_tag="BAB2_0355"
                     /db_xref="GeneID:3827566"
     CDS             350618..351622
                     /locus_tag="BAB2_0355"
                     /EC_number="4.1.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP-binding motif-containing protein"
                     /protein_id="YP_418562.1"
                     /db_xref="GI:83269271"
                     /db_xref="GeneID:3827566"
                     /translation="MVLMALNKMSVVLPPVSFQTISGLGPQLFSVLALWGCSVHKSGM
                     KTIVRPRRSVLFVPAANTRALEKSLTLSADCVIYDLEDSVAPEAKAAACEALAAHLSA
                     HPKVAFERIVRVNAADTPWGRDDVAAVAKMAVNAVLLPKVERPQDVIEAANHLDRQDA
                     DPAMGVWAMIETPRGILNVDEIAVLGHRSAVRLACFVVGPNDIARETGLRSQPGRPYL
                     APWLMQIVLAARAGGIAVLDGVYNDFRDSAGFEAECAQGAAMGFDGKTLIHPGQIEAA
                     NRAFSPTEEEVAHARAVREIFARPENAGKGVVSLDGQMVERLHLEMAERILAKAGINL
                     "
     misc_feature    350774..351613
                     /locus_tag="BAB2_0355"
                     /note="Citrate lyase beta subunit [Carbohydrate transport
                     and metabolism]; Region: CitE; COG2301"
                     /db_xref="CDD:225184"
     gene            351640..351846
                     /locus_tag="BAB2_0356"
                     /db_xref="GeneID:3827567"
     CDS             351640..351846
                     /locus_tag="BAB2_0356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418563.1"
                     /db_xref="GI:83269272"
                     /db_xref="GeneID:3827567"
                     /translation="MKLYRFITGPDDSAFCHRVTAALNKGWQLYGSPTYAFNAATGVM
                     HCGQPVVKEVDGVDYTPDIKLGEY"
     misc_feature    351640..351843
                     /locus_tag="BAB2_0356"
                     /note="Uncharacterized conserved small protein [Function
                     unknown]; Region: COG5515"
                     /db_xref="CDD:227802"
     gene            351846..352199
                     /locus_tag="BAB2_0357"
                     /db_xref="GeneID:3827568"
     CDS             351846..352199
                     /locus_tag="BAB2_0357"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase family protein"
                     /protein_id="YP_418564.1"
                     /db_xref="GI:83269273"
                     /db_xref="GeneID:3827568"
                     /translation="MAVRRIVANISASDPAAARRFYGDLLGLDVAMDFGWIVTYAGDA
                     EARVQVSVMSEGGAGTPVPDLSIEVDDVDAVLERAIALGFSIEYGPADEEWGVRRFYT
                     RDSYGRLVNILTHKH"
     misc_feature    351858..352190
                     /locus_tag="BAB2_0357"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_5; cd07238"
                     /db_xref="CDD:176662"
     misc_feature    order(351858..351884,351888..351890,351897..351899,
                     351909..351911,351921..351923,351927..351929,
                     351948..351971,351990..352016,352029..352055,
                     352128..352130,352161..352163)
                     /locus_tag="BAB2_0357"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176662"
     gene            complement(352228..354276)
                     /gene="dcp"
                     /locus_tag="BAB2_0358"
                     /db_xref="GeneID:3828146"
     CDS             complement(352228..354276)
                     /gene="dcp"
                     /locus_tag="BAB2_0358"
                     /EC_number="3.4.15.5"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="YP_418565.1"
                     /db_xref="GI:83269274"
                     /db_xref="GeneID:3828146"
                     /translation="MSDKPPYNHALSEWNGPLGLPDFTAFKDEDFAPAFDVALAQDLA
                     EVEAIAGQAGEPTIDNTLKALQLTGKALERVSSIFWLRAGAHTNNTIQALEREIAPKM
                     SRHYSRIMMDPALFARIDALDENRDMLDLDSETRRVLEKTWKGFVRSGAKLDAAGKTE
                     LADINEKLAGLGARFGQNVLKDESGWALFITDEADLAGLPDFLKNAMQSAAAERGKPD
                     AWAVTLSRSIVEPFLSFSQNRSLREQAFNAWAKRGENGGETDNREIVREMVDLRERKA
                     HLLGYANFAAYKLDDTMAKTPKAVMDLLEPVWNKARAKAAEEEAELERLIAADGGNHK
                     VAPWDWRFYAEKLRAERFAFDEAELKPYLQLDKIIEAAFDVAGRLFGIRFEEKKGIAT
                     WHPDVRVFQVFNADGSERGLFLGDYFARTSKRSGAWMSSLQSSHKLGNGQKPIIYNVM
                     NFAKPKAGEPALLSLDDARTLFHEFGHALHGLLSDVTWPAVSGTAVSRDFVELPSQLY
                     EHWLTVPAVLEKYAVHYRTGEAMPKALLDKVLAARTFNAGFNTVEFTSSALVDMAFHT
                     GKEKIADPLAFEKQTLAKLSMPDAIIMRHRTPHFTHVFSGDGYSAGYYSYMWSEVLDA
                     DAFSAFEETGDAFNPELAAKLKQHIYAAGGSRDPEELYKAFRGKMPTPDAMIEKRGLN
                     "
     misc_feature    complement(352231..354267)
                     /gene="dcp"
                     /locus_tag="BAB2_0358"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    complement(352234..354192)
                     /gene="dcp"
                     /locus_tag="BAB2_0358"
                     /note="Peptidase family M3 dipeptidyl carboxypeptidase
                     (DCP); Region: M3A_DCP; cd06456"
                     /db_xref="CDD:188995"
     misc_feature    complement(order(352429..352431,352438..352440,
                     352450..352455,352459..352461,352471..352476,
                     352492..352497,352615..352617,352762..352764,
                     352771..352773,352846..352848,352855..352860,
                     352990..352998))
                     /gene="dcp"
                     /locus_tag="BAB2_0358"
                     /note="active site"
                     /db_xref="CDD:188995"
     misc_feature    complement(order(352771..352773,352846..352848,
                     352858..352860))
                     /gene="dcp"
                     /locus_tag="BAB2_0358"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188995"
     gene            354371..354535
                     /locus_tag="BAB2_0359"
                     /db_xref="GeneID:3827569"
     CDS             354371..354535
                     /locus_tag="BAB2_0359"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418566.1"
                     /db_xref="GI:83269275"
                     /db_xref="GeneID:3827569"
                     /translation="MKKRLHFPAGLDFGGDRAHITPAANFRGGNFNRSFILLCPATVT
                     VDCFSRQGSS"
     gene            354602..355999
                     /gene="mgtE"
                     /locus_tag="BAB2_0360"
                     /db_xref="GeneID:3827182"
     CDS             354602..355999
                     /gene="mgtE"
                     /locus_tag="BAB2_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="divalent cation transporter"
                     /protein_id="YP_418567.1"
                     /db_xref="GI:83269276"
                     /db_xref="GeneID:3827182"
                     /translation="MTGLKPDNNFFAEVLNVADLPAAAIASRITDMRTGDAVEIVNEL
                     DADDAVAVIAQLSHDDAIRLLDQPELHRAAEIVAALQPGLASLLLDGMSADRATDVFQ
                     ELEDVDRARLFPILAPETKAALKKLMGYPPNTAGSLMTIEFIAVPSNWTVGQTLDHIR
                     KVERTRETVYAIYVVDPLSRVLLGVVSLRRLIIRQPDEPILSIARDDEPITISPLASR
                     EEVARLFRKHDLLAVPVVDEGRHIIGIVTVDDVLDAMTEEASEDAYRFGGMEALDKPY
                     MRIGFGEMLKKRAGWLGILFLGEMLTASAMQHFEAELEKALVLTLFIPLIMSSGGNSG
                     SQATSLIIRALALQEIKLKDWWRVALREIPSGLALGGFLGFIGIIRITTWQTLGIYDY
                     GEHWILVAFTVGMALVSIVTFGSLTGSMLPFVLQRLGFDPASASAPFVATLVDVTGLV
                     IYFSVALVILSGTLL"
     misc_feature    354617..355993
                     /gene="mgtE"
                     /locus_tag="BAB2_0360"
                     /note="Mg/Co/Ni transporter MgtE (contains CBS domain)
                     [Inorganic ion transport and metabolism]; Region: MgtE;
                     COG2239"
                     /db_xref="CDD:225148"
     misc_feature    354695..355000
                     /gene="mgtE"
                     /locus_tag="BAB2_0360"
                     /note="MgtE intracellular N domain; Region: MgtE_N;
                     pfam03448"
                     /db_xref="CDD:146204"
     misc_feature    355034..355366
                     /gene="mgtE"
                     /locus_tag="BAB2_0360"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domain in the
                     magnesium transporter, MgtE.  MgtE and its homologs are
                     found in eubacteria, archaebacteria, and eukaryota.
                     Members of this family transport Mg2+ or other...; Region:
                     CBS_pair_Mg_transporter; cd04606"
                     /db_xref="CDD:239979"
     misc_feature    355565..355969
                     /gene="mgtE"
                     /locus_tag="BAB2_0360"
                     /note="Divalent cation transporter; Region: MgtE;
                     pfam01769"
                     /db_xref="CDD:110745"
     gene            356242..358068
                     /locus_tag="BAB2_0361"
                     /db_xref="GeneID:3827570"
     CDS             356242..358068
                     /locus_tag="BAB2_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="YP_418568.1"
                     /db_xref="GI:83269277"
                     /db_xref="GeneID:3827570"
                     /translation="MELRNIAIIAHVDHGKTTLVDELLKQSGSFRENQRVAERMMDSN
                     DIEKERGITILAKATSVVWKNTRINIVDTPGHADFGGEVERILSMVDGAIVLVDAAEG
                     PMPQTKFVVGKALKVGLKPIVAINKIDRPDGRHEEVVNEVFDLFANLDATDEQLDFPI
                     LYGSGRNGWMALSPEGPKDQGLAPLFDLVLKHVPAPKVAEGPFRMIGTILEADPFLGR
                     IITGRIHSGSIKPNQAVKVLGQDGSVLENGRISKILAFRGIERQAIDEAHAGDIVAIA
                     GLSKGTVADTFCDPSVSEPLAAQPIDPPTVTMSFIVNDSPYAGTEGDKVTSRVIRDRL
                     LKEAEGNVALKIEESTEKDSFFVSGRGELQLAVLIENMRREGFELGVSRPRVVMKDGE
                     NGEKLEPVEEVVIDVDEEYSGTVVQKMSERKAEMVELRPSGGNRVRLVFYAPTRGLIG
                     YQSELLTDTRGTAIMNRLFHDYQPYKGEIAGRNNGVLISNDQGEAVAYALFNLEDRGP
                     MIIEAGVKVYQGMLIGIHSRDNDLEVNVLKGKKLTNIRAAGKDEAVKLTPPIKMTLER
                     ALSWIQDDELVEVTPKSIRLRKLYLDPNERKRFEKSKSSSAA"
     misc_feature    356242..358050
                     /locus_tag="BAB2_0361"
                     /note="Predicted membrane GTPase involved in stress
                     response [Signal transduction mechanisms]; Region: TypA;
                     COG1217"
                     /db_xref="CDD:224138"
     misc_feature    356245..356829
                     /locus_tag="BAB2_0361"
                     /note="Tyrosine phosphorylated protein A (TypA)/BipA
                     family belongs to ribosome-binding GTPases; Region:
                     TypA_BipA; cd01891"
                     /db_xref="CDD:206678"
     misc_feature    356269..356292
                     /locus_tag="BAB2_0361"
                     /note="G1 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(356272..356274,356278..356280,356290..356295,
                     356302..356304,356311..356316,356410..356415,
                     356467..356472,356539..356544,356650..356652,
                     356662..356664)
                     /locus_tag="BAB2_0361"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(356278..356295,356617..356622,356626..356628,
                     356731..356739)
                     /locus_tag="BAB2_0361"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206678"
     misc_feature    356377..356412
                     /locus_tag="BAB2_0361"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206678"
     misc_feature    356398..356400
                     /locus_tag="BAB2_0361"
                     /note="G2 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    356455..356466
                     /locus_tag="BAB2_0361"
                     /note="G3 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    356461..356517
                     /locus_tag="BAB2_0361"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206678"
     misc_feature    356617..356628
                     /locus_tag="BAB2_0361"
                     /note="G4 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    356731..356739
                     /locus_tag="BAB2_0361"
                     /note="G5 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    356848..357108
                     /locus_tag="BAB2_0361"
                     /note="BipA_TypA_II: domain II of BipA (also called TypA)
                     having homology to domain II of the elongation factors
                     (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein
                     with global regulatory properties in Escherichia coli.
                     BipA is phosphorylated on a...; Region: BipA_TypA_II;
                     cd03691"
                     /db_xref="CDD:239662"
     misc_feature    357433..357669
                     /locus_tag="BAB2_0361"
                     /note="BipA_TypA_C: a C-terminal portion of BipA or TypA
                     having homology to the C terminal domains of the
                     elongation factors EF-G and EF-2. A member of the ribosome
                     binding GTPase superfamily, BipA is widely distributed in
                     bacteria and plants.  BipA is a highly...; Region:
                     BipA_TypA_C; cd03710"
                     /db_xref="CDD:239681"
     gene            358118..358807
                     /locus_tag="BAB2_0362"
                     /db_xref="GeneID:3827571"
     CDS             358118..358807
                     /locus_tag="BAB2_0362"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418569.1"
                     /db_xref="GI:83269278"
                     /db_xref="GeneID:3827571"
                     /translation="MNIHCVLIAHGAFITTACQCPVCAMPGSAAYRIVMFTISRVETF
                     SQEIKKSRFLAIAAPVASEEAAKDFLHEYSDLSATHNCWAWRMGQNYRFSDDGEPSGT
                     AGKQILQAIDGQQLDNIVVVVTRWFGGILLGSGGLMRAYGGTAASCLRQAEKTEVIAL
                     VGFALACDFSDHALLKARLTAVKNVAILQENFTATGVEMTGAMPIAAKDDLSRLVSDL
                     TRGKTIITFDE"
     misc_feature    358220..358804
                     /locus_tag="BAB2_0362"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1739"
                     /db_xref="CDD:224653"
     misc_feature    358259..358567
                     /locus_tag="BAB2_0362"
                     /note="Uncharacterized protein family UPF0029; Region:
                     UPF0029; pfam01205"
                     /db_xref="CDD:250442"
     misc_feature    358610..358780
                     /locus_tag="BAB2_0362"
                     /note="Domain of unknown function (DUF1949); Region:
                     DUF1949; pfam09186"
                     /db_xref="CDD:255222"
     gene            359005..359244
                     /locus_tag="BAB2_0363"
                     /db_xref="GeneID:3827572"
     CDS             359005..359244
                     /locus_tag="BAB2_0363"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418570.1"
                     /db_xref="GI:83269279"
                     /db_xref="GeneID:3827572"
                     /translation="MLWPYCYASERVVPDFVPELLAPKLVAKKPRFMAFRLARRLPLM
                     NFAPPVFDKLQRVQCIRVLSLDTAHLAGDFQEQGQ"
     gene            359241..360263
                     /locus_tag="BAB2_0364"
                     /db_xref="GeneID:3827573"
     CDS             359241..360263
                     /locus_tag="BAB2_0364"
                     /EC_number="3.1.3.11"
                     /note="catalyzes the formation of D-fructose 6-phosphate
                     from fructose-1,6-bisphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="YP_418571.1"
                     /db_xref="GI:83269280"
                     /db_xref="GeneID:3827573"
                     /translation="MTLVGNFSPLVLVGDSDRVEAETVGAYLDGWAGHDKVRLATANA
                     IKAILSGAGRLVGRIARGYLPGDPGKLVGVNSDQDQQKSIDVGSHNLFVELLIAAGVA
                     SILSEEADLPVAGKADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADVEEPFLQPGN
                     RQIAAGYVSYGNSVDLGFSVGEGVIFATLDPVSGQFHITRRNVKLPERTSDLAFNASV
                     QRHLSAGMQAYVNDAFLGKDGPRGRNFNMRWLGAAVGDMHRIMQRGGLFFYVNDSRPG
                     YEKGRLRLVYEANPIAFLAREAGGKATDGSRPILDIVPQTYHERSALVFGVAEEVDIL
                     GEYFVK"
     misc_feature    359334..360254
                     /locus_tag="BAB2_0364"
                     /note="Fructose-1,6-bisphosphatase, an enzyme that
                     catalyzes the hydrolysis of fructose-1,6-biphosphate  into
                     fructose-6-phosphate and is critical in gluconeogenesis
                     pathway. The alignment model also includes chloroplastic
                     FBPases and sedoheptulose-1; Region: FBPase; cd00354"
                     /db_xref="CDD:238214"
     misc_feature    order(359352..359354,359358..359366,359598..359603,
                     359682..359684)
                     /locus_tag="BAB2_0364"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:238214"
     misc_feature    order(359493..359495,359559..359564,359616..359618,
                     359622..359624,360099..360101)
                     /locus_tag="BAB2_0364"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238214"
     misc_feature    order(359625..359627,359631..359636,359892..359894,
                     359982..359987,359997..359999,360045..360047,
                     360081..360083)
                     /locus_tag="BAB2_0364"
                     /note="active site"
                     /db_xref="CDD:238214"
     gene            360294..361358
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /db_xref="GeneID:3828210"
     CDS             360294..361358
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /EC_number="4.1.2.13"
                     /note="class II aldolase; catalyzes the reversible aldol
                     condensation of dihydroxyacetonephosphate and
                     glyceraldehyde 3-phosphate in the Calvin cycle, glycolysis
                     and gluconeogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphate aldolase"
                     /protein_id="YP_418572.1"
                     /db_xref="GI:83269281"
                     /db_xref="GeneID:3828210"
                     /translation="MARITLRQLLDHAAEKGYGVPAFNINNMEQALAIMEAANAVDAP
                     VILQASRGARSYANDIMLRHMMDAVAEIYPHIPVCVHLDHGNEAATCMSAIQAGFTSV
                     MMDGSLKADGKTPADWDYNVSVTRQVSEMSHLGGISVEGELGVLGSLETGMGDVEDGH
                     GAEGKLSHDQLLTDPDEAVKFVRETKVDALAIAMGTSHGAYKFSRKPDGSVLAMHVIE
                     EIHRKLPNTHLVMHGSSSVPEELQEIINKYGGQMKPTWGVPVEEIQRGIKHGVRKINI
                     DTDNRMAMTGQIRRILQEEPSEFDPRKYLKPAMAAMTKLCKERFEQFGTAGHAASIRP
                     IPLSEMAKRYRDGSLDPKFS"
     misc_feature    360309..361274
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /note="Tagatose-1,6-bisphosphate (TBP) aldolase and
                     related Type B Class II aldolases. TBP aldolase is a
                     tetrameric class II aldolase that catalyzes the reversible
                     condensation of dihydroxyacetone phosphate with
                     glyceraldehyde 3-phsophate to produce tagatose 1; Region:
                     TBP_aldolase_IIB; cd00947"
                     /db_xref="CDD:238477"
     misc_feature    order(360372..360380,360387..360389,360447..360449,
                     360456..360464,360474..360476,360486..360488,
                     360495..360500,360762..360764,361125..361130,
                     361134..361139,361146..361148,361158..361160,
                     361167..361169)
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238477"
     misc_feature    order(360540..360545,360882..360890,360894..360896,
                     360987..360992,360996..360998,361116..361118,
                     361122..361127)
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /note="active site"
                     /db_xref="CDD:238477"
     misc_feature    order(360543..360545,360885..360887,360987..360989)
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     misc_feature    order(360882..360884,360888..360890,360894..360896,
                     360990..360992,360996..360998)
                     /gene="fbaA"
                     /locus_tag="BAB2_0365"
                     /note="Na+ binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     gene            complement(361425..361880)
                     /locus_tag="BAB2_0366"
                     /db_xref="GeneID:3827515"
     CDS             complement(361425..361880)
                     /locus_tag="BAB2_0366"
                     /EC_number="5.3.1.6"
                     /note="catalyzes the interconversion of ribose 5-phosphate
                     to ribulose 5-phosphate; enzyme from E. coli shows allose
                     6-phosphate isomerase activity"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase B"
                     /protein_id="YP_418573.1"
                     /db_xref="GI:83269282"
                     /db_xref="GeneID:3827515"
                     /translation="MKVAVAGDSAGEGLAKVLADHLKDRFEVSEISRTDAGADAFYAN
                     LSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQ
                     IITMGARVIGAEVAKTIADAFLAQTFDENGRSAGNVNAINEVDAKYNKF"
     misc_feature    complement(361440..361880)
                     /locus_tag="BAB2_0366"
                     /note="ribose-5-phosphate isomerase B; Provisional;
                     Region: PRK05571"
                     /db_xref="CDD:235509"
     gene            complement(361892..362662)
                     /gene="tpiA"
                     /locus_tag="BAB2_0367"
                     /db_xref="GeneID:3827783"
     CDS             complement(361892..362662)
                     /gene="tpiA"
                     /locus_tag="BAB2_0367"
                     /EC_number="5.3.1.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_418574.1"
                     /db_xref="GI:83269283"
                     /db_xref="GeneID:3827783"
                     /translation="MTKFWIGTSWKMNKTLAEARLFAEALKAADAGRSPDIQRFVIPP
                     FTAVREVKEILSGTSVKVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREH
                     FGETNETVGLKVEAAVRHGLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQK
                     QAEILFAYEPVWAIGENGIPASADYADARQAEIIAVAQSVLARRVPCLYGGSVNPGNC
                     EELIACPHIDGLFIGRSAWNVEGYLDILARCATKVQAN"
     misc_feature    complement(361925..362653)
                     /gene="tpiA"
                     /locus_tag="BAB2_0367"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(361961..361966,361970..361972,
                     362027..362029,362138..362140,362156..362158,
                     362375..362377,362630..362632,362636..362638))
                     /gene="tpiA"
                     /locus_tag="BAB2_0367"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(362366..362371,362402..362407,
                     362414..362416,362468..362470,362507..362509,
                     362516..362518,362522..362530,362627..362629,
                     362636..362638))
                     /gene="tpiA"
                     /locus_tag="BAB2_0367"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(362156..362158,362375..362377,
                     362630..362632))
                     /gene="tpiA"
                     /locus_tag="BAB2_0367"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            complement(362675..363439)
                     /locus_tag="BAB2_0368"
                     /db_xref="GeneID:3827516"
     CDS             complement(362675..363439)
                     /locus_tag="BAB2_0368"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family regulatory protein"
                     /protein_id="YP_418575.1"
                     /db_xref="GI:83269284"
                     /db_xref="GeneID:3827516"
                     /translation="MKRDDRRQAIINLLIENQAVDLDDLAGRFAVSKMTIHRDLDSLE
                     QSGVLRKVRGGATIDAGTQFESDFRFRERQDGEAKLKMARAALELVEPGMTVMVNDGS
                     MAALLGGMLREKRPLTVITNNAVIIDELKGENGINLIALGGTYSAKFNAFFGILTEEA
                     LARLSADIAFVSSPAVNGQLVYHMDENVVRTKRAMTNAAARSCLLVNHQRFGRPALHV
                     MADLTDFDAIITDASPGTAVLNGLKQAGIKLTIAAD"
     misc_feature    complement(362684..363439)
                     /locus_tag="BAB2_0368"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    complement(363272..363424)
                     /locus_tag="BAB2_0368"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    complement(362741..363211)
                     /locus_tag="BAB2_0368"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(363527..364477)
                     /gene="eryD"
                     /locus_tag="BAB2_0369"
                     /db_xref="GeneID:3828209"
     CDS             complement(363527..364477)
                     /gene="eryD"
                     /locus_tag="BAB2_0369"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-binding domain-containing protein"
                     /protein_id="YP_418576.1"
                     /db_xref="GI:83269285"
                     /db_xref="GeneID:3828209"
                     /translation="MADADDSLALRAAWLHFVAGMTQSAVAKRLGLPSVKAHRLIAKA
                     VADGAVKVTIDGDITECIDLENRLADLYGLDYCEVAPDIGEEGLPLMALGHAGANFMR
                     REIEHGDHEVIGIGHGRTLSAAVGYMPRVMANDLRFVSLLGGLTRNFAANPHDVMHRI
                     AEKTGMPAYVMPVPFFANTAEDREVLLAQRGVTTVFDMGCRAELKIVGIGTVDAQAQL
                     VTSGMIELGEVEEIANLGGVGEMLGHFFNANGQWLETALTGRTIAASVENADMSRIVA
                     LAGGLSKVDAIRAVLKSGRLYGLITDERTAKALIGQPNGK"
     misc_feature    complement(363542..364477)
                     /gene="eryD"
                     /locus_tag="BAB2_0369"
                     /note="Transcriptional regulator, contains sigma
                     factor-related N-terminal domain [Transcription]; Region:
                     DeoR; COG2390"
                     /db_xref="CDD:225263"
     misc_feature    complement(364313..>364408)
                     /gene="eryD"
                     /locus_tag="BAB2_0369"
                     /note="PCI domain; Region: PCI; cl02111"
                     /db_xref="CDD:261183"
     misc_feature    complement(363545..364309)
                     /gene="eryD"
                     /locus_tag="BAB2_0369"
                     /note="Putative sugar-binding domain; Region: Sugar-bind;
                     pfam04198"
                     /db_xref="CDD:252446"
     gene            complement(364505..365437)
                     /locus_tag="BAB2_0370"
                     /db_xref="GeneID:3827517"
     CDS             complement(364505..365437)
                     /locus_tag="BAB2_0370"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D-erythrulose 4-phosphate dehydrogenase"
                     /protein_id="YP_418577.1"
                     /db_xref="GI:83269286"
                     /db_xref="GeneID:3827517"
                     /translation="MALTLSLNTNPLVNRFAEPDDLIETVARDLRLRDLQLTHEFINP
                     SWQASTIRRLTRDMDRALQRTGVRVTSGMTGPYGRLNHFGHPDRDVRRYYVDWFKTFA
                     DIIGDLGGKSVGTQFAIFTYKDFDDPARREELIKIAIDCWAEVAEHAAGAGLDYVFWE
                     PMSIGREFGETIAECMKLQDRLTAANMAIPMWMMADIDHGDVTSANPDDYDPYAWART
                     VPKVSPIIHIKQSLMDKGGHRPFTAAFNAKGRIQPEPLLKAFAEGGAVDNEICLELSF
                     KEREPNDREVIPQIAESVAFWAPHIDTGAKDLKI"
     misc_feature    complement(364709..365359)
                     /locus_tag="BAB2_0370"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     gene            complement(365445..366953)
                     /locus_tag="BAB2_0371"
                     /db_xref="GeneID:3827518"
     CDS             complement(365445..366953)
                     /locus_tag="BAB2_0371"
                     /EC_number="1.1.5.3"
                     /note="in Escherichia coli this homodimeric enzyme is
                     expressed under aerobic conditions; anaerobic expression
                     is repressed by the arcAB system; converts
                     sn-glycerol-3-phosphate and ubiquinone-8 to dihydroxy
                     acetone phosphate and ubiquinol-8; associates with the
                     cytoplasmic membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="YP_418578.1"
                     /db_xref="GI:83269287"
                     /db_xref="GeneID:3827518"
                     /translation="MAEPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAQGT
                     SSRSGKLVHGGLRYLEYYEFRLVREALIEREVLLNAAPHIIWPMRFVLPHSPQDRPAW
                     LVRLGLFLYDHLGGRKKLPGTRTLDLKRDPEGTPILDQYTKGFEYSDCWVDDARLVAL
                     NAVGAAEKGATILTRTPVVSARRENGGWIVETRNSDTGETRTFRARCIVNCAGPWVTD
                     VIHNVAASTSSRNVRLVKGSHIIVPKFWSGANAYLVQNHDKRVIFINPYEGDKALIGT
                     TDIAYEGRAEDVAADEKEIDYLITAVNRYFKEKLRREDVLHSFSGVRPLFDDGKGNPS
                     AVTRDYVFDLDETGGAPLLNVFGGKITTFRELAERGMHRLKHIFPQMGGDWTHDAPLP
                     GGEIANADYETFANTLRDTYPWMPRTLVHHYGRLYGARTKDVVAGAQNLEGLGRHFGG
                     DFHEAEVRYLVAREWAKTAEDILYRRTKHYLHLTEAERAAFVEWFDNANLVA"
     misc_feature    complement(365448..366953)
                     /locus_tag="BAB2_0371"
                     /note="glycerol-3-phosphate dehydrogenase; Provisional;
                     Region: PRK13369"
                     /db_xref="CDD:237365"
     misc_feature    complement(365463..366953)
                     /locus_tag="BAB2_0371"
                     /note="Glycerol-3-phosphate dehydrogenase [Energy
                     production and conversion]; Region: GlpA; COG0578"
                     /db_xref="CDD:223651"
     gene            complement(366966..368519)
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /db_xref="GeneID:3828150"
     CDS             complement(366966..368519)
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="YP_418579.1"
                     /db_xref="GI:83269288"
                     /db_xref="GeneID:3828150"
                     /translation="MREKGDIIIGIDAGTSVLKAVAFDFSGRQIESAAVRNTYVTGDH
                     GAVTQSLAQTWQDCARALRDLGAKLPGLAQRTAAIAVTGQGDGTWLVGKDNRPVGDAW
                     IWLDARAASTVTRLAAGPMNRARFEATGTGLNTCQQGAQMAHMDTIAPELLDNAEAAL
                     HCKDWLYLNLTGVRATDPSEASFTFGNFRTRQYDDVVIEALGLQKRRNLLPEIIDGSQ
                     SQHPLSAEAAAATGLLAGTPVSLGYVDMAMTALGAGVCGGTAGAGCSTIGSTGVHMRA
                     KPVADIHLNKEGTGYVIALPIPGIVTQVQTNMGATINIDWILQVAADLMSTPEKPVSL
                     GDLIPRLDDWFNASRPGAILYHPYISEAGERGPFVNANARAGFIGLSSRDRFPELVRS
                     VVEGLGMATRDCYAAMGEMPAELRITGGAARSKALRGTLSAAVNAPVRVSAREEAGAA
                     GAAMMAAVAIGAYPAMDDCIAEWVEPLLGASEAPDAARAHQYEELFVAYREARLALAP
                     VWDKLASGK"
     misc_feature    complement(366978..368513)
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="Sugar (pentulose and hexulose) kinases
                     [Carbohydrate transport and metabolism]; Region: XylB;
                     COG1070"
                     /db_xref="CDD:223996"
     misc_feature    complement(367182..368501)
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="L-xylulose kinases; a subfamily of the FGGY family
                     of carbohydrate kinases; Region: FGGY_L-XK; cd07802"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(367575..367577,367599..367601,
                     367605..367607,367614..367616,367632..367649,
                     367659..367667,367704..367706,367713..367715,
                     367776..367787,367797..367808,367863..367868,
                     367872..367877,367947..367949,367956..367958,
                     367962..367964,367974..367976,367983..367991,
                     368109..368114,368190..368192,368208..368210,
                     368268..368291,368424..368426,368433..368441,
                     368448..368453,368457..368459,368463..368465,
                     368472..368480,368484..368501))
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="putative N- and C-terminal domain interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(367248..367250,367254..367262,
                     367509..367511,367575..367577,367587..367589,
                     367704..367706,367713..367721,367782..367787,
                     368208..368210,368262..368264,368268..368270,
                     368463..368465,368469..368480,368484..368486))
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="putative active site [active]"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(367248..367250,367254..367262,
                     367500..367502,367506..367511,367575..367580,
                     367584..367589,367713..367721,367785..367787,
                     368463..368465,368469..368480,368484..368486))
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(367785..367787,368475..368477,
                     368484..368486))
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(367785..367787,368484..368486))
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(367605..367607,367782..367787,
                     368208..368210,368262..368264,368268..368270))
                     /gene="eryA"
                     /locus_tag="BAB2_0372"
                     /note="putative xylulose binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212666"
     gene            complement(368512..368664)
                     /locus_tag="BAB2_0373"
                     /db_xref="GeneID:3827519"
     CDS             complement(368512..368664)
                     /locus_tag="BAB2_0373"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418580.1"
                     /db_xref="GI:83269289"
                     /db_xref="GeneID:3827519"
                     /translation="MLKILQTVRQRYVISNMRHRPISPWKGLRATCFQSREEIRMFMK
                     ACVSHA"
     gene            369262..369918
                     /locus_tag="BAB2_0374"
                     /db_xref="GeneID:3827520"
     CDS             369262..369918
                     /locus_tag="BAB2_0374"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418581.1"
                     /db_xref="GI:83269290"
                     /db_xref="GeneID:3827520"
                     /translation="MSAQTSQVSAKPTTRPSRAALWSVIAAVVVIGAIGFDTKVVKIG
                     SDADVRQQVFSPAAYGASEFPKVKASIEQRAVDAVEVGNALAADKAAAGKKYGVGSVN
                     PVIPVKFTGTVEERKANYNVVKVDGMPEGMVIRVQTGPAVNGTELRDATGEIQFGQFK
                     NQIEYQNAGAALNNEMKKQVLQGVDVENLNGKTVSVVGVFKVVNPKNWLVTPVELEVK
                     "
     misc_feature    369319..369912
                     /locus_tag="BAB2_0374"
                     /note="Predicted periplasmic lipoprotein (DUF2291);
                     Region: DUF2291; pfam10054"
                     /db_xref="CDD:255723"
     gene            369915..371459
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /db_xref="GeneID:3827825"
     CDS             369915..371459
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribulokinase ABC transporter ATPase"
                     /protein_id="YP_418582.1"
                     /db_xref="GI:83269291"
                     /db_xref="GeneID:3827825"
                     /translation="MSLAAKIEGKNGDVVLAAQNVAKSYGRIHALKGVNFEIRRGQVT
                     TLFGENGAGKSTLMKVLSGVIQPTLGTIILDGKPVTFNSSTEARDHGISIIHQELSLA
                     PNMNVRDNIFMGREIRTATGVDFAEEERLTRELMKELEEDIDPLTPVEELRLGQQQVV
                     EIARALSVNSRILIMDEPTSALSASEVEVLFKVIRDLTARGVAIVYISHHLEEALQIT
                     NHAVVLRDGTMTACAPREEIDLEWIVRNMVGENFDLGSPPTGYEWGDVALSVEDLTVP
                     DPSGSGFSLVDRMSLNVRAGEIVCIYGLMGAGRTELLESVAGRLKSSGGRILLKGQDI
                     SGLTIAERIEKGLVLVPEDRQRDGLVQTMTVGKNLSLASIAEMTRGIFTSRKREKQIV
                     DQSIRNVHIKTDGGEAAIGSLSGGNQQKVVIGKMLATEPDVILLDEPSRGIDIGAKAE
                     VFKLLAEKAKQGLAVVYTTSEVGECLSIAHRIIVMHRGRISAEFGSDVSKEKIMAASG
                     EAMVGH"
     misc_feature    369948..371435
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    369960..370607
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    370056..370079
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(370065..370070,370074..370082,370203..370205,
                     370440..370445,370539..370541)
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    370194..370205
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    370368..370397
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    370428..370445
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    370452..370463
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    370527..370547
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    370704..371384
                     /gene="rbsA-3"
                     /locus_tag="BAB2_0375"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            371483..372523
                     /locus_tag="BAB2_0376"
                     /db_xref="GeneID:3827521"
     CDS             371483..372523
                     /locus_tag="BAB2_0376"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_418583.1"
                     /db_xref="GI:83269292"
                     /db_xref="GeneID:3827521"
                     /translation="MSVTSTNKETAAPTGAKRKTSLVHLLLEGRAFFALIAIIAVFSF
                     LSPYYFTVDNFLIMSSHVAIFGLLAIGMLLVILNGGIDLSVGSTLGLAGVVAGFLMQG
                     VTLQEFGIILYFPVWAVVLITCALGAFVGAVNGVLIAYLRVPAFVATLGVLYCARGVA
                     LLMTNGLTYNNLGGRPELGNTGFDWLGFNKLFGVPIGVLVLAILAIICAIVLNRTAFG
                     RWLYASGGNERAAELSGVPVKRVKVSVYVISGICAAIAGLVLSSQLTSAGPTAGTTYE
                     LTAIAAVVIGGAALTGGRGTIQGTLLGAFVIGFLSDGLVIIGVSSYWQTVFTGAVIVL
                     AVLLNSIQYSRR"
     misc_feature    371666..372499
                     /locus_tag="BAB2_0376"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    372167..372223
                     /locus_tag="BAB2_0376"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            372690..373637
                     /gene="rbsB-2"
                     /locus_tag="BAB2_0377"
                     /db_xref="GeneID:3827827"
     CDS             372690..373637
                     /gene="rbsB-2"
                     /locus_tag="BAB2_0377"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="YP_418584.1"
                     /db_xref="GI:83269293"
                     /db_xref="GeneID:3827827"
                     /translation="MFKKGMRVLFAAAAALPLIASTAWAEGLMTIIVNDPSNPYWFTE
                     GEVAKKTAEGLGYKAVVGGHKGDTNTESNLIDTAITNKSVAIILDPANADGSVGAVKR
                     AIAANIPVFLINAEINQEGLAKAQLVSNNAQGAALGATQWVESVGDKGKYVELFGAPS
                     DNNAATRSNGYETVLSQYPDLVRVGKDVANWDRTQGHDKMQALLQANPDIIGVISGND
                     EMALGAIAALKKAGKLDQVKVGGFDGSPDAIAAIKAGELQYTVLQPVAVFSEAAVKQA
                     DNFIKTGKTGVDHEKQLFDCILITKDNVDKYTSPFVLEQ"
     misc_feature    372771..373589
                     /gene="rbsB-2"
                     /locus_tag="BAB2_0377"
                     /note="Periplasmic sugar-binding domain of the
                     thermophilic Thermoanaerobacter tengcongensis ribose
                     binding protein (ttRBP) and its mesophilic homologs;
                     Region: PBP1_ribose_binding; cd06323"
                     /db_xref="CDD:107318"
     misc_feature    372780..373532
                     /gene="rbsB-2"
                     /locus_tag="BAB2_0377"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    order(372801..372803,372807..372812,372954..372956,
                     373029..373034,373176..373178,373188..373190,
                     373260..373262,373338..373340,373416..373418,
                     373476..373478)
                     /gene="rbsB-2"
                     /locus_tag="BAB2_0377"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107318"
     misc_feature    order(373182..373184,373194..373196,373233..373238,
                     373245..373250,373302..373304)
                     /gene="rbsB-2"
                     /locus_tag="BAB2_0377"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107318"
     gene            373845..374666
                     /locus_tag="BAB2_0378"
                     /db_xref="GeneID:3827522"
     CDS             373845..374666
                     /locus_tag="BAB2_0378"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family regulatory protein"
                     /protein_id="YP_418585.1"
                     /db_xref="GI:83269294"
                     /db_xref="GeneID:3827522"
                     /translation="MPNDSRHARQLVRRQQIAETVMAEGSMRIEDLTERFGISLMTAH
                     RDVDELVSRGLFRKSRGIVSAAPTSLIEASDLYRVTRQSEEKKLIAEAAMQFVEPGQA
                     IFFDDSTTVLQMVPHLPGKGPLTVITNSLILMNEVRDMKDVTLLGLGGQLYNWCNAFV
                     GGMTIHEIRRLRADVAFISIAAITDDLLFHQSPEMVETKRAMLDCAARRILLADHTKF
                     ERRALHNFGALSDFDVVIVDEKTPFAHIERMQAQGINVVVARASEKVDVIPARRR"
     misc_feature    373881..374624
                     /locus_tag="BAB2_0378"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    373881..374027
                     /locus_tag="BAB2_0378"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    374082..374564
                     /locus_tag="BAB2_0378"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(374958..375053)
                     /locus_tag="BAB2_0379"
                     /db_xref="GeneID:3827523"
     CDS             complement(374958..375053)
                     /locus_tag="BAB2_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418586.1"
                     /db_xref="GI:83269295"
                     /db_xref="GeneID:3827523"
                     /translation="MKKEYFDMIESLFYIHFPWSDSNICIPRFKR"
     gene            375289..375870
                     /locus_tag="BAB2_0380"
                     /pseudo
                     /db_xref="GeneID:3827524"
     misc_feature    375289..375870
                     /locus_tag="BAB2_0380"
                     /note="4-hydroxybenzoate octaprenyltransferase"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12546.1"
     gene            375780..376730
                     /locus_tag="BAB2_0381"
                     /pseudo
                     /db_xref="GeneID:3827525"
     misc_feature    375780..376730
                     /locus_tag="BAB2_0381"
                     /note="UbiA prenyltransferase"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12547.1"
     gene            376730..378064
                     /locus_tag="BAB2_0382"
                     /db_xref="GeneID:3827526"
     CDS             376730..378064
                     /locus_tag="BAB2_0382"
                     /EC_number="1.1.3.8"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase"
                     /protein_id="YP_418587.1"
                     /db_xref="GI:83269296"
                     /db_xref="GeneID:3827526"
                     /translation="MTRNFDSFGRIERHERASRSFEKVRAGFAASAAEETSLLAFGNG
                     CSYGDSCHNDAGLLVPMRSVAAIESFDPATGILQAQTGVLLSEIIGFVAPHGYFLPVT
                     PGTRFVTLGGAIANDVHGKNHHLRGTFGCHVESLELLRSDGVQYHCSLHENEGLFAAT
                     IGGMGLTGVIVSARLRLMPVGSLDVEERIVPFDNLDAYFDMAEAADRQNEYAVAWVDQ
                     LSRGKTAGRGVLITGNHAGNGNRSVEDERVRLGVPFDLPFSVLNRVSLRLFNMAYFNA
                     KRRKQKPHLASFGSFFYPLDGVGQWNRLYGPAGLYQHQSVIPFDAARHIIPAMLAASR
                     EAGQASFLTVLKRFGDTASPGLLSFPKPGYTLTMDFPNRGGKTRALLQTLDNMTIGAG
                     GRVNPYKDQRMGAATFKAGFPQWPELEQWRDKRFCSDFWRRTALAPELQQGR"
     misc_feature    376784..377176
                     /locus_tag="BAB2_0382"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    376847..378028
                     /locus_tag="BAB2_0382"
                     /note="FAD-linked oxidoreductase; Region: bact_FAD_ox;
                     TIGR01679"
                     /db_xref="CDD:130740"
     gene            378096..378515
                     /locus_tag="BAB2_0383"
                     /db_xref="GeneID:3827527"
     CDS             378096..378515
                     /locus_tag="BAB2_0383"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418588.1"
                     /db_xref="GI:83269297"
                     /db_xref="GeneID:3827527"
                     /translation="MKYIPFILFTVMTNAAAQLMLKYGMITLGPISFSADTLIQRIFQ
                     IVFNPWVFAGLFTFVISMASHLYVLSKVDLSFAYPFLSLAYVAVALCAWLLFKEELGA
                     YKIAGIAFICIGTILIAQSGKVREADKAVTVQEQAQL"
     misc_feature    378117..378449
                     /locus_tag="BAB2_0383"
                     /note="4-amino-4-deoxy-L-arabinose-phosphoundecaprenol
                     flippase subunit ArnF; Provisional; Region: PRK02971"
                     /db_xref="CDD:235094"
     gene            378564..379574
                     /locus_tag="BAB2_0384"
                     /db_xref="GeneID:3827528"
     CDS             378564..379574
                     /locus_tag="BAB2_0384"
                     /EC_number="4.2.1.46"
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase/dehydratase family protein"
                     /protein_id="YP_418589.1"
                     /db_xref="GI:83269298"
                     /db_xref="GeneID:3827528"
                     /translation="MRHIIFGGDGFVGRYLAPQLLADGHEVIVADIVKSDLAHYGDAT
                     FVHTDVTDPESIRKLGIRADDMVYNLSAKMLSPIQVRAKRHDFFFPVNYYGTENIIKA
                     MDAAGAKKLVHFTTDMVYGHTYVWPQKEDHPCKPLGEYGLSKLKTEELAAQWRTRGMN
                     ISLFRPRLIIGPGRLGILEKLFKLIDNNLPVPMIGSGKNPYQFISVFDCASAARAAFK
                     AGVPNEVYNLGSLNPPPVRKLLGDLIKHAGSKSMLLPTPAWAVKRTLDFLDWLNMPLM
                     DPEQYLIADEMCVLDVSKGERELGWIPQYRDEDMLIAAYSEYRKKKAGGAENRLSPSK
                     AA"
     misc_feature    378564..379535
                     /locus_tag="BAB2_0384"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    378576..379478
                     /locus_tag="BAB2_0384"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(378582..378584,378588..378593,378597..378599,
                     378651..378659,378771..378773,378777..378782,
                     378903..378911,378981..378983,378993..378995,
                     379059..379070)
                     /locus_tag="BAB2_0384"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(378837..378839,378909..378911,378981..378983,
                     378993..378995)
                     /locus_tag="BAB2_0384"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            379585..381039
                     /locus_tag="BAB2_0385"
                     /db_xref="GeneID:3827529"
     CDS             379585..381039
                     /locus_tag="BAB2_0385"
                     /EC_number="2.6.1.13"
                     /codon_start=1
                     /transl_table=11
                     /product="class III aminotransferase"
                     /protein_id="YP_418590.1"
                     /db_xref="GI:83269299"
                     /db_xref="GeneID:3827529"
                     /translation="MKSTIHSEGAAVSASVANHTPKPPLLSVDDAKALDLPRMTELFT
                     AHLNPGQLHFMKLLGFHKVKVERAEGMYYYDQNGRRILDFFGGFGSLAFGHNHPRIIA
                     ARRKFQEELRHEIAIAFMSQYAAALAYDLAACSPGDLDMVFLGSSGSEAMEAAIKVAE
                     RAAGPKKPKIVYAENSFHGKTKGVLSITDGGLYRGEFKLVDNTVRVPFGDITAIENAS
                     RSDPEIGTIVLETVQGGGGIIQADAEFWQKLRQLCDRYGVIWVADEVQCGFGRTGKFY
                     AFEHYGVIPDVTALAKSLGGGKAAMAAMIARRDIYMKAYGTPKTAMIHAMATFGGIGE
                     ACITAIEAVNILYDEQLIDNSAEVGDYLLERLKELQVRYPGLLKDVRGKGMMVGLEFH
                     DFSQAMPMVLRPMLAMLDDKLKGSLPGFIGSHLLRDHGVLVAFTEYNRNVIRLEPPLI
                     CQRAHVDEFIKALDEVLSRGIVKIVKDFIKAQIK"
     misc_feature    379747..380991
                     /locus_tag="BAB2_0385"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    379759..380985
                     /locus_tag="BAB2_0385"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(380023..380031,380113..380118,380122..380124,
                     380272..380274,380371..380373,380377..380382,
                     380458..380460)
                     /locus_tag="BAB2_0385"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(380026..380031,380113..380118,380272..380274,
                     380371..380373,380380..380382,380458..380460)
                     /locus_tag="BAB2_0385"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    380458..380460
                     /locus_tag="BAB2_0385"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(381204..382025)
                     /locus_tag="BAB2_0386"
                     /pseudo
                     /db_xref="GeneID:3827530"
     misc_feature    complement(381204..382025)
                     /locus_tag="BAB2_0386"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12552.1"
     gene            complement(382022..382888)
                     /locus_tag="BAB2_0387"
                     /pseudo
                     /db_xref="GeneID:3827531"
     misc_feature    complement(382022..382888)
                     /locus_tag="BAB2_0387"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12553.1"
     gene            complement(382999..383445)
                     /locus_tag="BAB2_0388"
                     /db_xref="GeneID:3827532"
     CDS             complement(382999..383445)
                     /locus_tag="BAB2_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418591.1"
                     /db_xref="GI:83269300"
                     /db_xref="GeneID:3827532"
                     /translation="MRARSATVGDLETVFCDLSKRMVAEYIAAGKDAKLAYDDLMMNM
                     KEGRAHALVQGDDVVAIISWRESDDATNTLFAAKDEFFSAKTVRFCKKHIRKIQALSG
                     NMPIHSRIWLDRPEIIRWFQIIGYHENGNENGAKLYKLPPTSDARA"
     gene            383707..383841
                     /locus_tag="BAB2_0389"
                     /db_xref="GeneID:3827533"
     CDS             383707..383841
                     /locus_tag="BAB2_0389"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418592.1"
                     /db_xref="GI:83269301"
                     /db_xref="GeneID:3827533"
                     /translation="MLRLVKARLLYSECNKIVDKTGKTAFLSMRHAQTRNNNQDTRIF
                     "
     gene            complement(383855..384247)
                     /locus_tag="BAB2_0390"
                     /db_xref="GeneID:3827574"
     CDS             complement(383855..384247)
                     /locus_tag="BAB2_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4"
                     /protein_id="YP_418593.1"
                     /db_xref="GI:83269302"
                     /db_xref="GeneID:3827574"
                     /translation="MTTKLHAVVDAIGLPLRIKPTPGHYGDCPQASSLLSGLKGVGHV
                     IADAAYDADHLRAFIASDLKATAQIKANPTRSSAPTIDWRLYKERHQIECFFNKLKRY
                     RRIALRCEKTLTAFMGFVHLACAMIWLR"
     misc_feature    complement(383858..384241)
                     /locus_tag="BAB2_0390"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    complement(383858..384118)
                     /locus_tag="BAB2_0390"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            complement(384279..384590)
                     /locus_tag="BAB2_0391"
                     /db_xref="GeneID:3827575"
     CDS             complement(384279..384590)
                     /locus_tag="BAB2_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="IS711, transposase orfA"
                     /protein_id="YP_418594.1"
                     /db_xref="GI:83269303"
                     /db_xref="GeneID:3827575"
                     /translation="MSNGTGSKHIFRGELVRPAAVALITDYLSTPSCGWLPMQRTGAI
                     CLRPSANGQRFMPAFGAGRTPVYGKGFSMPWLIRRTLNMSSLTAPYRKSTQMRRAQKG
                     G"
     misc_feature    complement(<384288..384368)
                     /locus_tag="BAB2_0391"
                     /note="heme biosynthesis-associated TPR protein; Region:
                     TPR_hemY_coli; TIGR00540"
                     /db_xref="CDD:233013"
     gene            complement(385125..386789)
                     /locus_tag="BAB2_0392"
                     /db_xref="GeneID:3827576"
     CDS             complement(385125..386789)
                     /locus_tag="BAB2_0392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418595.1"
                     /db_xref="GI:83269304"
                     /db_xref="GeneID:3827576"
                     /translation="MLSAGTDLHFKPNDRNAPFGAMMIMGDRRSAIPEDFRGIPVSVL
                     AYAAENAANQVLRARLCDLCWLLERKRHQLGRAAIASYVAIAEGLGSGSLKDRLDRDD
                     PLLGLTARDVLRRALSMGRPLGWDIDEVIAARTLLSAIRARAVRSSNPVPVHWFFEMD
                     LDFGISDPSIIAAEIEAYLTGGVPEPGSHMIVELWRLAARGHHYAKDEDGKNRCRTGA
                     AEALVAESEKHTSAMLASHWLSEAIAEYHGVPGQRKRRTQLRHKLIDVQSGIADEMSS
                     FSHPMDLSAIADQVKEQLEGERDLIDLLLIFADLEQSPSPKKLMEDAVKSINDHPLSS
                     LFGASFHDHEGKVIHKSEGGGFGDGDNGDAIRLQISQHESMRRGIHVSGQVQVARQYI
                     TRNYYVGEDTLQALIRHSPFVPNDLVNTFSRGFARFFEGDCVSALYILTPMLENSLRH
                     ILKLNGYDVTTFDDAKQVQEDRTISALFEQMRPELEEAFGDAITTDIDNVFLSKPGPS
                     LRHAVAHGLLNDSSPYGTDAIYACWLIFRLCCIPLFEQRERLRLPS"
     gene            complement(387007..387936)
                     /locus_tag="BAB2_0393"
                     /db_xref="GeneID:3827577"
     CDS             complement(387007..387936)
                     /locus_tag="BAB2_0393"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_418596.1"
                     /db_xref="GI:83269305"
                     /db_xref="GeneID:3827577"
                     /translation="MSDIKLFRTDSASVTELRGSAVALEKLLQTLIERNMEAFLGVRF
                     LASEFPTSNGGRMDSLGIDENGSPVIIEYKRASNENVINQGLFYLDWLMDHRRDFEWL
                     VLERFGAEQAKAVDWGTPRLICIAGDFTKYDAHAVNQMNRNIALVRYRRFGGELLLFE
                     LLTSASERSAREIPASIDTQDEPAAARPRSRQKTVMQYLADADQDLVDLYEATKAYLL
                     ALGGDVELKPLDNYVAFRRLKNFACVEVKPQIRHLKVFVKVDPDTTELEPGFTRDVRN
                     IGHFGIGDLEIIITDVATLDTAKPLMDRSYDGA"
     misc_feature    complement(387595..>387918)
                     /locus_tag="BAB2_0393"
                     /note="Protein of unknown function DUF91; Region: DUF91;
                     cl00709"
                     /db_xref="CDD:260583"
     misc_feature    complement(387010..387318)
                     /locus_tag="BAB2_0393"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3586"
                     /db_xref="CDD:226114"
     gene            complement(387944..388684)
                     /locus_tag="BAB2_0394"
                     /db_xref="GeneID:3827578"
     CDS             complement(387944..388684)
                     /locus_tag="BAB2_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418597.1"
                     /db_xref="GI:83269306"
                     /db_xref="GeneID:3827578"
                     /translation="MTDTAQHSIVFGGETFAFQIERTARRKTVAISVGFDGVRVLAPS
                     DLDDDRVLGIVRKKGAWLLRKQAAYRELEGQPVAKEFVSGETFHYLGRQYRLKLIPDE
                     TAVVTRIAARGSTLIAPVLPNGHASVQRAAVRNGLRHWYRAHAIQHFPIRARVIAKTL
                     GIPTPIVKVVDQSKRWGSCDARGRIRLNWRLAMAPMPLVDYVIAHEACHILEHNHSRR
                     FWRSLEAIMPDYEDRLRRLDRMGHQFIW"
     misc_feature    complement(387965..388606)
                     /locus_tag="BAB2_0394"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     pfam01863"
                     /db_xref="CDD:145171"
     gene            complement(388681..391584)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /db_xref="GeneID:3827167"
     CDS             complement(388681..391584)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /EC_number="3.1.21.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="YP_418598.1"
                     /db_xref="GI:83269307"
                     /db_xref="REBASE:BmeAORF397P"
                     /db_xref="GeneID:3827167"
                     /translation="MLFDYKPLSPEDVRRLRDGLATEPVLTLRLAECLTRLNPWLDDD
                     GVRRAVAAVTRVTAVDVMEANESAYTALTYGVTAPHTEGGRRQDRNMRFFDFDDPSAN
                     TFEFARQVAIKGARQDIIPDIVVYVNGLPLAAIECKSPSLADPMGEAIRQFRRYENRD
                     EFAGLGAPRLFETAQISIALARDVAKYGTTLTPARQWAEWKDPYPLTLDALAAQLGRT
                     PTGQDILLAGLLAPANLLDLIRNFVVFETIGGRRIKKLARYQQFVAVGKAIERIRTAP
                     NPQRRGGVIHHTQGSGKSLTMVFLATKLRRLPEAENPTIVIVTDRTDLDDQITGQFQR
                     SGFANPIQAESGDSLRKALSGGAGTTVLTTVHKFHSAVPKRSSVISKARNVFVMVDEA
                     HRTQYGALAARMRAGLPNACMIAFTGTPIDKKDRSTREAFGDYLHRYLIDQAVKDGAT
                     VPIYYEMRDARIRIDGRDFEREVRAAFPELSEDEIAKLRRGTGLQEKLAGAPVRVEAI
                     AQDILSHYRSTIEPNGFKAQIVTVSRDVAVTYVEALERLGAPECALIMSASNNDSARL
                     QARHLSKRDRDSKISRFKKRDDPLKILVVCDMLLTGFDAPIEQVLYLDAPLREHTLLQ
                     AIARVNRTADGKTYGLVVDYWGDNRRIADALDMFSDEDGIASALRPLSEKIQLLESRH
                     RAAIRLFEGISHQNDTACVELLRQDDIRAKFELDFLRFAEAMDMVLPNPKALEDPYPS
                     DLKWLSRIRVLARRAYHEEPFDPKDYGAKVGEIITSHLFVTGVEQLLVKFDILDPAFR
                     PHLESLRSSDTKAAEIEHAIRQEIHVHRDENPTAYASLWEQLERIVNDRREARVSAAS
                     ALTQLEAMVGQAADIRSGATSRSDGLNGTAAAILPFIDNDLPDAERSRSAAGITKALE
                     EYAEVVDWQHKEDVQRQMRRSIKEQLRSLGLDAHKIEATTAKIMDVARARYAG"
     misc_feature    complement(388762..391539)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="Type I site-specific restriction-modification
                     system, R (restriction) subunit and related helicases
                     [Defense mechanisms]; Region: COG0610"
                     /db_xref="CDD:223683"
     misc_feature    complement(391003..>391293)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:252519"
     misc_feature    complement(390325..390744)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(390703..390717)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(390406..390417)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(389692..>389874)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    complement(388702..389478)
                     /gene="hsdR"
                     /locus_tag="BAB2_0395"
                     /note="Domain of unknown function (DUF3387); Region:
                     DUF3387; pfam11867"
                     /db_xref="CDD:256686"
     gene            complement(391647..392870)
                     /gene="hsdS"
                     /locus_tag="BAB2_0396"
                     /db_xref="GeneID:3827168"
     CDS             complement(391647..392870)
                     /gene="hsdS"
                     /locus_tag="BAB2_0396"
                     /EC_number="3.1.21.3"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system subunit
                     S"
                     /protein_id="YP_418599.1"
                     /db_xref="GI:83269308"
                     /db_xref="GeneID:3827168"
                     /translation="MSVEVPKGWREVRIGQIAREISNRNHASADIPVLSMTKHRGFVR
                     SNEYFSKSVHSENTRQYKVVKRGQFAYATIHLDEGSIDYLRNEDAGLISPMYTVFETN
                     SEEIDNEIALRQFKRFALSGRFDPYSNGGVNRRKSILFSDLSAFKFGLPPLTEQRAIA
                     EVLGAAEAAIAKTEALIKAIEQTKKALLKQYFVERQQSLLWSCVAKMGRWLSGGTPAT
                     AAEENWKGSIPWVCPKDIKGPSISSTVDHISEDAAKALGMVGPGTLLLVVRGMILARS
                     VPSTICTVRCAFNQDVKAFVPNEGVAPAFLKLWLDINEHKLLGEIETATHGTKRFPLE
                     RLNEFPVPVVTRDEQIRLVTLAESSQERLRSERDNLSALRSVRDALAQELLSGRIRLP
                     ESIIARHRDKAGQAA"
     misc_feature    complement(392325..392855)
                     /gene="hsdS"
                     /locus_tag="BAB2_0396"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     misc_feature    complement(391707..392846)
                     /gene="hsdS"
                     /locus_tag="BAB2_0396"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     gene            complement(392860..394386)
                     /gene="hsdM"
                     /locus_tag="BAB2_0397"
                     /db_xref="GeneID:3827166"
     CDS             complement(392860..394386)
                     /gene="hsdM"
                     /locus_tag="BAB2_0397"
                     /EC_number="2.1.1.72"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 adenine-specific DNA methylase"
                     /protein_id="YP_418600.1"
                     /db_xref="GI:83269309"
                     /db_xref="GeneID:3827166"
                     /translation="MAKLTRTELENHLWKSADILRGSIDSSDYKIYIFGFLFLKRLSD
                     RFEEEAKESIRQGLPENVAYSDPDEHEFFLVERARWSSIKKLTTGIGDHLNKACAAIE
                     DANPSIEGVLANIDFNSESRLGDAKNREGVLSRLIDHFSRIDLSNASLSEPDMLGRAY
                     EYLIDKFADDAGKKGGEFYTPHHVVRLIVELLAPKPGMRISDPTCGSGGMLVQVAEHV
                     AKLEGKRLGEALNITLHGQEKNLGTWAIAKMNLLLHGLRDARIEKGDTIRNPRLLDQD
                     GNLFLYDRVIANPPFSLDSWGAEDVSGDTEKKGHNRFIYGIPPKNMGDLAFVQHMVAT
                     LNTKGVCGVVMPHGVLFRGSGDGRIRESMLKADLFEAIIGLPENLFAGTGIPATVLIL
                     NKAKATERKGRVLFIHGAKEFEERPKKNILGEGNITRIVNAFNAWKDEDRFCRIVDMK
                     EIEENDFNLNISRYIDTLEPEKPIDVQAELAKLWDAETARDEAAARMNALLKEMGYVG
                     "
     misc_feature    complement(392869..394377)
                     /gene="hsdM"
                     /locus_tag="BAB2_0397"
                     /note="Type I restriction-modification system
                     methyltransferase subunit [Defense mechanisms]; Region:
                     HsdM; COG0286"
                     /db_xref="CDD:223363"
     misc_feature    complement(393967..394362)
                     /gene="hsdM"
                     /locus_tag="BAB2_0397"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     misc_feature    complement(393346..393798)
                     /gene="hsdM"
                     /locus_tag="BAB2_0397"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     gene            complement(394394..395026)
                     /locus_tag="BAB2_0398"
                     /db_xref="GeneID:3827579"
     CDS             complement(394394..395026)
                     /locus_tag="BAB2_0398"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification enzyme, S
                     subunit"
                     /protein_id="YP_418601.1"
                     /db_xref="GI:83269310"
                     /db_xref="GeneID:3827579"
                     /translation="MMKQRKATVLSHTGARLLDVAEIFAGVGVSREETVIRPGERLPV
                     IGVRDLQDGVVAPREALDTVGFSSLSKAMTYAVQAGDVLVTGRGTLLKFGLVGDETAG
                     AVASANIIVVRPAPDATGGALFAILSSDVFRPKIEVLRRGATTLLSLSPKDLANLEIN
                     LPSLNEQERIAALVKEAQVAYRTALEAAKIRRSLARRLIDARLFGDDQNH"
     misc_feature    complement(394457..394972)
                     /locus_tag="BAB2_0398"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            395187..395327
                     /locus_tag="BAB2_0399"
                     /db_xref="GeneID:3827580"
     CDS             395187..395327
                     /locus_tag="BAB2_0399"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418602.1"
                     /db_xref="GI:83269311"
                     /db_xref="GeneID:3827580"
                     /translation="MASRARPSDLAIIERDAALIRGMIEWGDRHHDIAAFFGPIRVGS
                     LK"
     gene            396345..396575
                     /locus_tag="BAB2_0400"
                     /db_xref="GeneID:3827581"
     CDS             396345..396575
                     /locus_tag="BAB2_0400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418603.1"
                     /db_xref="GI:83269312"
                     /db_xref="GeneID:3827581"
                     /translation="MSASEFQRITGAMTALGWGYGTHRLYDLGRTGRSARMGFARGNA
                     DEQRTNGSPSAPKGGIPILQAVSEHTDESGPF"
     gene            396713..396925
                     /locus_tag="BAB2_0401"
                     /db_xref="GeneID:3827582"
     CDS             396713..396925
                     /locus_tag="BAB2_0401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418604.1"
                     /db_xref="GI:83269313"
                     /db_xref="GeneID:3827582"
                     /translation="MWRREASACLRGLQSAAGAGLSVFGAKGAAAISGALRWPPMPLP
                     RKRLQHLRGTVELIVVQPGEGAVNIG"
     gene            397094..397594
                     /locus_tag="BAB2_0402"
                     /db_xref="GeneID:3827583"
     CDS             397094..397594
                     /locus_tag="BAB2_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418605.1"
                     /db_xref="GI:83269314"
                     /db_xref="GeneID:3827583"
                     /translation="MLKGPAFSLPMMADICAEKSLKLYMRTLFRTKAAKDCSNSEMRT
                     LHSRALRAATSHSMKSDIVVLQMTMVDLLLAILHWLLSTFFGGQAFAFVGLVLWTIWT
                     GALKPRLIPVDDIVRVAGDIIASYPDPELEAFARHKRAWNRSEGAKQTYWYRVRKAVR
                     RRLQGR"
     gene            complement(397601..398323)
                     /locus_tag="BAB2_0403"
                     /db_xref="GeneID:3827584"
     CDS             complement(397601..398323)
                     /locus_tag="BAB2_0403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418606.1"
                     /db_xref="GI:83269315"
                     /db_xref="GeneID:3827584"
                     /translation="MKMRRLPEIDLARIAPLATDQKRRALERFKLGHPTLTYKPVRAL
                     FADIFNVQLDMFTASCPADWSILKRLIRAKATSDNEFNANLLVAKGLHDFAQAKALRS
                     RSHPFFPLSLSVGEKVEYWLPIVTALEGVPLVIFVDPRRSNGLTAEARRFVFSMMHEH
                     IRLANLDFATARLGIVQFGDATDSQRPVKLSTDEDVELFDFDQLDQMVRETYDIWREI
                     NEARESEVRRKAAGGGHGPLFD"
     gene            complement(398877..398952)
                     /gene="tRNA-Thr1"
                     /locus_tag="BAB2_1168"
                     /db_xref="GeneID:3827796"
     tRNA            complement(398877..398952)
                     /gene="tRNA-Thr1"
                     /locus_tag="BAB2_1168"
                     /product="tRNA-Thr"
                     /note="anticodon CGT, Cove Score=93.84"
                     /db_xref="GeneID:3827796"
     gene            complement(399182..399475)
                     /locus_tag="BAB2_0404"
                     /db_xref="GeneID:3827585"
     CDS             complement(399182..399475)
                     /locus_tag="BAB2_0404"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418607.1"
                     /db_xref="GI:83269316"
                     /db_xref="GeneID:3827585"
                     /translation="MLRSRKSPRRPHWWIVWNANIATHAQSSALALDRICVLTAHKHD
                     LPRNRARLLLPGFTFVVSGHEAISNFTNLDDPIGCMVPAMEIEQGFCTNMQIV"
     gene            complement(399378..400346)
                     /locus_tag="BAB2_0405"
                     /db_xref="GeneID:3827586"
     CDS             complement(399378..400346)
                     /locus_tag="BAB2_0405"
                     /EC_number="1.13.12.16"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN/related compound-binding core"
                     /protein_id="YP_418608.1"
                     /db_xref="GI:83269317"
                     /db_xref="GeneID:3827586"
                     /translation="MALPDILKDRLRIPVVGAPLFIISHPALVLAQCKAGVVGSFPAL
                     NARPEAQLDEWLAEITGDLAAYNAVNPGRPAAPFAVNQIVHRSNKRLEHDLGLCVKYK
                     VPIVISSLGAVPEVNAAIHSYGGIVLHDVINNRHANSAIRKGADGLIAVAAGAGGHAG
                     SLSPFALIQEIRSWFDGPLLLSGAIANGRSILAAQAMGADLAYMGSPFIATTEARAVD
                     AYKQMIVDSDSSDIVYSNYFTGIAGNYLKPSIAKAGLDPDNLPQADPSKMDFEKAQQE
                     GAKAWKDIWGCGQGIAAIKEIAPTASLVDRLEREYRDARAKLCAGA"
     misc_feature    complement(399393..400346)
                     /locus_tag="BAB2_0405"
                     /note="Dioxygenases related to 2-nitropropane dioxygenase
                     [General function prediction only]; Region: COG2070"
                     /db_xref="CDD:224981"
     misc_feature    complement(399609..400316)
                     /locus_tag="BAB2_0405"
                     /note="2-Nitropropane dioxygenase (NPD), one of the
                     nitroalkane oxidizing enzyme families, catalyzes oxidative
                     denitrification of nitroalkanes to their corresponding
                     carbonyl compounds and nitrites. NDP is a member of the
                     NAD(P)H-dependent flavin oxidoreductase...; Region:
                     NPD_like; cd04730"
                     /db_xref="CDD:240081"
     misc_feature    complement(order(399729..399740,399795..399803,
                     399879..399884,399894..399896,399957..399959,
                     400020..400022,400098..400100,400287..400292))
                     /locus_tag="BAB2_0405"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240081"
     gene            400493..400654
                     /locus_tag="BAB2_0406"
                     /db_xref="GeneID:3827587"
     CDS             400493..400654
                     /locus_tag="BAB2_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418609.1"
                     /db_xref="GI:83269318"
                     /db_xref="GeneID:3827587"
                     /translation="MIGAELKPKETIWLSTFGLLSNQKAVSFVNLEAADGEKPCALLI
                     FGAPVSYNG"
     gene            400852..401874
                     /locus_tag="BAB2_0407"
                     /db_xref="GeneID:3827588"
     CDS             400852..401874
                     /locus_tag="BAB2_0407"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418610.1"
                     /db_xref="GI:83269319"
                     /db_xref="GeneID:3827588"
                     /translation="MESIERAIRNAFAKADAHNPATRQRIYESAWGAHERAMATNTAL
                     SAAQKEQRREKLKDAISRIEEEFAKRHQDGEAQREPSLDSPHQNDPVLGSSMAESTPV
                     LDSGDIRPMSRKKRPAADLGYEGGTSRKDHKKKRHSPFYSYGIPALVLLVAVMIGYSL
                     YNSLSDLGRGPSTGPLMSGTSLAPLKEGEEPGGAKWINIFLPDEATRISVQGSATAEI
                     LQDGKNKFARIRSSGVGDTVTFDVGEGILDQLVGKKATFDIIARSDDGKLTQMSVNCN
                     LAGLGDCGRRRYDVNESLNDFLFDMDFSASRKPGGAGTITVDSDLSNSGKPVDIYAIR
                     VTTADK"
     gene            401970..402116
                     /locus_tag="BAB2_0408"
                     /db_xref="GeneID:3827589"
     CDS             401970..402116
                     /locus_tag="BAB2_0408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418611.1"
                     /db_xref="GI:83269320"
                     /db_xref="GeneID:3827589"
                     /translation="MPDLWRVERLQRVASRRVTKFARKGRGFAADKMRTKVNKRLGGL
                     PCCD"
     gene            402126..404681
                     /locus_tag="BAB2_0409"
                     /db_xref="GeneID:3827590"
     CDS             402126..404681
                     /locus_tag="BAB2_0409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418612.1"
                     /db_xref="GI:83269321"
                     /db_xref="GeneID:3827590"
                     /translation="MTLTRKPIAASATFLLPDRFVKWFAAKGWSPRAHQLELLARAEQ
                     GQSTLLIAPTGAGKTLAGFLPALVDLEKRRSKAISGKVGTGFPSGIAPKSKSGVHTLY
                     ISPLKALAVDIHRNLTVPVEEMGLDISIETRTGDTPAHKRQRQKLAPPDILLTTPEQL
                     ALLIASRVAEQFFKDLRYVVLDELHSLVISKRGHLLALGLARLRRLQPQLQTIGLSAT
                     VAEPDELRRWLVEQDGTGSMAGLVTVDGGAKPEITILDSKERVPWAGHSSRYAIPDIY
                     AAIRQHRTTLLFVNTRSQAEMLFQELWRVNEETLPIALHHGSLDAGQRRKVEQAMAAN
                     TLRAVVATSTLDLGIDWGDVDLVIHVGAPKGASRLAQRIGRANHRMDEPSRAILVPAN
                     RFEVMECRAALDANYLGAQDTPPLIDGALDVLAQHVLGMACAEPFNADQLYREVQSAA
                     PYANLPRDTFDRILDFVATGGYALKTYERFAKIRKTVDGTWRVSNPRIAQQYRLNIGT
                     IVEAPELNVRLTRGGKGANARGGRVLGRIEEYFLETLTAGDTFLFAGKVLRFEGIREN
                     ECIASNAAGQDAKIPVYAGGKFPLSTYLAAQVRAMLADRARWQFLPQQVREWLEVQQW
                     KSVLPGTDELLIETFPRGNRFYMVAYPFEGRLAHQTLGMLLTRRLERMGAHPLGFVTT
                     DYSLGLWGLKDMASMIRMGRLNLSRLFDEDMLGDDLEAWLDESYLLKRTFRNCAVISG
                     LIERRHPGQEKTGRQVTVSTDLIYDVLRSHEPDHILLQATRADAATGLLDIKRLGDML
                     ARVKGHILHKPLDQISPLALPVMLEIGRERVAGEGDEMLLEEAADDLVREAMQ"
     misc_feature    402177..404666
                     /locus_tag="BAB2_0409"
                     /note="DEXH box helicase, DNA ligase-associated; Region:
                     DEXH_lig_assoc; TIGR04121"
                     /db_xref="CDD:234478"
     misc_feature    402261..402779
                     /locus_tag="BAB2_0409"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    402288..402302
                     /locus_tag="BAB2_0409"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    402669..402680
                     /locus_tag="BAB2_0409"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    402921..403292
                     /locus_tag="BAB2_0409"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(402993..403004,403071..403076,403149..403157)
                     /locus_tag="BAB2_0409"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(403173..403175,403236..403238,403248..403250,
                     403260..403262)
                     /locus_tag="BAB2_0409"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    404004..404576
                     /locus_tag="BAB2_0409"
                     /note="DEAD/H associated; Region: DEAD_assoc; pfam08494"
                     /db_xref="CDD:254833"
     gene            404678..405394
                     /locus_tag="BAB2_0410"
                     /db_xref="GeneID:3827591"
     CDS             404678..405394
                     /locus_tag="BAB2_0410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418613.1"
                     /db_xref="GI:83269322"
                     /db_xref="GeneID:3827591"
                     /translation="MKTAAWGNGEAYSLAHAEVRGVAAVCDPSGALFLPYLHMLVVSD
                     LHLEKGSSFARRGQLIPPYDTAATLDMLAQAIARYQPRTIISLGDSFHDAKASERLPS
                     LYAIRLKSLMEHRDWLWITGNHDPERPVDLPGDCVEELAVGPLTFRHEPSRKAGQGEI
                     AGHLHPAARIVRRGRSVRRPCFVSDGERLIMPAFGAYTGALNILDRAFRGLFTDETLR
                     AYMLGQGKVYPIARGALYGG"
     misc_feature    404795..405286
                     /locus_tag="BAB2_0410"
                     /note="Pyrococcus furiosus PF1019 and related proteins,
                     metallophosphatase domain; Region: MPP_PF1019; cd07391"
                     /db_xref="CDD:163634"
     misc_feature    order(404807..404809,404813..404815,404942..404944,
                     405044..405049,405122..405124,405164..405166,
                     405170..405172)
                     /locus_tag="BAB2_0410"
                     /note="putative active site [active]"
                     /db_xref="CDD:163634"
     misc_feature    order(404807..404809,404813..404815,404942..404944,
                     405044..405046,405122..405124,405164..405166,
                     405170..405172)
                     /locus_tag="BAB2_0410"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163634"
     gene            complement(405492..406283)
                     /locus_tag="BAB2_0411"
                     /db_xref="GeneID:3827592"
     CDS             complement(405492..406283)
                     /locus_tag="BAB2_0411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418614.1"
                     /db_xref="GI:83269323"
                     /db_xref="GeneID:3827592"
                     /translation="MLLMTGSAAAQVDSSGNGNTVPQLQNPAEESIEIGLSTETIAIT
                     SNFGGTGLTIFGALDNADPMIQRQGRYDIIVVLQGPARDIVVRKKERYLGVWVNAASE
                     TFLGVPLSYSLASTRNLQDIADEKTYRQLSVGVHNFYLVPDDPDSPSDNIVKFGNELR
                     EIKIRQGLYSQRIGGVEFISRTLFRATLNLPANVPVGRHKARALLFRNGVFLREANAS
                     LEIVKAGLEQSVYNAAHQNSLLYGLFAVFLAIFTGWFGRILFRKD"
     misc_feature    complement(405495..406277)
                     /locus_tag="BAB2_0411"
                     /note="conserved hypothetical protein; Region:
                     alph_Pro_TM; TIGR02186"
                     /db_xref="CDD:200163"
     gene            complement(406318..407268)
                     /locus_tag="BAB2_0412"
                     /db_xref="GeneID:3827593"
     CDS             complement(406318..407268)
                     /locus_tag="BAB2_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418615.1"
                     /db_xref="GI:83269324"
                     /db_xref="GeneID:3827593"
                     /translation="MLCVEKPGSDLGIYLPIAELSVNMLVLLGMGAAVGFLSGLFGVG
                     GGFLITPLLIFYNIPPAIAVATGANQVIASSVSGALAHFKRRTLDIKLGLFLVAGGIL
                     GSLIGIFVFSWLRDLGQLDLIVSILYVFFLGTIGGLMLVESVQALRRAKKGQGGAVRR
                     SGQHTWIHRLPFKMRFRASTIYVSVIPVLGIGFFIGLLSSVMGVGGGFIMVPALIYLL
                     HVPTNVVVGTSLFQITFVTAFTTVMQATTNQSIDIVLAFLLMVGGVIGAQYGARAGRK
                     LRGEQLRLLLALLVLAVGMRLAFGLFVRPDNLFSISIADI"
     misc_feature    complement(406426..407190)
                     /locus_tag="BAB2_0412"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            complement(407505..410246)
                     /locus_tag="BAB2_0413"
                     /db_xref="GeneID:3828055"
     CDS             complement(407505..410246)
                     /locus_tag="BAB2_0413"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1-like repeat-containing protein"
                     /protein_id="YP_418616.1"
                     /db_xref="GI:83269325"
                     /db_xref="GeneID:3828055"
                     /translation="MQDLSQTLSALEEHLSELEPQKVDRAAPADARAQTSIAGLAEIA
                     DHLRRMRNPYISPDEEAAERAFQPPHRDEAFGEPPHYRRRLSDRIGTAAPEYARPQAA
                     PAEHDALHHIDGRLNEISRALIATNKLQRPSREEAERMDRIEKRLAALTAQLDSAFTR
                     EDSDALFRRLGELSQRIDALQANASLPEQIVDQLACQVQLLATQIGKVVENLSRSDYR
                     RVEARLEAISERLDAAERRAHEHHPAVMDQIDRRFAELTERLDAHYASRYGASSADSE
                     AIHNLEQQIASIAQHLAQPSRELAEIRPRLDSIERSLHSNREIVLDAAREATESVVAR
                     MLQHGPKSETAIAQQLAADMKALETLARNADDRNTKTFEAVHDTLTQVVERLAGIEKE
                     MSPKPAASAPIKAPVFSSPAAPAPVKFPQVEKAAAHTSRPHEPFFKSDFASLKPARRE
                     NPVHTQPPAVKPDVKSGPRAGDETVLDLNSIMKRVREERRQQEDGSEAPKTAATSKVD
                     FITAARRAAQLAATQSEQIEKDAAAPTEKKKASIADILHRQRKPILFAIGAVMIAIAG
                     LQVGTAFLNRDSDIDPAVNVAAEKPAAIDMASTGGIQTIPTTINRAATLATPQMPPLQ
                     AESTVDDKMPALPPEPQASAQFSPPETEQTAAPEPKKIEIPSIPEEAGPAALREAAAK
                     GDIRALFEIGNRYMEGRGVAENVKKAAKWYQLAADQGNASAMHNLAVLFATGTNGTPD
                     NAAAVRWFTEAAELGVKDSQYNLGILAAKGLGMPVNLEESYKWFALAANAGDKDAAEK
                     RDQIAKALKPEMLTRAKGAVKLWKAKPLDDAANSIDVPDAWTEAKPLSTSSVDMKKAV
                     RNIQLILQKNGYDTGTADGIMGAKTRTAISAFQKANGQEPTGEVNQKLVQLLLEKNK"
     misc_feature    complement(<409464..>409829)
                     /locus_tag="BAB2_0413"
                     /note="metal ion transporter CorA-like divalent cation
                     transporter superfamily; Region: MIT_CorA-like; cl00459"
                     /db_xref="CDD:260436"
     misc_feature    complement(order(409464..409481,409485..409508,
                     409536..409544,409548..409553,409557..409562,
                     409569..409574,409578..409583,409590..409595,
                     409635..409640,409668..409673,409680..409685,
                     409689..409691,409701..409706,409710..409715,
                     409722..409727,409734..409739,409743..409745,
                     409749..409751,409794..409796,409803..409808,
                     409812..409817,409824..409826))
                     /locus_tag="BAB2_0413"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213354"
     misc_feature    complement(407685..408323)
                     /locus_tag="BAB2_0413"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(408087..408188)
                     /locus_tag="BAB2_0413"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(407982..408086)
                     /locus_tag="BAB2_0413"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(407871..407975)
                     /locus_tag="BAB2_0413"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(407523..407684)
                     /locus_tag="BAB2_0413"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            410676..411071
                     /locus_tag="BAB2_0414"
                     /db_xref="GeneID:3828056"
     CDS             410676..411071
                     /locus_tag="BAB2_0414"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_418617.1"
                     /db_xref="GI:83269326"
                     /db_xref="GeneID:3828056"
                     /translation="MKAKHEGETNGPFFRIGDLAQEFGLTLRALRFYEDKGLLRPRRA
                     GVTRLCNLNDYARLRLVIFGRRIGFTLGEISELIGLWEQGLADPGQLSALRQSFIAKL
                     TELEKKKVEIDDTIDELRTVLGRLSSLPG"
     misc_feature    410715..411053
                     /locus_tag="BAB2_0414"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    410715..411053
                     /locus_tag="BAB2_0414"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    order(410718..410726,410766..410768,410811..410819)
                     /locus_tag="BAB2_0414"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            complement(411126..411485)
                     /locus_tag="BAB2_0415"
                     /db_xref="GeneID:3828057"
     CDS             complement(411126..411485)
                     /locus_tag="BAB2_0415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418618.1"
                     /db_xref="GI:83269327"
                     /db_xref="GeneID:3828057"
                     /translation="MELPRESTLLRIFVGEEDQTEDGKLLYEAIVNKAREMQMAGATV
                     LRGPLGFGHSSILHTAKILRLSQDLPTVIEIVDAPEKIEHFIPQVMKMTQSCLITTEK
                     VQVIHYGSNGSTKEKGD"
     misc_feature    complement(411153..411482)
                     /locus_tag="BAB2_0415"
                     /note="PII-like signaling protein [Signal transduction
                     mechanisms]; Region: COG1993"
                     /db_xref="CDD:224904"
     gene            complement(411501..411914)
                     /locus_tag="BAB2_0416"
                     /db_xref="GeneID:3828058"
     CDS             complement(411501..411914)
                     /locus_tag="BAB2_0416"
                     /note="may be involved in chromosome condensation;
                     overexpression in Escherichia coli protects against
                     decondensation by camphor; overexpressing the protein
                     results in an increase in supercoiling"
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="YP_418619.1"
                     /db_xref="GI:83269328"
                     /db_xref="GeneID:3828058"
                     /translation="MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLW
                     GTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFVMGGLCGGLTTFSSMSLDTFLLV
                     LHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR"
     misc_feature    complement(411504..411914)
                     /locus_tag="BAB2_0416"
                     /note="camphor resistance protein CrcB; Provisional;
                     Region: PRK14225"
                     /db_xref="CDD:172713"
     gene            complement(411911..412312)
                     /locus_tag="BAB2_0417"
                     /db_xref="GeneID:3828059"
     CDS             complement(411911..412312)
                     /locus_tag="BAB2_0417"
                     /note="may be involved in chromosome condensation;
                     overexpression in Escherichia coli protects against
                     decondensation by camphor; overexpressing the protein
                     results in an increase in supercoiling"
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="YP_418620.1"
                     /db_xref="GI:83269329"
                     /db_xref="GeneID:3828059"
                     /translation="MSVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNV
                     SGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGYTTVSSFCLQSVNLMLDGEQRQ
                     ALFNIVASALLCVLAVAAGYGGIMWIMEWPG"
     misc_feature    complement(411914..412312)
                     /locus_tag="BAB2_0417"
                     /note="camphor resistance protein CrcB; Provisional;
                     Region: PRK14233"
                     /db_xref="CDD:172721"
     gene            412769..413050
                     /locus_tag="BAB2_0418"
                     /pseudo
                     /db_xref="GeneID:3828060"
     misc_feature    412769..413050
                     /locus_tag="BAB2_0418"
                     /note="membrane fusion protein MtrC"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12584.1"
     gene            413064..413756
                     /locus_tag="BAB2_0419"
                     /pseudo
                     /db_xref="GeneID:3828061"
     misc_feature    413064..413756
                     /locus_tag="BAB2_0419"
                     /note="membrane fusion protein MtrC"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12585.1"
     gene            413779..414636
                     /locus_tag="BAB2_0420"
                     /pseudo
                     /db_xref="GeneID:3828062"
     misc_feature    413779..414636
                     /locus_tag="BAB2_0420"
                     /note="Acriflavin resistance protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12586.1"
     gene            414667..416859
                     /locus_tag="BAB2_0421"
                     /pseudo
                     /db_xref="GeneID:3828063"
     misc_feature    414667..416859
                     /locus_tag="BAB2_0421"
                     /note="ABC transporter, family 2:Acriflavin resistance
                     protein:Sodium:dicarboxylate symporter"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12587.1"
     gene            complement(417043..418248)
                     /gene="uxuA"
                     /locus_tag="BAB2_0422"
                     /db_xref="GeneID:3827697"
     CDS             complement(417043..418248)
                     /gene="uxuA"
                     /locus_tag="BAB2_0422"
                     /EC_number="4.2.1.8"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate from mannonate"
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate dehydratase"
                     /protein_id="YP_418621.1"
                     /db_xref="GI:83269330"
                     /db_xref="GeneID:3827697"
                     /translation="MRQAWRWFGPEAGVPLDAVRQAGATDIVSALHEVPIGQEWTSAQ
                     IVERKNLIESTPTGRHPLTWSVVESIPVSDDIKRSGKAARHDIGAWIASMEALARNDI
                     KVICYNFMPVVDWCRTDLDYITSTGAMAMRFDQDRFAAFDLHILQRKGAEKDYSEEDR
                     IAARAIFEAMDETEIEQLIVNIASALPGSTTEPLTIPAFRKKLETYASIDAAHLRRNL
                     VEFLEAVTPVADSLGVKLTLHPDDPPRSLFGLPRIASTEADYAAIFAAVPAQSNGMCF
                     CTGSLGVRADNDLPAIARRFASRIHFSHLRATTREGDGRTFHEAAHLEGDVDMVGILR
                     ILLEKDRKRDAGQTIIFRSDHGHRMMDDLEKKVTPGYPVIGRMRGLAELRGIITALDA
                     CALEYDPNV"
     misc_feature    complement(417058..418248)
                     /gene="uxuA"
                     /locus_tag="BAB2_0422"
                     /note="D-mannonate dehydratase [Carbohydrate transport and
                     metabolism]; Region: UxuA; COG1312"
                     /db_xref="CDD:224231"
     misc_feature    complement(417073..418248)
                     /gene="uxuA"
                     /locus_tag="BAB2_0422"
                     /note="mannonate dehydratase; Provisional; Region:
                     PRK03906"
                     /db_xref="CDD:235172"
     gene            complement(418309..419082)
                     /locus_tag="BAB2_0423"
                     /db_xref="GeneID:3828064"
     CDS             complement(418309..419082)
                     /locus_tag="BAB2_0423"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418622.1"
                     /db_xref="GI:83269331"
                     /db_xref="GeneID:3828064"
                     /translation="MRGRSAQPALEKQKNVADTESGAATGVKARTLPSRVAGVQRVTT
                     AKLIYHELQQQIIRMELLPGTPLNEKALTEKYGVSRTPVREALIRLAEDRLVDVFPQS
                     GTFVARIPVDAIPEAVVIRQALEGETAERAAANSTAAAIEKLDELIHLQTFYARKDKP
                     GPFHETDDAFHETIAEIAGYPGIWQHLKPVKMQIDRARRMTMPILGRMEQVLREHHAI
                     RDAISARDVHAAREAMKHHLSAVLPDIDELRKSRPDYFA"
     misc_feature    complement(418312..418965)
                     /locus_tag="BAB2_0423"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(418762..418941)
                     /locus_tag="BAB2_0423"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(418771..418782,418786..418791,
                     418819..418821,418828..418833,418837..418851,
                     418873..418878))
                     /locus_tag="BAB2_0423"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(418363..418737)
                     /locus_tag="BAB2_0423"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            419411..420535
                     /locus_tag="BAB2_0424"
                     /pseudo
                     /db_xref="GeneID:3828065"
     misc_feature    419411..420535
                     /locus_tag="BAB2_0424"
                     /note="uronate isomerase"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12590.1"
     gene            420532..420810
                     /locus_tag="BAB2_0425"
                     /pseudo
                     /db_xref="GeneID:3828066"
     misc_feature    420532..420810
                     /locus_tag="BAB2_0425"
                     /note="glucuronate isomerase, putative"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12591.1"
     gene            420813..422315
                     /locus_tag="BAB2_0426"
                     /db_xref="GeneID:3828067"
     CDS             420813..422315
                     /locus_tag="BAB2_0426"
                     /EC_number="1.1.1.57"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol dehydrogenase"
                     /protein_id="YP_418623.1"
                     /db_xref="GI:83269332"
                     /db_xref="GeneID:3828067"
                     /translation="MMPVRTSEPRLSNRTMSGLPSSVKVPAYDRSRITTGIAHLGIGA
                     FHRAHQTAYTDAVLTSGSNEWGIVGVSLRRPDTRDALQIQDELYTLAIRDGDSEKLQV
                     IGSIQNILVAPEDPQAVLDIMSHPDTRIVSLTITEKGYCRDAAVSGLDRSHPDIIYDL
                     AHPATPRSALGFITEALRRRRAQGTAPFTVLSCDNLPANGETCKNVIVQFAGCTDTDL
                     AHYIEETVAFPSTMVDRIVPATTDEDRISISRTLKVLDQWPITTEPFSQWVIEDRFPT
                     GRPAWEIAGATFVQDVAAFELMKLRLLNGSHSTLAYLGFLAGHRTVSQTMAAPGFKQL
                     IKALMEIEIAPTLPKLEGFDLSSYQAALIHRFENHALHHLTSQIAMDGSQKLPQRLLN
                     TIQERLDGGGSIDRLALGVAAWMRYVTGKDEAGTPIDVRDPLSGQLLDQTQGKFAPDE
                     IMDALLSFRQIFTARLAANELFREKLRLALGSLYAVGSAETVRRYAEIAM"
     misc_feature    420870..422297
                     /locus_tag="BAB2_0426"
                     /note="Mannitol-1-phosphate/altronate dehydrogenases
                     [Carbohydrate transport and metabolism]; Region: MtlD;
                     COG0246"
                     /db_xref="CDD:223324"
     misc_feature    420918..421400
                     /locus_tag="BAB2_0426"
                     /note="Mannitol dehydrogenase Rossmann domain; Region:
                     Mannitol_dh; pfam01232"
                     /db_xref="CDD:144722"
     misc_feature    421482..422228
                     /locus_tag="BAB2_0426"
                     /note="Mannitol dehydrogenase C-terminal domain; Region:
                     Mannitol_dh_C; pfam08125"
                     /db_xref="CDD:149275"
     gene            422475..423656
                     /locus_tag="BAB2_0427"
                     /db_xref="GeneID:3828068"
     CDS             422475..423656
                     /locus_tag="BAB2_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_418624.1"
                     /db_xref="GI:83269333"
                     /db_xref="GeneID:3828068"
                     /translation="MRLTRRQALGGMAALAAFPASRVWAQTKPAMPASPVTLNIVDVA
                     GNLALTQPAFEAYAKANPDKVSKITFTKAPAPELPGKLKAQQAANRLDIDVVLTGTDA
                     LSAGHELGLWVKLLPEYSTSLPDLKTLYQEPAWRMQEAQGKQHGLAIVYYPSGPLLEY
                     MPDKVKTVPRNLDELLVWAKENPNKFLYARPANSGPGRTFLMGLPYMLGDADPKDPMK
                     SWDKTWAYLKELHKYIEYYPTGTGALMKELGEGTRYMTVTTTGWDINPRVLGVVPKEA
                     AVSKLDGFHWVADAQFMAVPKGIGDDKLAVILDLMNYMLTPEAQAVTYDQGYFYPGPV
                     VKDVPITMAPQSSQDAIAEFGRAEYADWIANNPIELPLEPAAMVAAFRRWDEDVASQP
                     K"
     misc_feature    422565..423650
                     /locus_tag="BAB2_0427"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            423734..424786
                     /locus_tag="BAB2_0428"
                     /db_xref="GeneID:3828069"
     CDS             423734..424786
                     /locus_tag="BAB2_0428"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418625.1"
                     /db_xref="GI:83269334"
                     /db_xref="GeneID:3828069"
                     /translation="MPFNEIRLERMSRAFGSHNALKSITLSISKGEFIALLGPSGCGK
                     STALNCIAGLLATTGGGIYIDEKRIDTLKPEDRGFGMVFQNYALFPHMSVRENVGFGL
                     KMRGTPKSEIRKRVDEAIGMVRLNGQEEKLPGQLSGGQQQRVAIARAIVIEPPLVLMD
                     EPLSNLDAKLRLEMRAEIRRIHNQLGSTTIYVTHDQDEALSLADRIVVLRDGEIRQVG
                     VPSDLYERPDHLDVAEFMGYRNRLPGKVTAIDGERATISIGGSLIAGIARVPLAIGQD
                     VVLAARPDDVATGPASPAALQAKVETIEYRGRDFVGTANMSDGHNLVFHASAHAELGS
                     AVSLTVDPNRALIFPA"
     misc_feature    423746..424783
                     /locus_tag="BAB2_0428"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    423749..424444
                     /locus_tag="BAB2_0428"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    423845..423868
                     /locus_tag="BAB2_0428"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(423854..423859,423863..423871,423983..423985,
                     424211..424216,424313..424315)
                     /locus_tag="BAB2_0428"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    423974..423985
                     /locus_tag="BAB2_0428"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    424139..424168
                     /locus_tag="BAB2_0428"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    424199..424216
                     /locus_tag="BAB2_0428"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    424223..424234
                     /locus_tag="BAB2_0428"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    424301..424321
                     /locus_tag="BAB2_0428"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            424795..425694
                     /locus_tag="BAB2_0429"
                     /db_xref="GeneID:3828070"
     CDS             424795..425694
                     /locus_tag="BAB2_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418626.1"
                     /db_xref="GI:83269335"
                     /db_xref="GeneID:3828070"
                     /translation="MTASPAQETMSFRQKMAMKGIDGTTLLALPAVIFLLAVFVYPFL
                     YGLSLSFNPQEGEGIWANYIRFFSDPFLYNTIGTTLCLAIPVTFLSLIIAVPIAFRVR
                     LLRRQRLLTTVLVIPVTLGTVLVAEGLLNYLGPQGWFSRTLMLFGLVDAPLKLTNNYW
                     GVFASLIITGFPFTFLLTLSYVSGIDPALEQAAATHGAKSWQRFRYVLLPLLIPGLAI
                     TFCLSFVLAFAVFPSAILLGAPAGPTRVISIAAYQAAFEQYDYSMAAAIAMIMAAVQL
                     AIVVLVLGIRSLFYRGATSGGKG"
     misc_feature    424849..425640
                     /locus_tag="BAB2_0429"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    425020..425577
                     /locus_tag="BAB2_0429"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(425068..425073,425080..425085,425098..425100,
                     425128..425139,425143..425172,425179..425184,
                     425221..425223,425296..425301,425305..425307,
                     425311..425313,425320..425325,425329..425331,
                     425341..425346,425353..425355,425404..425406,
                     425446..425451,425458..425460,425479..425490,
                     425497..425502,425539..425544,425572..425577)
                     /locus_tag="BAB2_0429"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(425146..425184,425218..425223,425479..425496)
                     /locus_tag="BAB2_0429"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(425221..425223,425281..425283,425497..425499,
                     425533..425535,425542..425544,425572..425574)
                     /locus_tag="BAB2_0429"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(425356..425394,425410..425415,425425..425427)
                     /locus_tag="BAB2_0429"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            425695..426537
                     /locus_tag="BAB2_0430"
                     /db_xref="GeneID:3828071"
     CDS             425695..426537
                     /locus_tag="BAB2_0430"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418627.1"
                     /db_xref="GI:83269336"
                     /db_xref="GeneID:3828071"
                     /translation="MIRDTSTGAKLWIAAVCAVVIFFVINLTAMIATVVLSSFSTRWL
                     GTWLPAGLTTKWYYTAWSEFQLHDVLIVTFQIVFTVVILSGLLGVTAAYAMARRNFPG
                     RNIVMLLFLLPLLVPPITFGIPLATVLYQAGIGGTFWGVVLANLVPTVPFVILVMIPF
                     IEQVDPKVEAAARVFGANTFQLFRYVLLPMLLPGILAALLLVPVRTVAMFELTFLTAG
                     PTSQTLVVALYYSVFASGVRSVQSIDAMAVIYMITTLIWLLLALRFVNPTQIVARAKS
                     QNTN"
     misc_feature    425695..426489
                     /locus_tag="BAB2_0430"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    425902..426459
                     /locus_tag="BAB2_0430"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(425950..425955,425962..425967,425980..425982,
                     426010..426021,426025..426054,426061..426066,
                     426070..426072,426133..426138,426142..426144,
                     426148..426150,426157..426162,426166..426168,
                     426178..426183,426190..426192,426241..426243,
                     426283..426288,426295..426297,426316..426327,
                     426334..426339,426376..426381,426409..426414,
                     426421..426426,426430..426435,426442..426447,
                     426454..426459)
                     /locus_tag="BAB2_0430"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(426028..426072,426316..426333)
                     /locus_tag="BAB2_0430"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(426070..426072,426118..426120,426334..426336,
                     426370..426372,426379..426381,426409..426411)
                     /locus_tag="BAB2_0430"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(426193..426231,426247..426252,426262..426264)
                     /locus_tag="BAB2_0430"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            426615..428159
                     /locus_tag="BAB2_0431"
                     /db_xref="GeneID:3828072"
     CDS             426615..428159
                     /locus_tag="BAB2_0431"
                     /EC_number="4.2.1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="D-galactarate dehydratase/altronate hydrolase"
                     /protein_id="YP_418628.1"
                     /db_xref="GI:83269337"
                     /db_xref="GeneID:3828072"
                     /translation="MKNVVAAAVAPVIILHPSDDVAVARVPVRAGDPIGIDEITAREL
                     IGRGHKVALRAIPAGREVLKYGQVIGVATRDIAPGEHVHLQNLAMLPSEHAHQFSIDI
                     EEHGMVPDAERRHFMGYDRGAGGVGTRNFIGVISSVNCSATVSRYIADYFNRMGGLDG
                     FDNVDGVVALTHGSGCALNTRSEGYRLLTRTIQGYAKHPNFGGVLLIGLGCETNQIAP
                     ILEHYRIEEGSRLRAMTIQQHGGTRKTIDAAIGEIKDMLPMVNAAKRSPQPLSNLKVA
                     LECGGSDGYSGISANPALGYASDLIVRNGGTTVLSETPEIYGAEHLLTRRAVTPAVAE
                     KLLQRIDWWRDYTARNGDELNNNPSYGNKLGGLTTILEKSLGAVAKGGSMPLKAVYEF
                     AETITEQGFVFMDTPGYDPVAVTGQVAGGCNVICFTTGRGSVSGFKPSPCIKIATNSE
                     MYEHMKEDMDINCGGIVTGNETIEEAGARIFDHILAVASGQKTLSEIYDYGDNEFVPW
                     QVGAVT"
     misc_feature    426651..428156
                     /locus_tag="BAB2_0431"
                     /note="galactarate dehydratase; Region: galactar-dH20;
                     TIGR03248"
                     /db_xref="CDD:188300"
     misc_feature    426651..426878
                     /locus_tag="BAB2_0431"
                     /note="Domains similar to fish antifreeze type III
                     protein; Region: SAF_AH_GD; cd11613"
                     /db_xref="CDD:212158"
     misc_feature    426948..428156
                     /locus_tag="BAB2_0431"
                     /note="D-galactarate dehydratase / Altronate hydrolase, C
                     terminus; Region: GD_AH_C; pfam04295"
                     /db_xref="CDD:252510"
     gene            complement(428170..428568)
                     /locus_tag="BAB2_0432"
                     /db_xref="GeneID:3828073"
     CDS             complement(428170..428568)
                     /locus_tag="BAB2_0432"
                     /note="Inhibits transcription at high concentrations of
                     nickel"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel responsive regulator"
                     /protein_id="YP_418629.1"
                     /db_xref="GI:83269338"
                     /db_xref="GeneID:3828073"
                     /translation="MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQQAS
                     LEEGQMEACVGVLSYTYDHSARDLSKKLTNTHHDHHNISVASMHVHLDHDRCLEVSIL
                     KGKTDDVRHFADHVKAERHVTHGTLAVLPL"
     misc_feature    complement(428173..428568)
                     /locus_tag="BAB2_0432"
                     /note="nickel responsive regulator; Provisional; Region:
                     PRK02967"
                     /db_xref="CDD:235093"
     misc_feature    complement(428458..428562)
                     /locus_tag="BAB2_0432"
                     /note="Ribbon-helix-helix protein, copG family; Region:
                     RHH_1; pfam01402"
                     /db_xref="CDD:250592"
     misc_feature    complement(428173..428409)
                     /locus_tag="BAB2_0432"
                     /note="NikR C terminal nickel binding domain; Region:
                     NikR_C; pfam08753"
                     /db_xref="CDD:204052"
     gene            428835..429623
                     /locus_tag="BAB2_0433"
                     /pseudo
                     /db_xref="GeneID:3827144"
     misc_feature    428835..429623
                     /locus_tag="BAB2_0433"
                     /note="Bacterial extracellular solute-binding protein,
                     family 5"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12599.1"
     gene            429610..430416
                     /locus_tag="BAB2_0434"
                     /pseudo
                     /db_xref="GeneID:3827145"
     misc_feature    429610..430416
                     /locus_tag="BAB2_0434"
                     /note="Bacterial extracellular solute-binding protein,
                     family 5"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12600.1"
     gene            430418..431362
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /db_xref="GeneID:3827927"
     CDS             430418..431362
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="with NikACDE is involved in nickel transport into
                     the cell"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter permease NikB"
                     /protein_id="YP_418630.1"
                     /db_xref="GI:83269339"
                     /db_xref="GeneID:3827927"
                     /translation="MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKV
                     PPTPQALESARQMLGLDRAITTQYFDWLGKALHGDFGISFATQRPVLPDLLYFLPATL
                     QLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI
                     QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSE
                     RSVERSHVLRNAWLPIITATGMHIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPV
                     IQCFTLVMVTIFVICNLIVDVVYAWADPRIRLSAEGAE"
     misc_feature    430418..431359
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="nickel transporter permease NikB; Provisional;
                     Region: PRK10352"
                     /db_xref="CDD:182400"
     misc_feature    430709..431287
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(430757..430762,430769..430774,430787..430789,
                     430820..430831,430835..430864,430871..430876,
                     430880..430882,430973..430978,430982..430984,
                     430988..430990,430997..431002,431006..431008,
                     431018..431023,431030..431032,431081..431083,
                     431123..431128,431135..431137,431156..431167,
                     431174..431179,431204..431209,431237..431242,
                     431249..431254,431258..431263,431270..431275,
                     431282..431287)
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(430838..430882,431156..431173)
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(430880..430882,430958..430960,431174..431176,
                     431198..431200,431207..431209,431237..431239)
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(431033..431071,431087..431092,431102..431104)
                     /gene="nikB"
                     /locus_tag="BAB2_0435"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            431359..432231
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /db_xref="GeneID:3827928"
     CDS             431359..432231
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="with NikABDE is involved in nickel transport into
                     the cell"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter permease NikC"
                     /protein_id="YP_418631.1"
                     /db_xref="GI:83269340"
                     /db_xref="GeneID:3827928"
                     /translation="MSDSASMVCASKTGFLSVPRQWPVRLACIIVLLLLVAAVAGPWI
                     TPYNPDDVDLVRRLQSPSLAHWLGTDHLGRDMLSRLIAGVRVSLGSVVITLALTLAMG
                     IVIGGAAGFLGGRADQVIMRITDVFLTFPTLVLALFMVGMLGTGLVNVILAIALSHWA
                     WYARIVRGIVMSLRHREFLLAARMSGAGPVRTFWEHLLPATFSQLVVLATLDVGHIML
                     HVSGLSFLGLGVTPPTAEWGVMINDARQFVWTAPMLILWPGLALFLSVMAFNILGDAL
                     RDSLDPHLKAEHSH"
     misc_feature    431413..432228
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="nickel transporter permease NikC; Provisional;
                     Region: nikC; PRK10417"
                     /db_xref="CDD:236687"
     misc_feature    431611..432126
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(431656..431661,431668..431673,431686..431688,
                     431716..431727,431731..431760,431767..431772,
                     431776..431778,431827..431832,431836..431838,
                     431842..431844,431851..431856,431860..431862,
                     431872..431877,431884..431886,431935..431937,
                     431977..431982,431989..431991,432010..432021,
                     432028..432033,432073..432078,432106..432111,
                     432118..432123)
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(431734..431778,432010..432027)
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(431776..431778,431812..431814,432028..432030,
                     432067..432069,432076..432078,432106..432108)
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(431887..431925,431941..431946,431956..431958)
                     /gene="nikC"
                     /locus_tag="BAB2_0436"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            432228..433016
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /db_xref="GeneID:3827146"
     CDS             432228..433016
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="with NikABCE is involved in nickel transport into
                     the cell"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter ATP-binding protein NikD"
                     /protein_id="YP_418632.1"
                     /db_xref="GI:83269341"
                     /db_xref="GeneID:3827146"
                     /translation="MTRKTLAIEGLTATTVIDGQQRVLVDNLSLGVQRGRILALVGAS
                     GSGKSMTCSAALGVLPPGVTASRGRVTIDGVPYAANALRGRHVATIMQNPRSAFNPVR
                     TMRDHAIETLQALGKLSSNPQDQIVHCMRAAGLEDVKTILSLHPFEMSGGMLQRMMIA
                     LALLSEAPFLFADEPTTDLDLVVQLRVLELLEKLVEERDLGILLVTHDMGVVARLAHD
                     VAVLDHGRLIEQAPVMDIFQTPGHEVTRMLVSAHLSLYGMELNA"
     misc_feature    432231..433013
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="nickel transporter ATP-binding protein NikD;
                     Provisional; Region: nikD; PRK10418"
                     /db_xref="CDD:236688"
     misc_feature    432243..432920
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    432351..432374
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(432360..432365,432369..432377,432501..432503,
                     432744..432749,432846..432848)
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    432492..432503
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    432672..432701
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    432732..432749
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    432756..432767
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    432834..432854
                     /gene="nikD"
                     /locus_tag="BAB2_0437"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            433013..433813
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /db_xref="GeneID:3827147"
     CDS             433013..433813
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /EC_number="3.6.3.24"
                     /note="with NikABCD is involved with nickel transport into
                     the cell"
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter ATP-binding protein NikE"
                     /protein_id="YP_418633.1"
                     /db_xref="GI:83269342"
                     /db_xref="GeneID:3827147"
                     /translation="MSLISADNIVKIYQSHSLVGASARKTMLHDISISIGQGETVALL
                     GRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLDRSGMKAFRREVQLIFQDSPGAV
                     NARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI
                     CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKF
                     AARCLVMDEGQIVEEIKTADLDSMRHPASRLLREAVLPPLPVRAVETN"
     misc_feature    433013..433810
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="nickel transporter ATP-binding protein NikE;
                     Provisional; Region: nikE; PRK10419"
                     /db_xref="CDD:236689"
     misc_feature    433019..433711
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    433145..433168
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(433154..433159,433163..433171,433298..433300,
                     433538..433543,433640..433642)
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    433289..433300
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    433466..433495
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    433526..433543
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    433550..433561
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    433628..433648
                     /gene="nikE"
                     /locus_tag="BAB2_0438"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     gene            complement(433946..435112)
                     /locus_tag="BAB2_0439"
                     /db_xref="GeneID:3827148"
     CDS             complement(433946..435112)
                     /locus_tag="BAB2_0439"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_418634.1"
                     /db_xref="GI:83269343"
                     /db_xref="GeneID:3827148"
                     /translation="MDMHVAVDDYTDIREAVSKLCQRFPGEYWRKIDREMAYPNEFVN
                     ALTEAGWLSILIPEEYGGAGLPLSAAAAVLEEIQKSGCNGGACHAQMYTMGTLLRHGS
                     DEQKACYLPKIASGELRLQAFGVTEPTSGTDTGALKTTARREGDEFIINGQKIWTSRA
                     EYSDLMLLLARTSPLTDGMKKTDGLSVLIVDMAKAKNNGLTIRPIRTMMNHATTEVFF
                     DNLRVPISNLIGEEGKGFRYILSGMNAERILIAAECIGDAKWFTQKSVNYAKERSIFG
                     RPIGQNQGIQFPIAKAYANMRAAELMVQSALALYEAGQNPGAEANMAKMLAADASFEA
                     ANACVQTHGGFGFAEEYDVERKFRETRLYQVAPISTNLILSYIAEHVLGMPRSY"
     misc_feature    complement(433949..435091)
                     /locus_tag="BAB2_0439"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    complement(433964..435091)
                     /locus_tag="BAB2_0439"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(434000..434002,434006..434008,
                     434012..434020,434639..434641,434645..434647,
                     434738..434740,434744..434746,434840..434842))
                     /locus_tag="BAB2_0439"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(435429..436148)
                     /locus_tag="BAB2_0440"
                     /pseudo
                     /db_xref="GeneID:3827149"
     misc_feature    complement(435429..436148)
                     /locus_tag="BAB2_0440"
                     /note="transcriptional regulatory protein, lysR family"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12606.1"
     gene            436596..436874
                     /locus_tag="BAB2_0441"
                     /db_xref="GeneID:3827150"
     CDS             436596..436874
                     /locus_tag="BAB2_0441"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418635.1"
                     /db_xref="GI:83269344"
                     /db_xref="GeneID:3827150"
                     /translation="MPFFELVAPLIMANSTVLKLRQGAMSMDDFPSRTNQMQRNAMPR
                     RKEQTKATFTTATSKSVARTCEFLTFTETSKYASFGRNWIDHYTGGGK"
     gene            437049..438842
                     /locus_tag="BAB2_0442"
                     /db_xref="GeneID:3827151"
     CDS             437049..438842
                     /locus_tag="BAB2_0442"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter family protein"
                     /protein_id="YP_418636.1"
                     /db_xref="GI:83269345"
                     /db_xref="GeneID:3827151"
                     /translation="MPSYRAPVEDTNFVLNDVLNYQRYNNLPGFAEAAPDVVEAILSE
                     GAKLAEGTLFPVNQTADREGCTRHADGSVTTPKGYKEAYNLYREGGWLGLAVPEQYGG
                     QGLPYLLHTAVGEYMSSANMALTMYPGLTQGAIAAILTHGTDEQKDTYLPKMVEGTWT
                     GTMNLTEPHCGTDLGLLRTSAAPQADGTYKISGQKIFISAGEHDMSENIIHLVLARIE
                     GAPEGVKGISLFIVPKSILDENGNPGTRNGVSCGSIEEKMGIHGNATCVMNYDEATGY
                     LIGEANKGLRAMFTMMNEARLGVALQGLSIAETAYQNAVIYARERIQGRALSGAVAPE
                     KKADPIIVHPDIRRNLMNIRAFNEAGRALILWIALHSDIAHRSGDEAERQAADDLVGL
                     LTPVLKGVLTDKGFEHAVMAQQVFGGHGYIEEQGMSQYVRDARIAMIYEGANGIQALD
                     LVGRKLALNGGRAITAFFKEVGEFCETNRENEKLSFFTKYLKKGVNDLQAATMWLMQN
                     AMAKPDNAGAASNDYMHLFGLVALGYMWARMAKVAEEKLAAGEGNKAFFEAKLVTARY
                     YFERIMPESVTHLARIQSGADSMMALNAGTF"
     misc_feature    437052..437147
                     /locus_tag="BAB2_0442"
                     /note="Acyl-CoA dehydrogenase N terminal; Region:
                     AcylCoA_DH_N; pfam12418"
                     /db_xref="CDD:257037"
     misc_feature    437058..438839
                     /locus_tag="BAB2_0442"
                     /note="acyl-CoA dehydrogenase; Provisional; Region:
                     PTZ00456"
                     /db_xref="CDD:185635"
     misc_feature    437169..438416
                     /locus_tag="BAB2_0442"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(437445..437447,437535..437537,437541..437543,
                     437637..437639,437643..437645,438363..438371,
                     438375..438377,438381..438383)
                     /locus_tag="BAB2_0442"
                     /note="active site"
                     /db_xref="CDD:173838"
     misc_feature    438444..438824
                     /locus_tag="BAB2_0442"
                     /note="Acetyl-CoA dehydrogenase C-terminal like; Region:
                     Acyl-CoA_dh_C; pfam12806"
                     /db_xref="CDD:257313"
     gene            438907..440115
                     /locus_tag="BAB2_0443"
                     /db_xref="GeneID:3827152"
     CDS             438907..440115
                     /locus_tag="BAB2_0443"
                     /EC_number="2.3.1.9"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="YP_418637.1"
                     /db_xref="GI:83269346"
                     /db_xref="GeneID:3827152"
                     /translation="MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNG
                     IDTAKVDDIIFGCVDPVGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAA
                     AKVAFGSDDLVIAGGVESMSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYG
                     FSRDDVDAYAVESQKRAANSWEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALG
                     QLSPSFVMPGEMGGFNAVGIQAHPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKA
                     FDIKPRARIRAFANIGSEPALMLTGPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVL
                     RYMQAFDIPHDKINVNGGAIAMGHPLGATGAMILGTVLDELERRNLNTALVTLCIGAG
                     MGTATIIERV"
     misc_feature    438907..440112
                     /locus_tag="BAB2_0443"
                     /note="acetyl-CoA acetyltransferase; Validated; Region:
                     PRK08242"
                     /db_xref="CDD:236197"
     misc_feature    438919..440109
                     /locus_tag="BAB2_0443"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    order(438979..438981,439060..439062,439105..439107,
                     439114..439116,439126..439128,439159..439170,
                     439192..439194,439213..439218,439225..439227,
                     439270..439272,439768..439770,439774..439776,
                     439780..439782,439840..439842,440077..440082)
                     /locus_tag="BAB2_0443"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    order(439177..439179,439978..439980,440068..440070)
                     /locus_tag="BAB2_0443"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            440131..442347
                     /locus_tag="BAB2_0444"
                     /db_xref="GeneID:3827153"
     CDS             440131..442347
                     /locus_tag="BAB2_0444"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty oxidation complex subunit alpha"
                     /protein_id="YP_418638.1"
                     /db_xref="GI:83269347"
                     /db_xref="GeneID:3827153"
                     /translation="MAYVNFKVETDADGIALITWDMPEKSMNVFTVDAMQELNAIIDA
                     VIADDKIKGVVITSGKETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMS
                     GLFRKLETCGKPWVSAINGTCMGGAFEMSLACHARAASDAPGVKMALPEVKVGLFPGA
                     GGTQRVPRLANQQDALQMMTTGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLK
                     PVQPWDEKGFKLPGGAIYSAAGANLWPAATAILRRETSGNYPAALAILKSVYEGLLVP
                     FDTGLKIEQRYFTEILQTTEAGMMIRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGA
                     GFMGAGIAYVTAKAGIPVVLIDRDQESADKGKAHTADLITKEMQKGRATEADKEKLLS
                     LITATPDYAQLEGADLVIEAVFEDREVKRVATEKAEEVLKSSAVFASNTSTLPITGLA
                     KVSKRPKNFIGIHFFSPVDKMMLVEVILGKKTSDKALAVALDYVRAIKKTPIVVNDTR
                     GFYVNRCVLRYMSEAYNMLVEGVPAAMIENAARMAGMPVGPLALNDETAIDLSQKILK
                     ATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNGKGFYDYPAKPAKKHLWPGLKDLYP
                     QQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDPREADVGSILAFGFAPYTGGTLS
                     YIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENGETFHQRFNPYKGETKKAA"
     misc_feature    440146..442302
                     /locus_tag="BAB2_0444"
                     /note="multifunctional fatty acid oxidation complex
                     subunit alpha; Reviewed; Region: fadJ; PRK11154"
                     /db_xref="CDD:236864"
     misc_feature    440146..440772
                     /locus_tag="BAB2_0444"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(440209..440211,440215..440217,440311..440313,
                     440323..440337,440494..440496,440500..440508,
                     440578..440583,440590..440592)
                     /locus_tag="BAB2_0444"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(440329..440331,440506..440508)
                     /locus_tag="BAB2_0444"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(440446..440448,440470..440472,440533..440544,
                     440584..440595,440611..440613,440617..440625,
                     440629..440634,440647..440652,440656..440661,
                     440665..440670,440677..440679,440710..440712,
                     440719..440721,440764..440766)
                     /locus_tag="BAB2_0444"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    441112..441651
                     /locus_tag="BAB2_0444"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    441655..441948
                     /locus_tag="BAB2_0444"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            442585..443241
                     /locus_tag="BAB2_0445"
                     /db_xref="GeneID:3827154"
     CDS             442585..443241
                     /locus_tag="BAB2_0445"
                     /codon_start=1
                     /transl_table=11
                     /product="S24 family peptidase"
                     /protein_id="YP_418639.1"
                     /db_xref="GI:83269348"
                     /db_xref="GeneID:3827154"
                     /translation="MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAA
                     DGRARWPSTESLAKVMEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEA
                     GAGGYFDDAGFPAGQGWDIVEFPARTGEGVYALEVSGESMLPLYRDGDTLIVAPNAAV
                     RRGDRVVVRTRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ
                     "
     misc_feature    442585..443238
                     /locus_tag="BAB2_0445"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2932"
                     /db_xref="CDD:225484"
     misc_feature    442981..443223
                     /locus_tag="BAB2_0445"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    order(443005..443007,443116..443118)
                     /locus_tag="BAB2_0445"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            443242..444201
                     /locus_tag="BAB2_0446"
                     /db_xref="GeneID:3827155"
     CDS             443242..444201
                     /locus_tag="BAB2_0446"
                     /codon_start=1
                     /transl_table=11
                     /product="proline-rich extensin"
                     /protein_id="YP_418640.1"
                     /db_xref="GI:83269349"
                     /db_xref="GeneID:3827155"
                     /translation="MMQRREKSHAHFVFGSLACLTGAVLIAAFVAPFYGALDRRVVVI
                     DSGSAEKSDKGAKNGIVVEQFDYNEPETAPELDTAQQAVPQPSQSAPAEGQPPAWKEN
                     GKANDHVNDTGMEREAPRPPLSDLGLASTPKPPEPQPPATSVDAGEQMQLLQRPVAVA
                     AGRLESQGRTIELQGIEIVPVEQTCETASGESWPCGMQARTAFRQWLRSRAVMCRLPE
                     NDSGAAVSTKCMLGNEDAAAWLVANGWAKAVPGGTYDEAGRKAVEAHLGIFGDKPDTS
                     LLNPESDSGNMLDNPSPLAPEQEPQPSSPSLQQGDFPPAPAAQ"
     misc_feature    443521..444132
                     /locus_tag="BAB2_0446"
                     /note="Micrococcal nuclease (thermonuclease) homologs [DNA
                     replication, recombination, and repair]; Region: COG1525"
                     /db_xref="CDD:224442"
     gene            complement(444289..445944)
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /db_xref="GeneID:3827156"
     CDS             complement(444289..445944)
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /EC_number="6.1.1.6"
                     /note="class I; LysRS1; catalyzes a two-step reaction,
                     first charging a lysine molecule by linking its carboxyl
                     group to the alpha-phosphate of ATP, followed by transfer
                     of the aminoacyl-adenylate to its tRNA; in Methanosarcina
                     barkeri this enzyme charges both tRNA molecules for lysine
                     that exist in this organism (but the tRNALysUUU very
                     poorly) and in the presence of LysRS2 can charge tRNAPyl
                     with lysine"
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="YP_418641.1"
                     /db_xref="GI:83269350"
                     /db_xref="GeneID:3827156"
                     /translation="MTSHRLPEITLTPELTAAAAEAKAWPFEEARKILKRYAKTGLPE
                     TVIFETGYGPSGLPHIGTFGEVARTSMVRHAFRILTQDKVKTRLICFSDDLDGMRKVP
                     DNVPDRAALEPYLQMPLSSVPNPFGGDYKSFAEHNNAMLCRFLDTFGFDYEFASATEY
                     YRSGRFDTVLLKAVERYDDIMKVMLPTLGEERQATYSPFLPISPKSGRVLYVPMKKVD
                     AKAGTITFDDEDGEETTLSVTGGKVKLQWKPDFGMRWAALGVDFEMFGKDHQTNAGIY
                     DRICEILGGRAPEHFVYELFLDQLGQKISKSKGNGISIDEWLAYAPTESLALYNFQKP
                     KTAKKLYFDVIPKTVDEYFTYLSAYARQEWKDRLNNPVWHIHYGNPPKADLPVTFALM
                     LNLVSASNAESPAVLWGFISRHVPGVTPENNPELDALVGYAIRYFNDFVKPTKKFRAP
                     DDVERAALEALDAKLGELPAGTDGNVIQNAILDVARAIERYQDHTKKSPEGGPGVSVS
                     FFQMLYEVLIGQERGPRFGSFVALYGIDETRALIKKALAGELA"
     misc_feature    complement(444304..445872)
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /note="lysyl-tRNA synthetase; Reviewed; Region: lysK;
                     PRK00750"
                     /db_xref="CDD:234829"
     misc_feature    complement(444817..445872)
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    complement(order(445021..445032,445759..445770))
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    complement(order(445027..445029,445759..445761,
                     445768..445770))
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    complement(445759..445770)
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    complement(445021..445032)
                     /gene="lysK"
                     /locus_tag="BAB2_0447"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     gene            446139..446549
                     /locus_tag="BAB2_0448"
                     /db_xref="GeneID:3827157"
     CDS             446139..446549
                     /locus_tag="BAB2_0448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418642.1"
                     /db_xref="GI:83269351"
                     /db_xref="GeneID:3827157"
                     /translation="MKQITPQEALVYIMITTSAADTSMTDAELSSIGNVVSRLPVFQG
                     FDRDRLPKLASDCYALLAYEDGLERILDLAHEALPERLYDTAYALAVEVAAADLHVEQ
                     EELEFLQMLRDRWTLDELTVAAIERSARVRFRKL"
     misc_feature    446154..446489
                     /locus_tag="BAB2_0448"
                     /note="tellurite resistance protein terB; Region: terB;
                     cd07176"
                     /db_xref="CDD:143580"
     misc_feature    order(446199..446201,446220..446222,446427..446429,
                     446448..446450)
                     /locus_tag="BAB2_0448"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:143580"
     gene            complement(446611..447270)
                     /locus_tag="BAB2_0449"
                     /db_xref="GeneID:3827158"
     CDS             complement(446611..447270)
                     /locus_tag="BAB2_0449"
                     /EC_number="4.2.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="YP_418643.1"
                     /db_xref="GI:83269352"
                     /db_xref="GeneID:3827158"
                     /translation="MPMKNDHSPDQRTLSELFEHNRQWAAEKQEKDPEYFSRLSSSQR
                     PEFLWIGCSDSRVPANVVTGLQPGEVFVHRNGANLVHRADLNLLSVLEFAVGVLEIKH
                     IIVCGHYGCGGVRAAMDGYGHGIIDNWLQPIRDIAQANQAELDTIENTQDRLDRLCEL
                     SVSSQVESLSRTPVLQSAWKDGKDIIVHGWMYNLKDGLLRDIGCDCTRNALQFACQPA
                     E"
     misc_feature    complement(446665..447210)
                     /locus_tag="BAB2_0449"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeA; cd00883"
                     /db_xref="CDD:238448"
     misc_feature    complement(order(446695..446697,446938..446940,
                     446947..446949,446977..446979,446992..446994,
                     447058..447060,447067..447069,447103..447111,
                     447115..447117,447136..447138,447142..447144))
                     /locus_tag="BAB2_0449"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238448"
     misc_feature    complement(order(446938..446940,446947..446949,
                     447109..447111,447115..447117))
                     /locus_tag="BAB2_0449"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238448"
     misc_feature    complement(order(446674..446676,446680..446682,
                     446686..446691,446695..446697,446884..446886,
                     446992..446997,447004..447009,447049..447051,
                     447055..447057,447061..447069,447082..447084,
                     447088..447093,447097..447099,447103..447114))
                     /locus_tag="BAB2_0449"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238448"
     gene            complement(447419..447763)
                     /locus_tag="BAB2_0450"
                     /db_xref="GeneID:3827159"
     CDS             complement(447419..447763)
                     /locus_tag="BAB2_0450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418644.1"
                     /db_xref="GI:83269353"
                     /db_xref="GeneID:3827159"
                     /translation="MSSLLPPLHDGHAPIYLHHAFHEAVDACEDWPLDSAEPVVQVNG
                     KITRISVVFRRLWNCTDTVPRDTLEALKEIVPSTLVRSERWRDNSTFAEAARVMRSVL
                     EMRKARALPAYY"
     misc_feature    complement(<447473..>447763)
                     /locus_tag="BAB2_0450"
                     /note="Eukaryotic translation initiation factor 3 subunit
                     8 N-terminus; Region: eIF-3c_N; pfam05470"
                     /db_xref="CDD:253208"
     gene            448118..449731
                     /locus_tag="BAB2_0451"
                     /db_xref="GeneID:3827160"
     CDS             448118..449731
                     /locus_tag="BAB2_0451"
                     /codon_start=1
                     /transl_table=11
                     /product="solute-binding family 5 protein"
                     /protein_id="YP_418645.1"
                     /db_xref="GI:83269354"
                     /db_xref="GeneID:3827160"
                     /translation="MSGFVASRRAFLVGSTSLAALAFWPKATWAAQEVQKGGRLVVAA
                     DSEPRNLNPAIIASNGVFFVASKVIEPLAEAAYEGQGGLAPRLATSWEGSADGLTATF
                     RLREGVNWHDGKPFTSADVAFSAMEVWKPLQNLGRVVFKSLEKVETPDEHTAIFHFSE
                     PTPFQLIRNALPALTAVLPKHVFAGTDIAANPANEKLAGTGPFKYAEHKTGEYYRLVK
                     NADYWGEGEPYLDEVIYRVLPDRAAAADALEAGEIDLAAFSAVPLADLDRISKVPGLA
                     VISKGYEGLTYQLVVEINHRRKELADLKVRQAIAHAIDRDFVVKTIFQGFAVPSTGPV
                     PRYDSQFYTDDVPTYPFDVKKANALLDEAGYRRGKDGMRFALKLLPAPYFNETKQFGD
                     YLRQALAAIGIDAHIVNNDAAAHQKAVYTDHDFDLAIAPTVYRGDPAISTTILVESGI
                     PAGVPFSNQGGYANAELDALIAKAASTTDEKERTALYQKFQQMVEADLPLINVAEWGF
                     ITVASERVKNVSNNPRWAVSNWADTWLEP"
     misc_feature    448136..449725
                     /locus_tag="BAB2_0451"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    448226..449674
                     /locus_tag="BAB2_0451"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_13; cd08517"
                     /db_xref="CDD:173882"
     gene            449749..450747
                     /locus_tag="BAB2_0452"
                     /db_xref="GeneID:3827161"
     CDS             449749..450747
                     /locus_tag="BAB2_0452"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418646.1"
                     /db_xref="GI:83269355"
                     /db_xref="GeneID:3827161"
                     /translation="MYLADVKQILALLRKRLVGSMVVLLIVVIGCFFMLESAPGDAVD
                     AYGVTFGGDAGQIAEMRARWGLDQSVWHRLGAYLAALAQGNLGWSVSFNRPIFDVISE
                     RLPNTLLLMGAATALSFAVGSFLGVVAGARPGSFRDRFLSVASLVLYAVPGFWLALVL
                     VILFSIKLRWLPSSGIETIASGKHGLARASDIARHLILPVVSLAVIYLALYLRVMRAA
                     MADIWRMDFVRALRARGISRPRIVLFHVARNALLPLVTVLGVQAASMLGGSVVIESVF
                     AVPGLGRLAQEAVASRDTPLLLGVIITSALMVILVNFVIDLVYLWLDPRIAAGGRA"
     misc_feature    449776..450726
                     /locus_tag="BAB2_0452"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    450058..450678
                     /locus_tag="BAB2_0452"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(450106..450111,450118..450123,450139..450141,
                     450169..450180,450184..450213,450220..450225,
                     450229..450231,450364..450369,450373..450375,
                     450379..450381,450388..450393,450397..450399,
                     450409..450414,450421..450423,450472..450474,
                     450514..450519,450526..450528,450547..450558,
                     450565..450570,450595..450600,450628..450633,
                     450640..450645,450649..450654,450661..450666,
                     450673..450678)
                     /locus_tag="BAB2_0452"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(450187..450231,450547..450564)
                     /locus_tag="BAB2_0452"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(450229..450231,450349..450351,450565..450567,
                     450589..450591,450598..450600,450628..450630)
                     /locus_tag="BAB2_0452"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(450424..450462,450478..450483,450493..450495)
                     /locus_tag="BAB2_0452"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            450744..451574
                     /locus_tag="BAB2_0453"
                     /db_xref="GeneID:3827162"
     CDS             450744..451574
                     /locus_tag="BAB2_0453"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418647.1"
                     /db_xref="GI:83269356"
                     /db_xref="GeneID:3827162"
                     /translation="MSGLKRYFATGEGMAGAAILVLLILAALCAPLFFPGDPLSIVST
                     PLMQPFENGDFLFGTDRLGRDVLAELFYGARTSLLVGLAAAFAAIVLGSIVGTLAGFA
                     GGFIDEALMRVAEAFQTVPGFLLALALVSIAGPSLPVLIAAIALSSWTQATRLTRAQV
                     LSIRESDYVAAARVIGMHPLEIAFRQILPNALPPVLALVPVIVASAILTEAALSFLGL
                     GDPNRVTWGGMIAEGRTVLRSAPWLSILPGAALALTVVGVYLAGEGLTEAMSRREAQP
                     "
     misc_feature    450756..451559
                     /locus_tag="BAB2_0453"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    450963..451481
                     /locus_tag="BAB2_0453"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(451011..451016,451023..451028,451041..451043,
                     451071..451082,451086..451115,451122..451127,
                     451131..451133,451182..451187,451191..451193,
                     451197..451199,451206..451211,451215..451217,
                     451227..451232,451239..451241,451290..451292,
                     451332..451337,451344..451346,451365..451376,
                     451383..451388,451425..451430,451458..451463,
                     451470..451475,451479..451481)
                     /locus_tag="BAB2_0453"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(451089..451133,451365..451382)
                     /locus_tag="BAB2_0453"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(451131..451133,451167..451169,451383..451385,
                     451419..451421,451428..451430,451458..451460)
                     /locus_tag="BAB2_0453"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(451242..451280,451296..451301,451311..451313)
                     /locus_tag="BAB2_0453"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            451571..452326
                     /locus_tag="BAB2_0454"
                     /db_xref="GeneID:3827163"
     CDS             451571..452326
                     /locus_tag="BAB2_0454"
                     /codon_start=1
                     /transl_table=11
                     /product="uridine kinase"
                     /protein_id="YP_418648.1"
                     /db_xref="GI:83269357"
                     /db_xref="GeneID:3827163"
                     /translation="MSKLVRLEKLSVRYGREMALQNIDLDIASGEILAVIGESGSGKS
                     TLALALASLLPAGAHVTGGMEWAAGRLQPGRDIGFIFQDPASSFDPLMTVGAQLVETI
                     RAHENSGRGQARAKAIALLERVHIPAPDESFHRYPHQFSGGQKQRIAVALAIAANSRL
                     LIADEPTSALDTIVQKEITALLQRLVREDGMTLVFITHDIALASGLADRIAVFRHGRL
                     IETGSAAFIVAKPQTDYTKALIAAVPDLEAVHG"
     misc_feature    451574..452317
                     /locus_tag="BAB2_0454"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    451580..452236
                     /locus_tag="BAB2_0454"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    451679..451702
                     /locus_tag="BAB2_0454"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(451688..451693,451697..451705,451814..451816,
                     452060..452065,452162..452164)
                     /locus_tag="BAB2_0454"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    451805..451816
                     /locus_tag="BAB2_0454"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    451988..452017
                     /locus_tag="BAB2_0454"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    452048..452065
                     /locus_tag="BAB2_0454"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    452072..452083
                     /locus_tag="BAB2_0454"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    452150..452170
                     /locus_tag="BAB2_0454"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     gene            452319..453071
                     /locus_tag="BAB2_0455"
                     /db_xref="GeneID:3827899"
     CDS             452319..453071
                     /locus_tag="BAB2_0455"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418649.1"
                     /db_xref="GI:83269358"
                     /db_xref="GeneID:3827899"
                     /translation="MAEPLLQARNLVFRYGGNLALNDVSFDMASGETLALVGPSGSGK
                     SMLARALLRLHPLASGAIRFEGENWLALSGSALRRRRAHMQLVFQDPLSAFNPRASLR
                     DLLYEPLRIHGIKRDIGELLQKVGLDSALAQRGVHEVSGGQRQRVAIARALATSPSLI
                     VLDEAVSALDVTVRGAILKLLREVQKAENTAYLFITHDLGVAAQMADRIAVMEHGRIV
                     ECRPTQELIATPHAPITRALIEAVPRLERFRF"
     misc_feature    452328..453059
                     /locus_tag="BAB2_0455"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    452331..452975
                     /locus_tag="BAB2_0455"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    452430..452453
                     /locus_tag="BAB2_0455"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(452439..452444,452448..452456,452583..452585,
                     452805..452810,452907..452909)
                     /locus_tag="BAB2_0455"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    452574..452585
                     /locus_tag="BAB2_0455"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    452733..452762
                     /locus_tag="BAB2_0455"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    452793..452810
                     /locus_tag="BAB2_0455"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    452817..452828
                     /locus_tag="BAB2_0455"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    452895..452915
                     /locus_tag="BAB2_0455"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    452970..>453056
                     /locus_tag="BAB2_0455"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(453161..453976)
                     /gene="proC"
                     /locus_tag="BAB2_0456"
                     /db_xref="GeneID:3828054"
     CDS             complement(453161..453976)
                     /gene="proC"
                     /locus_tag="BAB2_0456"
                     /EC_number="1.5.1.2"
                     /note="catalyzes the formation of L-proline from
                     pyrroline-5-carboxylate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="YP_418650.1"
                     /db_xref="GI:83269359"
                     /db_xref="GeneID:3828054"
                     /translation="MQDKVVLVGCGNMGFAMLRGWLDSGILKAGDFHVVEPAEALRER
                     AALAHVHVYADAADLPADLQPRMVLVAVKPQMMANVLPTYKRFAPASTFVSVAAGIPV
                     ALFESHLGKDVAVIRCMPNTPAAIGKGMLVTFKNANVSDANEAFVTSLLKTSGKVASV
                     DEEGLMDAVTAVSGSGPAYIFHFIEALTDAGVNLGLPRETAALLAMQTVMGAGALADA
                     STDSPSKLREQVTSPNGTTAAALDVLMGGDRLKELVAEAVKAAHKRSVELGKS"
     misc_feature    complement(453164..453976)
                     /gene="proC"
                     /locus_tag="BAB2_0456"
                     /note="pyrroline-5-carboxylate reductase; Reviewed;
                     Region: PRK11880"
                     /db_xref="CDD:237008"
     misc_feature    complement(453680..453967)
                     /gene="proC"
                     /locus_tag="BAB2_0456"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; cl19126"
                     /db_xref="CDD:267479"
     misc_feature    complement(453173..453496)
                     /gene="proC"
                     /locus_tag="BAB2_0456"
                     /note="Pyrroline-5-carboxylate reductase dimerization;
                     Region: P5CR_dimer; pfam14748"
                     /db_xref="CDD:258885"
     gene            454297..455196
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /db_xref="GeneID:3828226"
     CDS             454297..455196
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /EC_number="1.5.1.5"
                     /note="catalyzes the formation of
                     5,10-methenyltetrahydrofolate from
                     5,10-methylenetetrahydrofolate and subsequent formation of
                     10-formyltetrahydrofolate from
                     5,10-methenyltetrahydrofolate"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 5,10-methylene-tetrahydrofolate
                     dehydrogenase/ 5,10-methylene-tetrahydrofolate
                     cyclohydrolase"
                     /protein_id="YP_418651.1"
                     /db_xref="GI:83269360"
                     /db_xref="GeneID:3828226"
                     /translation="MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDP
                     ASQVYVASKSRKAKECGFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPG
                     HIDSGRVIQTIAPEKDVDGFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLS
                     GLNAVVIGRSNIVGKPMFNLLLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMV
                     KGDWVKPGATVIDVGINRIPAPERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMT
                     IAMLMANTLTAACRSAGMKKPVF"
     misc_feature    454297..455193
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /note="bifunctional 5,10-methylene-tetrahydrofolate
                     dehydrogenase/ 5,10-methylene-tetrahydrofolate
                     cyclohydrolase; Provisional; Region: PRK14188"
                     /db_xref="CDD:184558"
     misc_feature    454303..454656
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /note="Tetrahydrofolate dehydrogenase/cyclohydrolase,
                     catalytic domain; Region: THF_DHG_CYH; pfam00763"
                     /db_xref="CDD:250116"
     misc_feature    454639..455160
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /note="NADP binding domain of methylene-tetrahydrofolate
                     dehydrogenase/cyclohydrolase; Region:
                     NAD_bind_m-THF_DH_Cyclohyd; cd01080"
                     /db_xref="CDD:133448"
     misc_feature    order(454666..454671,454678..454680,454777..454779,
                     454783..454785,454801..454803,454828..454833,
                     454840..454842,454849..454866,454870..454872,
                     454876..454881,454906..454908)
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:133448"
     misc_feature    order(454723..454725,454801..454806,454870..454875,
                     454930..454932,454936..454938,454945..454947,
                     454990..454992,454996..454998,455113..455115,
                     455122..455124)
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:133448"
     misc_feature    order(455101..455106,455125..455127)
                     /gene="folD"
                     /locus_tag="BAB2_0457"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133448"
     gene            complement(455288..457111)
                     /locus_tag="BAB2_0458"
                     /db_xref="GeneID:3827900"
     CDS             complement(455288..457111)
                     /locus_tag="BAB2_0458"
                     /EC_number="4.2.1.12"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-6-phospho-D-gluconate from
                     6-phospho-D-gluconate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphogluconate dehydratase"
                     /protein_id="YP_418652.1"
                     /db_xref="GI:83269361"
                     /db_xref="GeneID:3827900"
                     /translation="MSTETAHKRIQEITERIRERSKPTREAYLDRVREAASNKPKRSF
                     LGCANLAHGFAACGPHDKAALTADVVPNLGIITAYNDMLSAHQPFETFPQLIKQAARE
                     AGGVAQVAGGVPAMCDGVTQGFAGMELSLFSREVIAMATAVGLSHDMFDAAVYLGVCD
                     KIVPGLIVGALTFGHLPPVFIPAGPMTSGLPNDEKAKTRQLYAEGKAGRAELLESESK
                     SYHGPGTCTFYGTANSNQMLMEIMGLHLPGASFINPGTPLRDALTREAAKRALAITAL
                     GNEYTPVGEMIDERSIVNGVVGLNATGGSTNHTIHLIAMAAAAGIKLTWHDISQISDV
                     VPLLARVYPNGLADVNHFHAAGGMGFLIRELLDGGLLHEDVRTVWGEGLRPYAIEPKL
                     GPDGNVVREAAPEKSGDDKVLAKIAAPFQPTGGIKVLSGNIGNAIIKVSAVKPERHVI
                     EAPAKVFNDQAELQAAFKAGDLTGDFIAVVRYQGPKANGMPELHKLMTVLGILQDRGQ
                     RVALVTDGRLSGASGKVPSAIHVTPEALDGGMVGKIRTGDIIRLDAINGTLEVLLNQA
                     VLDSRIEERPDLSGNEYGTGRELFRAFRQIAGRADEGASVF"
     misc_feature    complement(455291..457093)
                     /locus_tag="BAB2_0458"
                     /note="phosphogluconate dehydratase; Validated; Region:
                     PRK09054"
                     /db_xref="CDD:181628"
     gene            complement(457147..457845)
                     /gene="pgl"
                     /locus_tag="BAB2_0459"
                     /db_xref="GeneID:3828045"
     CDS             complement(457147..457845)
                     /gene="pgl"
                     /locus_tag="BAB2_0459"
                     /EC_number="3.1.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="YP_418653.1"
                     /db_xref="GI:83269362"
                     /db_xref="GeneID:3828045"
                     /translation="MSIERHDFISATELAQSLSEAIANKLATAIAERGQAVLAVSGGT
                     TPLKLFEVLSRKMIDWNLVTITLVDERFVPVENERSNEKLVRDHLLRDHAGVARFVGL
                     YNPAATAETAALAAASRIDALRRPFDVVVLGMGNDGHTASFFPNADRLDQAINPATRA
                     LVLPIHAEGAGEKRLTLTLPLIAEAEMLVLHIEGAAKQATLEKALAGDDEREMPVRAV
                     FHHARAPIQLYWAS"
     misc_feature    complement(457153..457809)
                     /gene="pgl"
                     /locus_tag="BAB2_0459"
                     /note="6PGL: 6-Phosphogluconolactonase (6PGL) subfamily;
                     6PGL catalyzes the second step of the oxidative phase of
                     the pentose phosphate pathway, the hydrolyzation of
                     6-phosphoglucono-1,5-lactone (delta form) to
                     6-phosphogluconate. 6PGL is thought to guard...; Region:
                     6PGL; cd01400"
                     /db_xref="CDD:238694"
     misc_feature    complement(order(457255..457257,457324..457326,
                     457429..457431,457633..457635,457711..457716))
                     /gene="pgl"
                     /locus_tag="BAB2_0459"
                     /note="putative active site [active]"
                     /db_xref="CDD:238694"
     gene            complement(457974..459449)
                     /locus_tag="BAB2_0460"
                     /db_xref="GeneID:3827901"
     CDS             complement(457974..459449)
                     /locus_tag="BAB2_0460"
                     /EC_number="1.1.1.49"
                     /note="catalyzes the formation of D-glucono-1,5-lactone
                     6-phosphate from D-glucose 6-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="YP_418654.1"
                     /db_xref="GI:83269363"
                     /db_xref="GeneID:3827901"
                     /translation="MTSQTIPVDPFDCIVFGGTGDLAERKLIPALYQRQRAGQLSDPT
                     RIIGASRSQMTDDEYRTFAGNAIKEHVKPEEVDQAEVEIFLKRLHYVAVDAKSDEGWD
                     ALKTLIGKKPEKIRAFYLAVSPTLFGDIATRLKAHGLITRDTRIVVEKPIGRDLDSAK
                     ALNDTLGSVFREDQIFRIDHYLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAE
                     AVGLEGRAGYYDKAGALRDMVQNHILQLLCLVAMEPPSSIEADAVHDEKVKVLRSLQP
                     ISTHNVEELTVRGQYRAGASAGGPVKGYLEDLESDTSNTETFVALKAEIANWRWAGVP
                     FYLRTGKRLATRVSEIVVTFKPIPHSIFGESAGKVIANQLVIRLQPDEGVKQWLMIKD
                     PGPGGMRLRHMPLDMSFAESFEDRNPDAYERLIMDVVRGNQTLFMRRDEVEAAWRWID
                     PILQAWEFNSQPVQGYTAGTWGPSSSIALIERDGRTWHESL"
     misc_feature    complement(457983..459443)
                     /locus_tag="BAB2_0460"
                     /note="glucose-6-phosphate 1-dehydrogenase; Validated;
                     Region: PRK05722"
                     /db_xref="CDD:235579"
     misc_feature    complement(458883..459410)
                     /locus_tag="BAB2_0460"
                     /note="Glucose-6-phosphate dehydrogenase, NAD binding
                     domain; Region: G6PD_N; pfam00479"
                     /db_xref="CDD:249890"
     misc_feature    complement(457980..458879)
                     /locus_tag="BAB2_0460"
                     /note="Glucose-6-phosphate dehydrogenase, C-terminal
                     domain; Region: G6PD_C; pfam02781"
                     /db_xref="CDD:251528"
     gene            459720..460469
                     /gene="fabG"
                     /locus_tag="BAB2_0461"
                     /db_xref="GeneID:3827902"
     CDS             459720..460469
                     /gene="fabG"
                     /locus_tag="BAB2_0461"
                     /EC_number="1.1.1.100"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="YP_418655.1"
                     /db_xref="GI:83269364"
                     /db_xref="GeneID:3827902"
                     /translation="MNRLQDKVAIITGAGSGFGLGMARRFAAEGARVVLADVNVKRVE
                     DGLADISSNGISIQADVSRKDDMERVARTAFEEFGRIDIMVNNAGFTHRNMPLTDVDE
                     HNFDLIVAVNMKALYYSTQLVVPIMEHQGGGVIINTASATGLHPRKGLTWYCASKGWV
                     VSATKAMALELAERNIRVNCLCPAESDGEGLKMFLAEDTPEARAALKSTIPLGRFSTP
                     KDVAEAALWLASDDASMVTGVALGIDGGYSI"
     misc_feature    459723..460466
                     /gene="fabG"
                     /locus_tag="BAB2_0461"
                     /note="putative beta-ketoacyl acyl carrier protein [ACP]
                     reductase (BKR), subgroup 3, classical (c) SDR; Region:
                     BKR_3_SDR_c; cd05345"
                     /db_xref="CDD:187603"
     misc_feature    459723..460466
                     /gene="fabG"
                     /locus_tag="BAB2_0461"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    order(459756..459758,459762..459773,459828..459836,
                     459894..459902,459978..459986,460050..460052,
                     460131..460139,460176..460178,460188..460190,
                     460266..460277,460281..460286)
                     /gene="fabG"
                     /locus_tag="BAB2_0461"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187603"
     misc_feature    order(460053..460055,460137..460139,460176..460178,
                     460188..460190)
                     /gene="fabG"
                     /locus_tag="BAB2_0461"
                     /note="active site"
                     /db_xref="CDD:187603"
     gene            complement(460558..461805)
                     /locus_tag="BAB2_0462"
                     /db_xref="GeneID:3827903"
     CDS             complement(460558..461805)
                     /locus_tag="BAB2_0462"
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline resistance protein"
                     /protein_id="YP_418656.1"
                     /db_xref="GI:83269365"
                     /db_xref="GeneID:3827903"
                     /translation="METPHPNGSFTQSNADENHEQYWKQNLVICLLGSFTTLIAMSLL
                     LPFLPLYVEQLGVISHAAIVQWSGIAYGATFLAAAFVAPLWGRLGDRYGRKLMLIRAS
                     LGMAVAMSLIGMVTSVWQLVALRLFVGIAGGYSSGSMILVATQTPKDKTGWALGALSA
                     GIMAGNLAGPLLGGALPPLIGIRATFWLAGGVIFLTFLATTFLIREERKPPKPTREEK
                     TQSIWAAIPDKGPVVAMLVTGILLLFANMSIEPILTIYVMQLMDDQTKVTLVSGVVMA
                     AAALGSILSSSRLGQLADRIGHTRVIIGALAVSALLLVPQAFVTDAWQLIGLRFLMGL
                     ALGGLLPCITSVIRHNVPDRVAGGILGYSVSAQYVGQVAGPVAGGFVGGHFGMRAVFL
                     GTCLMMAAGAIYNWAVLRNSKTR"
     misc_feature    complement(460576..461739)
                     /locus_tag="BAB2_0462"
                     /note="drug efflux system protein MdtG; Provisional;
                     Region: PRK09874"
                     /db_xref="CDD:182127"
     misc_feature    complement(460597..461727)
                     /locus_tag="BAB2_0462"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(460693..460695,460702..460707,
                     460714..460719,460726..460731,460762..460764,
                     460771..460776,460786..460788,460795..460800,
                     460807..460809,460948..460950,460960..460962,
                     460969..460971,460981..460983,460993..460995,
                     461044..461046,461053..461058,461065..461070,
                     461077..461079,461308..461310,461326..461331,
                     461338..461343,461377..461379,461386..461391,
                     461398..461403,461410..461412,461548..461553,
                     461557..461562,461572..461574,461581..461586,
                     461593..461595,461659..461664,461668..461676,
                     461683..461685))
                     /locus_tag="BAB2_0462"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(462044..462343)
                     /locus_tag="BAB2_0463"
                     /db_xref="GeneID:3827904"
     CDS             complement(462044..462343)
                     /locus_tag="BAB2_0463"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418657.1"
                     /db_xref="GI:83269366"
                     /db_xref="GeneID:3827904"
                     /translation="MIDPRVALTILAMASVTYLTRIGGYVLLRNRTLSNRAMAVMEAA
                     PGCVLISVIAPDFVSDKPANLIALAVTVFAATRFSMLPTVLIGMGAASICRYLIG"
     misc_feature    complement(462047..462343)
                     /locus_tag="BAB2_0463"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4541"
                     /db_xref="CDD:226916"
     gene            complement(462340..463080)
                     /locus_tag="BAB2_0464"
                     /db_xref="GeneID:3827905"
     CDS             complement(462340..463080)
                     /locus_tag="BAB2_0464"
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC protein"
                     /protein_id="YP_418658.1"
                     /db_xref="GI:83269367"
                     /db_xref="GeneID:3827905"
                     /translation="MDILQVYAPQKGKPAWRSEFRRGIVSGFPVLLGMIPFALVLGAQ
                     AAHTGLTLAEVSMMTGLNFAGGSEFAAFRLWSSPPDVLLIAAITFLVNSRHLLMGAAL
                     APFLRHFPKRTAFLTLFLMCDESWAVSLADAKRRQAKGVNAALNLAYYMGVAIPFYLA
                     WVMSATLGAVFGPMIGDLHPYGFDMAIPAVFLVLIAGMWKGFAAARPWFVSLVAAAAT
                     HVFVPGALYVASGAISGLAAAYLLTGEK"
     misc_feature    complement(462349..463032)
                     /locus_tag="BAB2_0464"
                     /note="Predicted branched-chain amino acid permease
                     (azaleucine resistance) [Amino acid transport and
                     metabolism]; Region: AzlC; COG1296"
                     /db_xref="CDD:224215"
     gene            463456..463920
                     /locus_tag="BAB2_0465"
                     /db_xref="GeneID:3827906"
     CDS             463456..463920
                     /locus_tag="BAB2_0465"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_418659.1"
                     /db_xref="GI:83269368"
                     /db_xref="GeneID:3827906"
                     /translation="MPMKLDEIDKKILRALQRNGRIANNDLAREVGLSPSPCLRRVKL
                     LEEAGVIDRYVAVLNPAKIGKGLTFFTRIRLDQQDEETLQKFANEIMRLPQVLECYFM
                     LGDYDAMIRGVATDIEDYRRFQSEYLSRIKGVQNLKTDVPSQIVKQISEMPL"
     misc_feature    463456..463917
                     /locus_tag="BAB2_0465"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    463471..>463617
                     /locus_tag="BAB2_0465"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(463474..463482,463519..463527,463555..463566,
                     463570..463575,463582..463587,463591..463596,
                     463612..463617)
                     /locus_tag="BAB2_0465"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(463519..463521,463531..463533)
                     /locus_tag="BAB2_0465"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    463669..463872
                     /locus_tag="BAB2_0465"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            464179..464421
                     /locus_tag="BAB2_0466"
                     /db_xref="GeneID:3827907"
     CDS             464179..464421
                     /locus_tag="BAB2_0466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418660.1"
                     /db_xref="GI:83269369"
                     /db_xref="GeneID:3827907"
                     /translation="MSSELNGHSPRNRARRHFLGVAATAAARVAILGALVSSSLPARH
                     GQQMVAPWGARFALPVERHARHHAEWSCCRGKALRR"
     gene            464309..464977
                     /locus_tag="BAB2_0467"
                     /db_xref="GeneID:3827908"
     CDS             464309..464977
                     /locus_tag="BAB2_0467"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-regulated protein FrpC"
                     /protein_id="YP_418661.1"
                     /db_xref="GI:83269370"
                     /db_xref="GeneID:3827908"
                     /translation="MGNKWWHHGGHGSRCLLKGTLVTTPNGPVAVEKLCVGDLVTTVS
                     GECLPIKWIGWQNYRAGEADWNESVMPIRVRRHALDGRTPHRDLYLSPNHALFIDGVL
                     IRVKDLVNGRSIMRIPVERTLDYYNIVLDRHAVVLAEGAAVETFLMRGDGYRGFTNFS
                     EYERLYPDEAEIVMQPCAPAMGYEGARQHMRALLGLSGIVPVRDVVEETYQRLAARAG
                     SYAA"
     misc_feature    464351..464749
                     /locus_tag="BAB2_0467"
                     /note="Hint domain; Region: Hint_2; pfam13403"
                     /db_xref="CDD:257728"
     gene            465287..465703
                     /locus_tag="BAB2_0468"
                     /db_xref="GeneID:3827909"
     CDS             465287..465703
                     /locus_tag="BAB2_0468"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family regulatory protein"
                     /protein_id="YP_418662.1"
                     /db_xref="GI:83269371"
                     /db_xref="GeneID:3827909"
                     /translation="MTDIDYQVLAEWRYRSRRFMSFSATAAEAEGLPPQQHQALLAIK
                     ASGPDKLMTVGTLAERLVVAPHTATELTGRLVAAGLVARVVDLADRRRHTLELTIEAE
                     HILERLSSVHLAEIRELAPKFIDVLIKLNKMANEPE"
     misc_feature    465323..465643
                     /locus_tag="BAB2_0468"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    465359..465643
                     /locus_tag="BAB2_0468"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            complement(465714..467000)
                     /locus_tag="BAB2_0469"
                     /db_xref="GeneID:3827910"
     CDS             complement(465714..467000)
                     /locus_tag="BAB2_0469"
                     /EC_number="1.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase family protein"
                     /protein_id="YP_418663.1"
                     /db_xref="GI:83269372"
                     /db_xref="GeneID:3827910"
                     /translation="MPYQSPISPGYSWYEANTPDRPQYPELDGSQQADVVVIGGGYTG
                     LSAAYHLAKQGTDVVLIEAARLGDGASGRNGGQFGTGQRTWAEDLETEYGYERAKALF
                     NVAEEAKSYLLAFAEEHAIDMEYVQGHISVVHKPRYLKSYERHVEQMASRFNYPHQRF
                     LDRAETAELLGTSRYHGGVYDSATGHIHPMKLLIGTAKAAHTAGAKLFEDTKATKIST
                     ASGRVEVETTRGTIRARHAFIAVNAYGGRLEPVSASHVMPIRSFIGATAPLGDDSPVI
                     PGGESVDDSRFVVRYFRRSKDGRLLFGGREAYTADNPRDISAHIRRQITEIYPALENV
                     EITHAWGGSVGITMPRQPFVREVMPGVISAGGYSGHGVMLANYVGKLYADTLAGRREK
                     LKLFEELRIPPFPGGRTFRSPLLILALSWYALMDRI"
     misc_feature    complement(465885..466958)
                     /locus_tag="BAB2_0469"
                     /note="putative aminophosphonate oxidoreductase; Region:
                     Phn_aa_oxid; TIGR03329"
                     /db_xref="CDD:132372"
     misc_feature    complement(465771..466916)
                     /locus_tag="BAB2_0469"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     gene            complement(467054..467416)
                     /locus_tag="BAB2_0470"
                     /db_xref="GeneID:3827911"
     CDS             complement(467054..467416)
                     /locus_tag="BAB2_0470"
                     /note="crystal structure of protein from Xanthomonas shows
                     pentameric toroidal structure; physiological function is
                     unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418664.1"
                     /db_xref="GI:83269373"
                     /db_xref="GeneID:3827911"
                     /translation="MSINSYRDILVWQQAMELVTAIYKSTETWPREEIYGLTSQIRRA
                     AVSIPANIAEGYGRDTRGAYQQFLRIAQGSLKEMETHLLIAEQLGFIAKERAEPIMAM
                     GESIGKLLRLLIRKLSET"
     misc_feature    complement(467096..467410)
                     /locus_tag="BAB2_0470"
                     /note="hypothetical protein; Reviewed; Region: PRK12275"
                     /db_xref="CDD:183395"
     gene            complement(467452..468882)
                     /locus_tag="BAB2_0471"
                     /db_xref="GeneID:3827912"
     CDS             complement(467452..468882)
                     /locus_tag="BAB2_0471"
                     /EC_number="6.3.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_418665.1"
                     /db_xref="GI:83269374"
                     /db_xref="GeneID:3827912"
                     /translation="MSADTTEKKATRTPRRRTPAYVKSLRGVKNWKQATEWLAWRDIE
                     DIECITPDQAGVARGKMMPSKKFTSNTSLALPSAVFMTTISGAYPEDGYGFHYPEDDG
                     DLKLLPDLTTLSAVPWETDSTAQVICDLVYQDGHAVEFTPRNVLRNVIAAYSKRGLKP
                     VVAPEIEFYLVRKNPDPDYPLTPPVGRSGRAIGGGQGYSIAGVNEFDELIDDIYHFSE
                     GQGLEIDTLIHEEGAGQLEINLRHGDPVELADQVFMFKRTIREAALKHDMYATFMAKP
                     IQGQPGSAMHIHQSIVDKKTGRNIFTNEDGSESQAFHHFLGGMQRHVPNALVMFAPYV
                     NSYRRLTPDASAPVNVKWGYDNRTTAFRVPRSDPSARRVENRIPSSDANPYLALAASL
                     ACGLIGLVNKIEPEQPATTSVNTKEVELPRGLIDAVELFEEDAELRNLFGSSFMTTYA
                     AIKRAEFETFMEVISPWEREFLLLNV"
     misc_feature    complement(467458..468795)
                     /locus_tag="BAB2_0471"
                     /note="Glutamine synthetase [Amino acid transport and
                     metabolism]; Region: GlnA; COG0174"
                     /db_xref="CDD:223252"
     misc_feature    complement(467698..468459)
                     /locus_tag="BAB2_0471"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            complement(468886..469140)
                     /locus_tag="BAB2_0472"
                     /db_xref="GeneID:3827913"
     CDS             complement(468886..469140)
                     /locus_tag="BAB2_0472"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418666.1"
                     /db_xref="GI:83269375"
                     /db_xref="GeneID:3827913"
                     /translation="MLIIENLAGATFTCRAPSRPACPLPGQSFTGRAFFIVSKGKNIK
                     LRQSHLRGPNKNDPCPQKRKGPFVKSACHSYHINIEMIFW"
     gene            complement(469134..469436)
                     /locus_tag="BAB2_0473"
                     /db_xref="GeneID:3827914"
     CDS             complement(469134..469436)
                     /locus_tag="BAB2_0473"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418667.1"
                     /db_xref="GI:83269376"
                     /db_xref="GeneID:3827914"
                     /translation="MIATSNFTATDLPAGSGRVSAFTQLVKVIFAPALRRWTFSKGKR
                     QVMSLSDFDDHMLHDIGLRREDIYTAMRDRRVEDPTRILSELAIARLRMEAARHIC"
     misc_feature    complement(469233..469349)
                     /locus_tag="BAB2_0473"
                     /note="Domain of unknown function (DUF1127); Region:
                     DUF1127; pfam06568"
                     /db_xref="CDD:253801"
     gene            469603..470571
                     /locus_tag="BAB2_0474"
                     /db_xref="GeneID:3827915"
     CDS             469603..470571
                     /locus_tag="BAB2_0474"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_418668.1"
                     /db_xref="GI:83269377"
                     /db_xref="GeneID:3827915"
                     /translation="MGAPLDLDQLQTFVAIADAGSFTRAADAVFKTQSAVSMQMRRLE
                     ERIGKPLFDRDGRTNRLTEDGERLLLYARRMMHLNSETIAAFDDTQLEGHVRIGTPDD
                     YADRFLPEIMARFARSNPRVELSVVCEPTVNLDEMIRRGTLDIALVTQCDDKRRSEVV
                     RTEPLLWVTSTNHAVHEEAMLPLAVGRPTCIWRHAAIDVLEAARRDYRIIITSWSATV
                     LAAAVLSGLAVSVLPECALRPGMRVLGEADGFGMLPEIGIGIMRGHSKQNAAVDALAQ
                     HIIESLDNISSPQPGGLAGAMSSAEISPFPAVCTRRVRTNELLPGW"
     misc_feature    469615..470448
                     /locus_tag="BAB2_0474"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    469621..469800
                     /locus_tag="BAB2_0474"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    469885..470436
                     /locus_tag="BAB2_0474"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(469927..469932,469936..469941,469948..469950,
                     469960..469962,469966..469986,470230..470247,
                     470263..470268,470272..470277)
                     /locus_tag="BAB2_0474"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            470640..472175
                     /gene="xseA"
                     /locus_tag="BAB2_0475"
                     /db_xref="GeneID:3827916"
     CDS             470640..472175
                     /gene="xseA"
                     /locus_tag="BAB2_0475"
                     /EC_number="3.1.11.6"
                     /note="bidirectionally degrades single-stranded DNA into
                     large acid-insoluble oligonucleotides"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="YP_418669.1"
                     /db_xref="GI:83269378"
                     /db_xref="GeneID:3827916"
                     /translation="MASDSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEIS
                     GYRGPHSSGHAYFALKDDRARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSK
                     YQIVIEQMEPAGAGALMALLEERKQRLAAEGLFDPTLKQLLPFMPRVIGVVTSPTGAV
                     IRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVAR
                     GGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDWTLIDLAADMRAPTPTGAAEMA
                     VPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARAMPSADQLLALPRRRFDEAA
                     SRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGVTMLGQRLPRALEAFLRE
                     RRTAFTHRANRLSPEPILRRTRLTGSTLEQLDRRRDQAVRLLIERVKRRSQELDRLMR
                     TLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFRDGDVGVVARAGLTIPDPT
                     KGQ"
     misc_feature    470673..472133
                     /gene="xseA"
                     /locus_tag="BAB2_0475"
                     /note="exodeoxyribonuclease VII large subunit; Reviewed;
                     Region: xseA; PRK00286"
                     /db_xref="CDD:234714"
     misc_feature    470745..470981
                     /gene="xseA"
                     /locus_tag="BAB2_0475"
                     /note="ExoVII_LU_OBF: A subfamily of OB folds
                     corresponding to the N-terminal OB-fold domain of
                     Escherichia coli exodeoxyribonuclease VII (ExoVII) large
                     subunit. E. coli ExoVII is composed of two non-identical
                     subunits. E. coli ExoVII is a...; Region: ExoVII_LU_OBF;
                     cd04489"
                     /db_xref="CDD:239935"
     misc_feature    order(470751..470753,470898..470900,470904..470906,
                     470910..470912,470970..470972)
                     /gene="xseA"
                     /locus_tag="BAB2_0475"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239935"
     misc_feature    order(470766..470774,470805..470816,470820..470822,
                     470838..470846,470850..470852,470895..470897,
                     470916..470924,470949..470957)
                     /gene="xseA"
                     /locus_tag="BAB2_0475"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239935"
     gene            complement(472241..473614)
                     /locus_tag="BAB2_0476"
                     /db_xref="GeneID:3827917"
     CDS             complement(472241..473614)
                     /locus_tag="BAB2_0476"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="YP_418670.1"
                     /db_xref="GI:83269379"
                     /db_xref="GeneID:3827917"
                     /translation="MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYT
                     ANNSPVPYGGPRGIKAILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFEL
                     SGAPLSTIHQTCREVNAHLSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIM
                     TNYMPKVGHEGLDMMYRTSTIQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTE
                     GKPNGLLSWRSSIWRDTDNQRSGVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHD
                     CTHVTFRQFMNGALKGEVSDPVPNMGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRI
                     CALPAYWVGLLYDEEALAAAELLTKDWTYEEVLALRNEVPTKALKTDFHGKPLELIAR
                     ETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAAATTDAERMLNAYHSVWAGSVDP
                     IFLEYAY"
     misc_feature    complement(472244..473614)
                     /locus_tag="BAB2_0476"
                     /note="Gamma-glutamylcysteine synthetase [Coenzyme
                     metabolism]; Region: GshA; COG3572"
                     /db_xref="CDD:226102"
     gene            complement(473714..474460)
                     /locus_tag="BAB2_0477"
                     /db_xref="GeneID:3827841"
     CDS             complement(473714..474460)
                     /locus_tag="BAB2_0477"
                     /note="in Escherichia coli RsmE methylates the N3 position
                     of the U1498 base in 16S rRNA; cells lacking this function
                     can grow, but are outcompeted by wild-type; SAM-dependent
                     m(3)U1498 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="16S ribosomal RNA methyltransferase RsmE"
                     /protein_id="YP_418671.2"
                     /db_xref="GI:229358031"
                     /db_xref="GeneID:3827841"
                     /translation="MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEV
                     LVFNGRDGEWKASLQPEGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKA
                     VEMGAGVLQPVITQHTQVLRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQW
                     DTSRRLIFCDEGHESDDPLSILTGLEPGPSGLLIGPEGGFSEEERQLLHRQPFVTAIP
                     LGPRILRADTAAVAAMALVQAVLGDWRNAA"
     misc_feature    complement(473786..474448)
                     /locus_tag="BAB2_0477"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1385"
                     /db_xref="CDD:224303"
     gene            474710..475132
                     /locus_tag="BAB2_0478"
                     /db_xref="GeneID:3827842"
     CDS             474710..475132
                     /locus_tag="BAB2_0478"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_418672.1"
                     /db_xref="GI:83269381"
                     /db_xref="GeneID:3827842"
                     /translation="MKQAWVEFAPLLASAARGWRKAFDAAMAEHGLSDAKAIPLITLL
                     RHGDCIPQGVLAERVGIEGATIVRIVDELEKDGLIQRIVDDADRRVKLIQLTEDGRAV
                     ATQVEKSAARLRAQFLGGFDLQEVDVAMEVLRKLNEKF"
     misc_feature    474767..475129
                     /locus_tag="BAB2_0478"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    474782..475087
                     /locus_tag="BAB2_0478"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    order(474803..474805,474812..474814,474821..474826,
                     474833..474838,474845..474847,474938..474940,
                     475007..475012,475016..475018)
                     /locus_tag="BAB2_0478"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(474812..474820,474860..474868,474893..474904,
                     474908..474913,474920..474925,474929..474934,
                     474950..474952,474962..474967,474980..474988)
                     /locus_tag="BAB2_0478"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(474860..474862,474869..474871,475007..475009)
                     /locus_tag="BAB2_0478"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            475190..477286
                     /locus_tag="BAB2_0479"
                     /db_xref="GeneID:3827843"
     CDS             475190..477286
                     /locus_tag="BAB2_0479"
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein region"
                     /protein_id="YP_418673.1"
                     /db_xref="GI:83269382"
                     /db_xref="GeneID:3827843"
                     /translation="MTKLAETTPKFWDVVFSLKTFAAAMLALWIGLMANLPNPYWSVA
                     AVYIVAHPLSGATTSKGFYRLIGTIIGGAVTVVFVPHLVNSPEILTLAIGLWMGLCLV
                     ISLLDGTPRSYLFMLAGYTVAIASFAVVQAPETTFDYALGRVEEIAVGIICAAVVNRL
                     VFPRHSGPVLVGRIDNWLRDGSKLAVASMRGEGDSPEFRRDRQRLAADTLELRNLTTH
                     VAYDTSSIRNVAPLLHVLQQRMVAVLPIISSLHDVLLLKPGEGEKPWHPAVQQLLDEV
                     CDWLQSGENLTEERRTVFLRLIEEIDRHSRDASTWGELLPFNLSARIRDLVQIWSDCL
                     TLKQDISSGSRHSLRWRRYDAHLKGRPMHRDYGMALLSGFSSFLATCVATALWVASGW
                     AQGSAAAMMAGIFCCIFATMDDPVPVIRKFNCLLMVVIAAAFVFEFALLPLVNGFMPL
                     VLVLGLFLVPAGMLLVIPSQFLLGMVLCVNLPNMLMLQSHLTLDFPSFANANLATVLG
                     IVIAAVVTSIVRSVGAEWSVRRLVKAGWSDIVLATERRPGRYRREHMNRLLLRMIDRI
                     GMMAPRLALIPDADVAKVDLLRDLRNGMNTIDLQQYRAKLPAPCREAVDEVLDGVGAH
                     YRALSNKTRDTVEHIDERLLAAIDKAIATIIENGSPAVARRPRIALVALRFNLFPKAP
                     PFVLPPLPQLEFAQAA"
     misc_feature    475208..476914
                     /locus_tag="BAB2_0479"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; cl19401"
                     /db_xref="CDD:267754"
     misc_feature    475226..477241
                     /locus_tag="BAB2_0479"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     gene            477313..477522
                     /locus_tag="BAB2_0480"
                     /db_xref="GeneID:3827844"
     CDS             477313..477522
                     /locus_tag="BAB2_0480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418674.1"
                     /db_xref="GI:83269383"
                     /db_xref="GeneID:3827844"
                     /translation="MHPEFDIYGIYIPSLGLLALAAYFANTLMQRLLARVHFYRFVWH
                     RPLFDAAMYFCILGVAAVLLNGIPL"
     misc_feature    477319..477489
                     /locus_tag="BAB2_0480"
                     /note="Protein of unknown function (DUF1656); Region:
                     DUF1656; pfam07869"
                     /db_xref="CDD:254477"
     gene            477519..478385
                     /locus_tag="BAB2_0481"
                     /db_xref="GeneID:3827845"
     CDS             477519..478385
                     /locus_tag="BAB2_0481"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="YP_418675.1"
                     /db_xref="GI:83269384"
                     /db_xref="GeneID:3827845"
                     /translation="MKKLLAHSGRVFLTLVMVVMAGLLGWHLWDYYMNAPWTRDGKIR
                     ADVVRIAPDVSGLVSEVLVHDNQTVHKGDVIFRIDQARYKLALQTAEAKADSSKAALD
                     MANRDLVRYRQLNDTTVTRQKLEQVETAAQQAEAAHRQAELDRDLAALNMERSSIKAP
                     VNGVITNFSLQPGDYVSAGSAVTALVDTDSYYVSGYFEENKLERIHIGDPVVVDVMGS
                     KVQLKGKVEGIAGGIEDRERSDSQSLLANVSPTFNWVRLAQRVPVRVKLEDVPQGIHL
                     VAGRTVSVSVVD"
     misc_feature    477522..478382
                     /locus_tag="BAB2_0481"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     misc_feature    477654..477797
                     /locus_tag="BAB2_0481"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    477987..478235
                     /locus_tag="BAB2_0481"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            478503..478979
                     /locus_tag="BAB2_0482"
                     /db_xref="GeneID:3827846"
     misc_binding    478503..478735
                     /locus_tag="BAB2_0482"
                     /note="cobalamin riboswitch"
                     /bound_moiety="adenosylcobalamin"
     CDS             478563..478979
                     /locus_tag="BAB2_0482"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418676.1"
                     /db_xref="GI:83269385"
                     /db_xref="GeneID:3827846"
                     /translation="MRTTHQGAETVAAPATVSGLPFILVTPKASCHCAHGTGRQMDGD
                     YPQARRPAVLRSPLSRAGMPGTGAGYDSLPRYKAHSPIVIHIPGYARLRHVSMRACHL
                     MHFQTQTAFRVLENALVISGIFHENHKKQAIPCCFL"
     gene            478936..479970
                     /locus_tag="BAB2_0483"
                     /db_xref="GeneID:3827847"
     CDS             478936..479970
                     /locus_tag="BAB2_0483"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein"
                     /protein_id="YP_418677.1"
                     /db_xref="GI:83269386"
                     /db_xref="GeneID:3827847"
                     /translation="MKIIKNRPFLAAFYSFAFLVTGFSGSSLAGETRYPLTLKNCGRE
                     VTFHHAPQRAVAIGQSSAEILYNLGLGDRVVGTAVWFGPVMKGYEEVNARVKRLADND
                     PSLESVLAQKSDMVAAQFQWHVGPEGIVAKPEQFEELGIPVYTAPADCIGKVNSGKGD
                     GVRHTVFTMDLIYQEIRELAEIFNVQDRGEKVIADLKAREEAARKKIASANGRLSAVV
                     WFSSAQMDIDPYVAGKNGAPAYILSALGIRNVIGSEEEWPTVGWETIAKSDPTMIIAG
                     KMDRRRYPADDIAVKRKFLETDPVASLMPAVKDGHVFDMDAQAMNPTIRTIEGIETLA
                     DAIAAAGLNK"
     misc_feature    478936..479955
                     /locus_tag="BAB2_0483"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    479035..479937
                     /locus_tag="BAB2_0483"
                     /note="Metal binding protein TroA_a.  These proteins are
                     predicted to function as initial receptors in ABC
                     transport of metal ions in eubacteria. They belong to the
                     TroA superfamily of helical backbone metal receptor
                     proteins that share a distinct fold and...; Region:
                     TroA_a; cd01148"
                     /db_xref="CDD:238568"
     misc_feature    479197..479199
                     /locus_tag="BAB2_0483"
                     /note="putative ligand binding residues [chemical
                     binding]; other site"
                     /db_xref="CDD:238568"
     gene            479967..481010
                     /locus_tag="BAB2_0484"
                     /db_xref="GeneID:3827848"
     CDS             479967..481010
                     /locus_tag="BAB2_0484"
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter"
                     /protein_id="YP_418678.1"
                     /db_xref="GI:83269387"
                     /db_xref="GeneID:3827848"
                     /translation="MTVRAAAIRFSMKSRMGAGVLALVLLFVALWLGAAIGETSIPLD
                     VVAKTVANRLWYAGYPLDPIDEGIVWSYRLSRAVVAACCGAALALSGVVLQSLLRNSL
                     ADPYILGISAGASTGAVSVAILGIGAGILTLSFGAFIGAIVAFALVAMLAMRAGRGNS
                     AIILAGIAGSQLFNALTSFIVTKAANAEQARGIMFWLLGNLSGVRWPDVALALPVCLA
                     GLAVCLWHARALDAFTFGAESAASLGIPVRRIYAVLIGASAMMTAVMVSIVGSIGFIG
                     LVIPHAARMIVGVRHDVLLPAAALIGAIFMILADILSRTIIPGQVLPIGVITALFGAP
                     AFALLLGQKRGHP"
     misc_feature    480234..480986
                     /locus_tag="BAB2_0484"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(480249..480251,480261..480269,480636..480641,
                     480645..480653,480657..480662,480666..480683,
                     480687..480695,480816..480818,480837..480839)
                     /locus_tag="BAB2_0484"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(480264..480266,480270..480272,480285..480287,
                     480447..480449,480453..480458,480465..480470,
                     480477..480482,480489..480491,480498..480503,
                     480507..480509,480546..480551,480558..480560,
                     480786..480788,480942..480944,480951..480956,
                     480963..480965,480972..480977,480984..480986)
                     /locus_tag="BAB2_0484"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(480507..480509,480588..480590,480762..480764,
                     480774..480776,480906..480908,480933..480935)
                     /locus_tag="BAB2_0484"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            481007..481801
                     /locus_tag="BAB2_0485"
                     /db_xref="GeneID:3827849"
     CDS             481007..481801
                     /locus_tag="BAB2_0485"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418679.1"
                     /db_xref="GI:83269388"
                     /db_xref="GeneID:3827849"
                     /translation="MMLSARNVCWAAGCAEILHDVSLDVVKGEFLGIIGPNGSGKTTL
                     LSLLSGIRRPRSGTVLLGNAPIQKFNRREIARRLALVEQQAETTERITARQAVELGRT
                     PYLGALSPWSAADDAIVGKALENVDMAHLAGRCWHTLSGGERQRLHIARALAQEPQIL
                     LLDEPTNHLDIGHQIGLLDLVSRQGLTVVAALHDLNHAAMFCDRIAVMDTGQLVALGS
                     PREVLSAESIRAVFGVEVDVEYHGVRGCHIRYRLPDRPSLELRCLA"
     misc_feature    481007..481768
                     /locus_tag="BAB2_0485"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    481016..481657
                     /locus_tag="BAB2_0485"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    481109..481132
                     /locus_tag="BAB2_0485"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(481118..481123,481127..481135,481253..481255,
                     481493..481498,481583..481585)
                     /locus_tag="BAB2_0485"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    481244..481255
                     /locus_tag="BAB2_0485"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    481421..481450
                     /locus_tag="BAB2_0485"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    481481..481498
                     /locus_tag="BAB2_0485"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    481505..481516
                     /locus_tag="BAB2_0485"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    481571..481591
                     /locus_tag="BAB2_0485"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            481859..482101
                     /locus_tag="BAB2_0486"
                     /db_xref="GeneID:3827850"
     CDS             481859..482101
                     /locus_tag="BAB2_0486"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418680.1"
                     /db_xref="GI:83269389"
                     /db_xref="GeneID:3827850"
                     /translation="MRRCDISCSHFIAIKTLTLNQQNIDNDGLKWNESIRRHIWFSLI
                     GIYGNRICWEEAADYSQVSVVKMTPSLFGVADPDLE"
     gene            complement(482261..483712)
                     /locus_tag="BAB2_0487"
                     /db_xref="GeneID:3827851"
     CDS             complement(482261..483712)
                     /locus_tag="BAB2_0487"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418681.1"
                     /db_xref="GI:83269390"
                     /db_xref="GeneID:3827851"
                     /translation="MRIFTASLATETNTFSPVPTDRASFEMAFYAAPDKHPETPTLCS
                     SPIVALRKRAAAEGLTVIEGTATWAEPGGLLQRQTFEELRDEILDQLKAAMPVDAVVL
                     GLHGAMVAQGYDDCEGDLLERVRAIVGPGVLVASEFDPHSHLTPKRVQNLNIFASFLE
                     FPHTDFYERGEHVVELALDALKGRTKPVISTFDCRMIAVLPTSKEPMRSFVDRIKALQ
                     GKDGILSISVIHGFMAADVPEMGTRILVVTDNDPQKGAALAEKLGREQTSMAMLDTDQ
                     GIDRALAAHAANPSKPAVIADVWDNPGGGVAGDGTYILRRLIERGVNNAGIATIWDPI
                     AVTFCHAAGEGAVIDLRFGGKSGPLGGEPIDARVTVLKVANEGWQSFGPSRVTLGPSA
                     VVRIEDTGIDIILNTNRTQTFEPDIFSNLGIDPMTKNVLVVKSTNHFHAGFAPVAAEI
                     IYVDAPSSYPSNPRTTNYRKLNRAIWPRVEDPW"
     misc_feature    complement(482264..483712)
                     /locus_tag="BAB2_0487"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5476"
                     /db_xref="CDD:227763"
     misc_feature    complement(482864..483712)
                     /locus_tag="BAB2_0487"
                     /note="Protein of unknown function (DUF1485); Region:
                     DUF1485; pfam07364"
                     /db_xref="CDD:254171"
     misc_feature    complement(482300..482833)
                     /locus_tag="BAB2_0487"
                     /note="MlrC C-terminus; Region: MlrC_C; pfam07171"
                     /db_xref="CDD:254088"
     gene            complement(483739..484110)
                     /locus_tag="BAB2_0488"
                     /db_xref="GeneID:3827852"
     CDS             complement(483739..484110)
                     /locus_tag="BAB2_0488"
                     /codon_start=1
                     /transl_table=11
                     /product="YjgF-like protein:endoribonuclease L-PSP"
                     /protein_id="YP_418682.1"
                     /db_xref="GI:83269391"
                     /db_xref="GeneID:3827852"
                     /translation="MSRKQVFGASHVPLSPAVRVGDMVYVSGQVPVGPNGQIVEGGIE
                     AQTRQVLENIKAALALAGAAMEDVVKTTVWLEDARDFGRMNAVYGTYFPKEPPARTTV
                     ESRLMIDIKIEIEAVAYAPQK"
     misc_feature    complement(483757..484068)
                     /locus_tag="BAB2_0488"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(483760..483762,483766..483768,
                     483772..483774,483802..483822,483847..483849,
                     483856..483858,483889..483891,483895..483897,
                     483901..483906,483910..483912,484027..484032,
                     484036..484038,484042..484044,484051..484053,
                     484057..484059,484066..484068))
                     /locus_tag="BAB2_0488"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(483772..483774,483814..483816,
                     483856..483858,483868..483870))
                     /locus_tag="BAB2_0488"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            complement(484123..484950)
                     /locus_tag="BAB2_0489"
                     /db_xref="GeneID:3827853"
     CDS             complement(484123..484950)
                     /locus_tag="BAB2_0489"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418683.1"
                     /db_xref="GI:83269392"
                     /db_xref="GeneID:3827853"
                     /translation="MMSAKLKRTVVAWAVLSPLIVLTLFPFAVMFLTAVKPAQEVLSP
                     NWWPSTFRWQNFSEMWVATNFGNALLNSIYVSVIASVGAIIISIPAAYAMSRFRFAAH
                     GAFRQFLLVSQMISPIVLVLGLFRLLAAYGLIESVSAVGAVYMAFNIAFTVWMLQSYF
                     DTIPRDLEEAAWMEGAGRGKTLVKVFLPLCLPAIAVTAIFTFINAWNEFVVALTMLRR
                     QESYTLPIQVFSLVAGRYTVEWHYVMAATFLATLPVAILFIWLQRYLIKGLALGAVK"
     misc_feature    complement(484126..484950)
                     /locus_tag="BAB2_0489"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(484189..484746)
                     /locus_tag="BAB2_0489"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(484189..484191,484198..484203,
                     484210..484215,484219..484224,484231..484236,
                     484264..484269,484309..484314,484321..484332,
                     484351..484353,484360..484365,484405..484407,
                     484456..484458,484465..484470,484480..484482,
                     484486..484491,484498..484500,484504..484506,
                     484510..484515,484576..484578,484582..484587,
                     484594..484623,484627..484638,484666..484668,
                     484681..484686,484693..484698))
                     /locus_tag="BAB2_0489"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(484315..484332,484576..484620))
                     /locus_tag="BAB2_0489"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(484234..484236,484264..484266,
                     484273..484275,484312..484314,484528..484530,
                     484576..484578))
                     /locus_tag="BAB2_0489"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(484384..484386,484396..484401,
                     484417..484455))
                     /locus_tag="BAB2_0489"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(484947..485816)
                     /locus_tag="BAB2_0490"
                     /db_xref="GeneID:3827854"
     CDS             complement(484947..485816)
                     /locus_tag="BAB2_0490"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418684.1"
                     /db_xref="GI:83269393"
                     /db_xref="GeneID:3827854"
                     /translation="MQNRTLPYFLILPSLLLAAVVIFWPVVHLFEIATHDVNRFGQLR
                     EFNDGANFTALFATAEFMNALWRTAVWTVAVVGGALVLSIPVAIILNMDFYGRSVARV
                     IIMLPWAVSLTMTAIFWRWALNGESGMLNSALHGLGLIDTNIQWLASAATAFPMQILV
                     GILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVLN
                     TIYVFNSFPIIWVMTQGRPANSTDILVTHLYKLAFRLGKFGEASAVSLIMLAILLVFT
                     VIYIRISTRSEQS"
     misc_feature    complement(484959..485816)
                     /locus_tag="BAB2_0490"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    complement(484998..485624)
                     /locus_tag="BAB2_0490"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(484998..485003,485010..485015,
                     485022..485027,485031..485036,485043..485048,
                     485076..485081,485124..485129,485136..485147,
                     485166..485168,485175..485180,485220..485222,
                     485271..485273,485280..485285,485295..485297,
                     485301..485306,485313..485315,485319..485321,
                     485325..485330,485457..485459,485463..485468,
                     485475..485504,485508..485519,485544..485546,
                     485559..485564,485571..485576))
                     /locus_tag="BAB2_0490"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(485130..485147,485457..485501))
                     /locus_tag="BAB2_0490"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(485046..485048,485076..485078,
                     485085..485087,485127..485129,485343..485345,
                     485457..485459))
                     /locus_tag="BAB2_0490"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(485199..485201,485211..485216,
                     485232..485270))
                     /locus_tag="BAB2_0490"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(485889..487124)
                     /locus_tag="BAB2_0491"
                     /db_xref="GeneID:3827855"
     CDS             complement(485889..487124)
                     /locus_tag="BAB2_0491"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_418685.1"
                     /db_xref="GI:83269394"
                     /db_xref="GeneID:3827855"
                     /translation="MLIRKWKAGLLAGLSILALASSADAGEVRMTVAEYSAKTGPYFE
                     EVKKAFEAENPGITLNFEVVPWDVLLQKLTTDISAGTNADLSIIGTRWLIDFVQQGIA
                     EPLDGYMNDEFKGRFIETFLSPSVLDGKTYGLPIAASARAMYYNKDLFEKAGIKNPPA
                     NWDELKADAAKIKALGGENYGFGLQGKEIETDVYYYYAMWSYGTEILNKDGTSGLSTP
                     GALEAAKLYKSMIDDGLTQPGVTSYAREDVQNLFKQGKVGMMITAPFLSNQIKEEAPN
                     LKYGVAAIPAGPTGARGTYGVTDSVIMFQNSKNKEEAWKVLDFLFQKDWRAKFTQNEG
                     FLPVNKEEAKMDYYVNNADLAAFTALLPDARFAPVIPGWEEIADITSNAMQSIYLGKG
                     EPDAVLKDAAAKADAILKK"
     misc_feature    complement(485934..487124)
                     /locus_tag="BAB2_0491"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    complement(486144..487007)
                     /locus_tag="BAB2_0491"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            487304..488077
                     /locus_tag="BAB2_0492"
                     /db_xref="GeneID:3827856"
     CDS             487304..488077
                     /locus_tag="BAB2_0492"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase"
                     /protein_id="YP_418686.1"
                     /db_xref="GI:83269395"
                     /db_xref="GeneID:3827856"
                     /translation="MDHSGEFAGRSVLVTGAGGGLGRALAALFAARGARVIGCDVSMD
                     LMAASDFASRHVFDLLDRAELAAAANKLILADGVPDIVINNAGWTRAETFEGLEQDRI
                     EVEIDLNLTGVASFSNIMAQAMATRGHGAFVFVSSVNSLQHFGNPAYAAAKAGINAFA
                     RGIAVEFGQRGVRANVVCPGSIRTPAWDHRIAQDPSVLDRLQRLYPLGRIVNVGEVAE
                     AVAFLASERASGITGAVLPVDAGLTAGCRPFIEDILGGN"
     misc_feature    487313..488032
                     /locus_tag="BAB2_0492"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Reviewed; Region: PRK12826"
                     /db_xref="CDD:183775"
     misc_feature    <487469..488032
                     /locus_tag="BAB2_0492"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(487556..487564,487706..487714,487748..487750,
                     487760..487762,487838..487849)
                     /locus_tag="BAB2_0492"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(487628..487630,487712..487714,487748..487750,
                     487760..487762)
                     /locus_tag="BAB2_0492"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            488082..489134
                     /locus_tag="BAB2_0493"
                     /db_xref="GeneID:3827857"
     CDS             488082..489134
                     /locus_tag="BAB2_0493"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_418687.1"
                     /db_xref="GI:83269396"
                     /db_xref="GeneID:3827857"
                     /translation="MKEVSLRGISKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKST
                     LLRMVAGLEPISGGDLVIGGERANELPPQKRNIAMVFQSYALFPHMTARENIGFGPRI
                     RGEKAAETAAKVDHAASILNLHSYLDRYPRQLSGGQRQRVAMGRAIVREPSVFLFDEP
                     LSNLDAQLRVQMRTEIKALHQRLKSTVIYVTHDQIEAMTMADRIVVMNQGKIQQIGAP
                     LDLYDRPANKFVAGFIGSPSMSFIPGTVADGFFCTGEGEKIAVSAAAKGARAAEAGIR
                     PENFVIAREGAGLTLVVEVIEPTGPETHIYGRIAGEPVRAVFRERIQLAPGEQVPVTA
                     GSEHIHLFDKESGLPL"
     misc_feature    488082..489122
                     /locus_tag="BAB2_0493"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    488091..488729
                     /locus_tag="BAB2_0493"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    488187..488210
                     /locus_tag="BAB2_0493"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(488196..488201,488205..488213,488325..488327,
                     488553..488558,488655..488657)
                     /locus_tag="BAB2_0493"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    488316..488327
                     /locus_tag="BAB2_0493"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    488481..488510
                     /locus_tag="BAB2_0493"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    488541..488558
                     /locus_tag="BAB2_0493"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    488565..488576
                     /locus_tag="BAB2_0493"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    488643..488663
                     /locus_tag="BAB2_0493"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    488901..489107
                     /locus_tag="BAB2_0493"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            489106..490023
                     /locus_tag="BAB2_0494"
                     /db_xref="GeneID:3827858"
     CDS             489106..490023
                     /locus_tag="BAB2_0494"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LacI"
                     /protein_id="YP_418688.1"
                     /db_xref="GI:83269397"
                     /db_xref="GeneID:3827858"
                     /translation="MIRKAVCRFELFMSKVADIITRLHVVAQEGSKSDRRLAGLVLAD
                     PHYASKAAISEIAARAGVSEPTVTRFCRALGCDGVRDFKFFLAQALAIGGQYLTAEIP
                     ARDVRESRIATAVTDAAIAAIQRAGDGVDMGVLMKVAERLAAGGPVLCLGSGDMSSML
                     ATEMENRLFRLGIPVNAQVDGQLQRMYAAVTTHETTVLAFSVSGFARSVVEAVLVARQ
                     YGAETVAITAAGSDLARAADMLIPFQPNEDGNIYKPTSARYGLLAILDMIATAAAEAR
                     GPKVLESLRRIKHILNTLTIDDPRLPLGD"
     misc_feature    489148..489993
                     /locus_tag="BAB2_0494"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    489187..489378
                     /locus_tag="BAB2_0494"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    489508..489918
                     /locus_tag="BAB2_0494"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    order(489574..489576,489706..489708)
                     /locus_tag="BAB2_0494"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            490028..490192
                     /locus_tag="BAB2_0495"
                     /pseudo
                     /db_xref="GeneID:3827859"
     misc_feature    490028..490192
                     /locus_tag="BAB2_0495"
                     /note="amino acid processing enzyme-related protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12661.1"
     gene            490193..491095
                     /locus_tag="BAB2_0496"
                     /pseudo
                     /db_xref="GeneID:3827860"
     misc_feature    490193..491095
                     /locus_tag="BAB2_0496"
                     /note="Protein of unknown function UPF0001"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12662.1"
     gene            491109..491411
                     /locus_tag="BAB2_0497"
                     /pseudo
                     /db_xref="GeneID:3827594"
     misc_feature    491109..491411
                     /locus_tag="BAB2_0497"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12663.1"
     gene            491408..491584
                     /locus_tag="BAB2_0498"
                     /pseudo
                     /db_xref="GeneID:3827595"
     misc_feature    491408..491584
                     /locus_tag="BAB2_0498"
                     /note="conserved hypothetical protein"
                     /pseudo
                     /db_xref="PSEUDO:CAJ12664.1"
     gene            491747..491923
                     /locus_tag="BAB2_0499"
                     /db_xref="GeneID:3827596"
     CDS             491747..491923
                     /locus_tag="BAB2_0499"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418689.1"
                     /db_xref="GI:83269398"
                     /db_xref="GeneID:3827596"
                     /translation="MSQVVEYLSQLVPAIDFRGITITIGLAGCFLLSTVLYGPKICCV
                     TFQKIIQGDGEQRG"
     gene            492179..493312
                     /locus_tag="BAB2_0500"
                     /db_xref="GeneID:3827597"
     CDS             492179..493312
                     /locus_tag="BAB2_0500"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine/L-proline ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_418690.1"
                     /db_xref="GI:83269399"
                     /db_xref="GeneID:3827597"
                     /translation="MACFKVFGDNPMRAMRELGAGKSKAQIHSDLGATIGVDNATFDI
                     REGEVFVIMGLSGSGKSTLLRLLNRLIEPTAGSIEVEGRDIVKMSKRELIDLRRRDMS
                     MVFQSFALLPNRSVLNNAAFGLEVAGMGEVQRHQKALKALAAVGLEPYAHSMPDQLSG
                     GMKQRVGLARALASEPTVLLMDEAFSALDPLIRTEMQDELKRLQAQHSRTIVFVSHDL
                     DEAMRIGDRICIMQHGKVVQVGTPNEIISAPANDYVRSFFRNVDVSRVFKAADVARDD
                     ELIVFEAEQLATALERFDASGKAYGVLVDADRTYRGLVSRDALAAGQRLNDFAAIEAD
                     APLSGLLVHVAKSPWPVPVTDRQNRYVGAISRSVLLETLGRAG"
     misc_feature    492185..493309
                     /locus_tag="BAB2_0500"
                     /note="ABC-type proline/glycine betaine transport system,
                     ATPase component [Amino acid transport and metabolism];
                     Region: ProV; COG4175"
                     /db_xref="CDD:226643"
     misc_feature    492185..492976
                     /locus_tag="BAB2_0500"
                     /note="ATP-binding cassette domain of the osmoprotectant
                     proline/glycine betaine uptake system; Region:
                     ABC_Pro_Gly_Betaine; cd03294"
                     /db_xref="CDD:213261"
     misc_feature    492338..492361
                     /locus_tag="BAB2_0500"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213261"
     misc_feature    order(492347..492352,492356..492364,492494..492496,
                     492722..492727,492824..492826)
                     /locus_tag="BAB2_0500"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213261"
     misc_feature    492485..492496
                     /locus_tag="BAB2_0500"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213261"
     misc_feature    492650..492679
                     /locus_tag="BAB2_0500"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213261"
     misc_feature    492710..492727
                     /locus_tag="BAB2_0500"
                     /note="Walker B; other site"
                     /db_xref="CDD:213261"
     misc_feature    492734..492745
                     /locus_tag="BAB2_0500"
                     /note="D-loop; other site"
                     /db_xref="CDD:213261"
     misc_feature    492812..492832
                     /locus_tag="BAB2_0500"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213261"
     misc_feature    493016..493294
                     /locus_tag="BAB2_0500"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair; cl15354"
                     /db_xref="CDD:265675"
     gene            493375..494280
                     /locus_tag="BAB2_0501"
                     /db_xref="GeneID:3827598"
     CDS             493375..494280
                     /locus_tag="BAB2_0501"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein dependent transport system inner
                     membrane protein"
                     /protein_id="YP_418691.1"
                     /db_xref="GI:83269400"
                     /db_xref="GeneID:3827598"
                     /translation="MDLNFSVGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNAL
                     IAVPPFAGVAILSLLALWRVGWKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIA
                     VVIGIPLGIAMARSDAVASIVRPILDLMQTMPAFVYLISAAMFFGLGAVPSTIATVIF
                     AMPPVVRLTNLGIRQVHAEFVEAGLAFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLS
                     LSMVVIASMIGAGGLGNTVLTGIQRLNVGLGFEGGLAVVILAVILDRITQSFGKGGTG
                     LLKRLAFLKRAAGEQPASSFRKQEA"
     misc_feature    493645..494163
                     /locus_tag="BAB2_0501"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(493684..493689,493696..493701,493714..493716,
                     493741..493752,493756..493785,493792..493797,
                     493801..493803,493849..493854,493858..493860,
                     493864..493866,493873..493878,493882..493884,
                     493894..493899,493906..493908,493957..493959,
                     493999..494004,494011..494013,494032..494043,
                     494050..494055,494092..494097,494125..494130,
                     494137..494142,494146..494151,494158..494163)
                     /locus_tag="BAB2_0501"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(493759..493803,494032..494049)
                     /locus_tag="BAB2_0501"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(493801..493803,493834..493836,494050..494052,
                     494086..494088,494095..494097,494125..494127)
                     /locus_tag="BAB2_0501"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(493909..493947,493963..493968,493978..493980)
                     /locus_tag="BAB2_0501"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            494334..495200
                     /locus_tag="BAB2_0502"
                     /db_xref="GeneID:3827599"
     CDS             494334..495200
                     /locus_tag="BAB2_0502"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_418692.1"
                     /db_xref="GI:83269401"
                     /db_xref="GeneID:3827599"
                     /translation="MLGKLTRFGLAAVVAGTMTMGAAFAQDGKTVKIGWAPWSDAEFV
                     TKLARKLIEDNLGQKVELVQTDVAPLYQGVSRGDIDAMMMAWLPETHADYYKRVEGKV
                     ENLGPLYEGAKLGWIVPDYIPESEVSSIEDLKKPEVREKLKGEIQGIDPGAGLTRLSQ
                     EAIKKYGLDYKLNISSEAAMLTTVDRANRSEGWFVATSWSPHWMFGKYKLRYIADPKG
                     ALGGAEHIDAVARKGFKEDDPKVAALLAKMSIPINELEAAMFDAQETSYEKAVDKYIA
                     DHPDRIKEWLSQ"
     misc_feature    494334..495197
                     /locus_tag="BAB2_0502"
                     /note="ABC-type proline/glycine betaine transport systems,
                     periplasmic components [Amino acid transport and
                     metabolism]; Region: ProX; COG2113"
                     /db_xref="CDD:225024"
     gene            complement(495246..496091)
                     /locus_tag="BAB2_0503"
                     /db_xref="GeneID:3827600"
     CDS             complement(495246..496091)
                     /locus_tag="BAB2_0503"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_418693.1"
                     /db_xref="GI:83269402"
                     /db_xref="GeneID:3827600"
                     /translation="MIALITSGIAIGSSPIFVRLSEVGPLATGFWRLALAVLPLLLMD
                     GRERHERKDAAPLTLADCLRLALPGFFIAADLGAWHLSLHSTSVANATLLANMAPIFV
                     TIGAWLLFRSRVSSSFIVGLVVAVAGVIVLKGGPGELLHSRSSGDAMALLAAVFYAGY
                     ILSVGRLRSRFSTMRIMLWSSAIAAIFSLPVAYFMEGHILPATLYGWLVLAGLAWLTH
                     AAGQSMIAYALAFLPASFSSLTLLLQPVVAAFLAWTILSEPIGLMQAIGGVIVISGIL
                     IARRG"
     misc_feature    complement(495249..496091)
                     /locus_tag="BAB2_0503"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(495261..495629)
                     /locus_tag="BAB2_0503"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(496227..496424)
                     /locus_tag="BAB2_0504"
                     /db_xref="GeneID:3827601"
     CDS             complement(496227..496424)
                     /locus_tag="BAB2_0504"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418694.1"
                     /db_xref="GI:83269403"
                     /db_xref="GeneID:3827601"
                     /translation="MYFEPTVRSGSGSKMRHRRPEIKQWRGAAQHKNTIFRDQLSGVY
                     FLLDGCPNQDYAALRFAAGKR"
     gene            complement(496554..496997)
                     /locus_tag="BAB2_0505"
                     /db_xref="GeneID:3827602"
     CDS             complement(496554..496997)
                     /locus_tag="BAB2_0505"
                     /codon_start=1
                     /transl_table=11
                     /product="immunoreactive 14 kDa protein BA14k"
                     /protein_id="YP_418695.1"
                     /db_xref="GI:83269404"
                     /db_xref="GeneID:3827602"
                     /translation="MNSFRKTCAGALALIFGATSIVPTVAAPMNMDRPAINQNVIQAR
                     AHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLAAFGAGAIIGGAISQPR
                     PVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYSR"
     misc_feature    complement(496572..496661)
                     /locus_tag="BAB2_0505"
                     /note="BA14K-like protein; Region: BA14K; pfam07886"
                     /db_xref="CDD:203793"
     gene            complement(497179..498348)
                     /locus_tag="BAB2_0506"
                     /db_xref="GeneID:3827603"
     CDS             complement(497179..498348)
                     /locus_tag="BAB2_0506"
                     /EC_number="1.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Iron-containing alcohol dehydrogenase"
                     /protein_id="YP_418696.1"
                     /db_xref="GI:83269405"
                     /db_xref="GeneID:3827603"
                     /translation="MTTLTAKWNFPTTVLFGPGHIKELPAVLKAAGIEHPLFVTDPGL
                     AKLPVVASTLAVLDAAGVQYGVFSDVKPNPVESNLHAGVKVFREGRHDGVIAFGGGSA
                     LDLGKLIAFQAGQTRPVWDFEDIGDWWTRADSNAIAPVIAVPTTAGTGSEVGRAGVLT
                     NESTHTKKVIFHPKMLPVTVIADPELSTGMPPFITAGTGMDALAHCLEAYCAPGFHPM
                     ADGIAVEGIRLVFENLPKAYANGGDIEARANMMAAAAMGATAFQKGLGAIHSLSHPIG
                     ALYDTHHGMTNAVFMPYVLHHNRDAIEKRIARLADYLGIEGGFDGFADAIMKLRTELG
                     VPRTLPDLIKNLQMDNARKELIAEMAVADPTAGGNPVELTKNDALKLLNAALEGR"
     misc_feature    complement(497203..498321)
                     /locus_tag="BAB2_0506"
                     /note="Iron-containing alcohol dehydrogenases-like,
                     involved in the linear alkylbenzenesulfonate (LAS)
                     degradation pathway; Region: Fe-ADH7; cd08192"
                     /db_xref="CDD:173951"
     misc_feature    complement(order(497500..497502,497530..497532,
                     497542..497544,497734..497736,497746..497748,
                     497767..497769,497791..497793,497845..497850,
                     497905..497907,497911..497916,498028..498030,
                     498037..498039,498046..498054,498226..498228))
                     /locus_tag="BAB2_0506"
                     /note="putative active site [active]"
                     /db_xref="CDD:173951"
     misc_feature    complement(order(497500..497502,497542..497544,
                     497734..497736,497746..497748))
                     /locus_tag="BAB2_0506"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173951"
     gene            complement(498449..499816)
                     /locus_tag="BAB2_0507"
                     /db_xref="GeneID:3827604"
     CDS             complement(498449..499816)
                     /locus_tag="BAB2_0507"
                     /EC_number="6.3.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_418697.1"
                     /db_xref="GI:83269406"
                     /db_xref="GeneID:3827604"
                     /translation="MAGQLTFDELKKAVAEGRIDTVLACIVDMQGRLIGKRFYGQFFV
                     ESGYDETHGCNYLLADDIDMEPVPGYEAAGWDKGYGDFVMKPDLSTLRLAPWLEKTAI
                     VLCDVLDHHHDDLSHSPRAVLKKQVQRLHERGYRAYFASELEFYIFDETYKSARAKRW
                     HEMETASPYVQGYVIHLTTREEPVLRAMRNHLADAGIPVENSKGEWGPGQQELNVRYC
                     KALEMADRHVIMKNAMKEIAEAHGKCITFMAKYDYARAGSSSHVHNSIWSADGKEPLF
                     FDPKAPYTMTPLMRSWVAGQIKYATDYTYFLAPYINSYKRFQAGTFAPTKIMWSQDNR
                     TAGFRLCGEGTKGIRIECRIGGADINPYLAFAALIAAGLKGVDEKLELDEPFVGDAYS
                     AVRLKEIPYTLREAAAALKGSAFLKEAFGEDVVNHYTHTAHWEQIEYDRRVTDWELYR
                     GFERY"
     misc_feature    complement(498455..499801)
                     /locus_tag="BAB2_0507"
                     /note="Glutamine synthetase [Amino acid transport and
                     metabolism]; Region: GlnA; COG0174"
                     /db_xref="CDD:223252"
     misc_feature    complement(499490..>499576)
                     /locus_tag="BAB2_0507"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    complement(498701..499465)
                     /locus_tag="BAB2_0507"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            complement(499880..500569)
                     /locus_tag="BAB2_0508"
                     /db_xref="GeneID:3827605"
     CDS             complement(499880..500569)
                     /locus_tag="BAB2_0508"
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="YP_418698.1"
                     /db_xref="GI:83269407"
                     /db_xref="GeneID:3827605"
                     /translation="MPESFAGLGLDAETRKTHIAWDPGAVEVARELSKALDAPLVEAG
                     LPRLLIDCNRPLDAPDLIPEISETTLVPGNHGLNTAERMARIDLSHRPFHRRIEEVIA
                     MRAARGQPSWIVTVHSFTPVYRGVSRPWQIGIIHDEDDRIARPLIAALRQDMGLHIGV
                     NEPYSPADRVYYTLERHARPRNAPCVMIEIRNDEITDAGTQTAWGRKLTAILKKYQET
                     MRSAGGAYPYA"
     misc_feature    complement(499883..500569)
                     /locus_tag="BAB2_0508"
                     /note="Predicted N-formylglutamate amidohydrolase [Amino
                     acid transport and metabolism]; Region: COG3931"
                     /db_xref="CDD:226441"
     gene            complement(500538..500675)
                     /locus_tag="BAB2_0509"
                     /db_xref="GeneID:3827606"
     CDS             complement(500538..500675)
                     /locus_tag="BAB2_0509"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418699.1"
                     /db_xref="GI:83269408"
                     /db_xref="GeneID:3827606"
                     /translation="MANEREDRAASCEPVFVINEGGKSLSSRLRTCLQPYAGKLRRAW
                     A"
     gene            500702..501646
                     /locus_tag="BAB2_0510"
                     /db_xref="GeneID:3827607"
     CDS             500702..501646
                     /locus_tag="BAB2_0510"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_418700.1"
                     /db_xref="GI:83269409"
                     /db_xref="GeneID:3827607"
                     /translation="MLRFFHLCAIADYLIRPMIFCQTQFAQNWKRAAGMETAAPMSAS
                     VAELINERIDAMPAGERSAAQMLIADYPMLGLKTVAEFSTQAGVSSPTILRFVNRLGF
                     QSYPDFQARLQDELAAQLQSPHHRNEQPDKRPDAADPGVEHTLENIRETFRHLGEKQL
                     HQVVASLSLAKGNVYLIGGRFTDPIAQYMTAHMSIVRARVFHLGGQESMWRDRLLDMG
                     KRDILVVFDIRRYQESLLALAEKARSRGVEVVLVTDQWLSPIARVARHVLAGRIAVPS
                     AWDSSAALFVLAETIIREMTRMLEKDSAARIAELEALR"
     misc_feature    500822..501643
                     /locus_tag="BAB2_0510"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    500834..501058
                     /locus_tag="BAB2_0510"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    501173..501577
                     /locus_tag="BAB2_0510"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    order(501245..501247,501380..501382)
                     /locus_tag="BAB2_0510"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            501758..502987
                     /locus_tag="BAB2_0511"
                     /db_xref="GeneID:3827608"
     CDS             501758..502987
                     /locus_tag="BAB2_0511"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase
                     class-II"
                     /protein_id="YP_418701.1"
                     /db_xref="GI:83269410"
                     /db_xref="GeneID:3827608"
                     /translation="MDDRCIIIGAGHAGSQAAVSLRQEGYAGEIILINDETDIPYHKP
                     PLSKSYLKAPEKGSLVLRPESAYRDNNIEMLFGAHVDAVSIAERTVTLGDGRVLPWSE
                     LVFATGARARIPDVPGVALEGVVTLRRMEDARRIAAMMPDVRNVVIIGGGFIGLEMAH
                     SAIALGKKTVLIEAAPRILGRSVAAPVSAHVEARSRAADITLLTGLGVASIEGENGRA
                     IGVTAGDGTFFPADLVVIGTGAVPNVELAAKAGLSIDNGIRVDEHMRTSAPHVYAIGD
                     CASYAHFHAGRHVRLESVQNATDQAKHVARTIVGRETPYREVAWFWSDQGDMKLQTAG
                     LSFDADRHVLSGEPEENAFSVFHFKGDRLVAVDSINRPAGHMIARRLLAAGISPSEAD
                     IMAGMPRLKELLAVVAR"
     misc_feature    501773..502972
                     /locus_tag="BAB2_0511"
                     /note="Uncharacterized NAD(FAD)-dependent dehydrogenases
                     [General function prediction only]; Region: HcaD; COG0446"
                     /db_xref="CDD:223523"
     misc_feature    501773..502246
                     /locus_tag="BAB2_0511"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    502190..502435
                     /locus_tag="BAB2_0511"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    502715..502969
                     /locus_tag="BAB2_0511"
                     /note="Reductase C-terminal; Region: Reductase_C;
                     pfam14759"
                     /db_xref="CDD:258896"
     gene            complement(503160..503318)
                     /locus_tag="BAB2_0512"
                     /db_xref="GeneID:3827609"
     CDS             complement(503160..503318)
                     /locus_tag="BAB2_0512"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_418702.1"
                     /db_xref="GI:83269411"
                     /db_xref="GeneID:3827609"
                     /translation="MVRKMNLIRSYNNWRRYRNTVNELSRLSPRELNDLGILPSEIPF
                     VARKAAAR"
     misc_feature    complement(503163..>503306)
                     /locus_tag="BAB2_0512"
                     /note="Domain of unknown function (DUF1127); Region:
                     DUF1127; cl02276"
                     /db_xref="CDD:261233"
     gene            503732..505063
                     /gene="gcvT"
                     /locus_tag="BAB2_0513"
                     /db_xref="GeneID:3828234"
     misc_binding    503732..503811
                     /gene="gcvT"
                     /locus_tag="BAB2_0513"
                     /note="gcvT riboswitch"
                     /bound_moiety="glycine"
     misc_binding    503815..503912
                     /gene="gcvT"
                     /locus_tag="BAB2_0513"
                     /note="gcvT riboswitch"
                     /bound_moiety="glycine"
     CDS             503960..505063
                     /gene="gcvT"
                     /locus_tag="BAB2_0513"
                     /EC_number="2.1.2.10"
                     /note="catalyzes the transfer of a methylene carbon from
                     the methylamine-loaded GcvH protein to tetrahydrofolate,
                     causing the release of ammonia and the generation of
                     reduced GcvH protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system aminomethyltransferase
                     T"
                     /protein_id="YP_418703.1"
                     /db_xref="GI:83269412"
                     /db_xref="GeneID:3828234"
                     /translation="MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPITYPLGVMKEHL
                     HTRDHAGLFDISHMKLVEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLD
                     DLIVTRLGEDRFMVVANAGNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAKAVI
                     TDAGLPGADLAFMSGFEPKQGWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVE
                     WIGLAARDSLRLEAGLCLHGQDITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAI
                     AKGASAKRVGLKPEGRQPVRAGADLFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASL
                     ATPGTRVFADVRGNKVPVDVHALPFTPHRYRKG"
     mi