GenomeNet

Database: RefSeq
Entry: NC_007624
LinkDB: NC_007624
Original site: NC_007624 
LOCUS       NC_007624            1156948 bp    DNA     circular CON 01-MAR-2015
DEFINITION  Brucella melitensis biovar Abortus 2308 chromosome II, complete
            sequence, strain 2308.
ACCESSION   NC_007624
VERSION     NC_007624.1  GI:83268957
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000054005.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Brucella abortus 2308
  ORGANISM  Brucella abortus 2308
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Brucellaceae; Brucella.
REFERENCE   1  (bases 1 to 1156948)
  AUTHORS   Chain,P.S., Comerci,D.J., Tolmasky,M.E., Larimer,F.W.,
            Malfatti,S.A., Vergez,L.M., Aguero,F., Land,M.L., Ugalde,R.A. and
            Garcia,E.
  CONSRTM   Microbial Genomics Group, Lawrence Livermore National Laboratory,
            and the Genome Analysis Group, Oak Ridge National Laboratory
  TITLE     Whole-genome analyses of speciation events in pathogenic Brucellae
  JOURNAL   Infect. Immun. 73 (12), 8353-8361 (2005)
   PUBMED   16299333
REFERENCE   2  (bases 1 to 1156948)
  AUTHORS   Larimer,F.
  CONSRTM   Microbial Genomics Group, Lawrence Livermore National Laboratory,
            and the Genome Analysis Group, Oak Ridge National Laboratory
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2006) Larimer F., Oak Ridge National Laboratory,
            1 Bethel Valley Road, Bldg 5700 A201 Oak Ridge, TN 37831, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Submitted on behalf of the Microbial Genomics Group, Lawrence
            Livermore National Laboratory, and the Genome Analysis Group, Oak
            Ridge National Laboratory;
            chain2@llnl.gov, larimerfw@ornl.gov.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 02/26/2015 10:37:00
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 458994)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 3,190
            CDS                          :: 3,099
            Pseudo Genes                 :: 23
            rRNAs                        :: 9 ( 5S, 16S, 23S )
            tRNAs                        :: 55
            ncRNA                        :: 4
            Frameshifted Genes           :: 17
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1156948
                     /organism="Brucella abortus 2308"
                     /mol_type="genomic DNA"
                     /strain="2308"
                     /db_xref="taxon:359391"
                     /chromosome="II"
     gene            complement(1..60)
                     /gene="ctRNA"
                     /locus_tag="BAB_RS26370"
                     /db_xref="GeneID:3828139"
     misc_RNA        complement(1..60)
                     /gene="ctRNA"
                     /locus_tag="BAB_RS26370"
                     /product="antisense RNA, repressor of repC"
                     /db_xref="GeneID:3828139"
     gene            155..1348
                     /locus_tag="BAB_RS26375"
                     /old_locus_tag="BAB2_0001"
                     /db_xref="GeneID:3827833"
     CDS             155..1348
                     /locus_tag="BAB_RS26375"
                     /old_locus_tag="BAB2_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006090962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_002966577.1"
                     /db_xref="GI:489056440"
                     /db_xref="GeneID:3827833"
                     /translation="MEIQLASTPFGSRRMSFALLAAQKKARQIPQGAAADKWQLHRWL
                     CEAKTILGINDRSLAVLSALLSFYPEVTLTGEGNLVVFPSNKQLALRAHGMADATLRR
                     HLAALVEAGLIARQDSPNGKRYARRAKGGELQIAFGFSLAPLLARAPEFEAAAEEIKT
                     AKAQLREMREQLTLLRRDIAKLIEFALIEGLEGPWAHLNQRFRDIVEAIPRRADVQEL
                     AMLVEQMREIRENVDKLLKTNKKAENLSGNESQNERQLNESKPDSHFDETALSHEDQR
                     VFENSQVQKEPSISLDMVLRACPEIETYASGSIRIWQDLIETAGKVRIFLGIDNKLYD
                     MATKTLGIHNAAITIAYILQRYDHIRSAGGYLRILSEKAASGAFSIKPLMMSAMCNRK
                     QPARC"
     gene            1551..1814
                     /locus_tag="BAB_RS26380"
                     /old_locus_tag="BAB2_0002"
                     /db_xref="GeneID:3827437"
     CDS             1551..1814
                     /locus_tag="BAB_RS26380"
                     /old_locus_tag="BAB2_0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968808.1"
                     /db_xref="GI:489058725"
                     /db_xref="GeneID:3827437"
                     /translation="MRRQIACAKSLFHFEPAACMQPALESAAAKTAARLWNVAGLQLK
                     FLCSGRGEQAQEKQDATPDGEHPEYLIGQVVNHVCDPKIDESA"
     gene            2092..3033
                     /locus_tag="BAB_RS26385"
                     /old_locus_tag="BAB2_0004"
                     /db_xref="GeneID:3827439"
     CDS             2092..3033
                     /locus_tag="BAB_RS26385"
                     /old_locus_tag="BAB2_0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_002967153.1"
                     /db_xref="GI:489057029"
                     /db_xref="GeneID:3827439"
                     /translation="MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLG
                     GKGANQAVAVAKLGGAIRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAI
                     IQVEETGQNTIAVCAGANARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVR
                     AAGGTVLLDPAPVGDASQMADLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLL
                     ERGPKIVILKLGSRGALLITADEVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPL
                     HDCVRYSSAAGAIAVTRVGAGAAAPTAREVEELIGRA"
     gene            complement(3110..4045)
                     /locus_tag="BAB_RS26390"
                     /old_locus_tag="BAB2_0005"
                     /db_xref="GeneID:3827440"
     CDS             complement(3110..4045)
                     /locus_tag="BAB_RS26390"
                     /old_locus_tag="BAB2_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966573.1"
                     /db_xref="GI:489056436"
                     /db_xref="GeneID:3827440"
                     /translation="MARKIIIDTDPGQDDAVAILLALASPELDILGITAVAGNGPLAR
                     TEVNARTVCEVAKKPDTKVFAGSIRPLVRPLVTAENVHGKTGLDGYDLPAPTMPLQAQ
                     HGVDFIIETLMKEEPGTVTLCPIGPLTNIASALIRESKIAGRVKEIVLMGGGYFEGGN
                     ITPSAEFNIYVDPHAASVVFSSGIKITMLPLDVTHKVLTTEKRIAAIRNIGSHVGEVV
                     AAWLEFFERYDEAKYGTDGAPLHDPNVIAYLIKPELYSGRACNVEIEINSELTIGETV
                     VDWWEVTDRPKNAFFIKDVDADGFFSLLTERLATL"
     gene            complement(4131..4910)
                     /locus_tag="BAB_RS26395"
                     /db_xref="GeneID:23672478"
     CDS             complement(4131..4910)
                     /locus_tag="BAB_RS26395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002968809.1"
                     /db_xref="GI:489058726"
                     /db_xref="GeneID:23672478"
                     /translation="MTTVLAQILDPHFIGTILRVATPLLLAALVVGALLGWLMSLSVN
                     RLGTDLIMTGIALNIAAAAATTLGLYLATGDKGMSGALKSGALPSLAVPFIGNIHVLT
                     FAALLAVPAVSLLMMRTRFGLHLRATGVDPKSARAAGIQTGRVQMMALILSGLFGGAA
                     GAYLSLGYVTWFAQNMTAGRGFIAIAAEVMGQGTAWGTLVASLVLAAAESIAITLQSL
                     GLPFELMQMIPYLVPVIVLTVHAARRQRRARRQITPETQET"
     gene            complement(4907..5986)
                     /locus_tag="BAB_RS26400"
                     /old_locus_tag="BAB2_0007"
                     /db_xref="GeneID:3827442"
     CDS             complement(4907..5986)
                     /locus_tag="BAB_RS26400"
                     /old_locus_tag="BAB2_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002966571.1"
                     /db_xref="GI:489056434"
                     /db_xref="GeneID:3827442"
                     /translation="MRRFIAYLIPFFLTVLVIGVIMAVLLVPLALMQDNPAAILKTFF
                     LGPFGSIRHMGNVVEAATPIMLTGLAITILFRSGLFNLGAESGFFLGALGAVAGAVLL
                     PSLGWFSLPVAILCGAVAGSFACTIPAALRLRFGASEMVTSLVLNYAFLFLGLFVLNY
                     VIRDPNAGGMMSLRIPADAKLDRLLAGTRLNSGSIIAVLACIAGGIWLYWTRSGLNIR
                     IAGSSPGFANHLGLPLKGIIMRAQIVGGLVAGMAGALEVLGLHARFAWLDLPGYGWTG
                     LVVAILARENPFLLIPSALFLGFVQVGGDLLARNMNIPTEVVGLVTAAIMVGATASVI
                     HNHPTVLRLIRSLRNRDGEQAGVQA"
     gene            complement(6048..7619)
                     /locus_tag="BAB_RS26405"
                     /old_locus_tag="BAB2_0008"
                     /db_xref="GeneID:3827443"
     CDS             complement(6048..7619)
                     /locus_tag="BAB_RS26405"
                     /old_locus_tag="BAB2_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_002967154.1"
                     /db_xref="GI:489057030"
                     /db_xref="GeneID:3827443"
                     /translation="MEKQAETSEGGDAIVAFRPIVAFRDVSKIYPNGTVALRDVSFSI
                     RAGSIHAICGENGAGKSTLMKILFGIENATAGEIVVDGKHIASWSPEDAAAQGIGMVH
                     QHFSLVPTLTVTENIILGHEPVKAGLIDRAGARKMVETLMQQYDLHADPDAITGTLSV
                     AAQQKVEILKALARRTRLLILDEPTAVLSPPEIEELMRRLKSLRDDGITILFISHKLN
                     EVRELAESVTVLRAGAVAGTEKLADVPDDAIMQMVMGHAVDIPKRAHQRGPGRTVLEM
                     KDVTTAAPDPADRIRSVSLTIGAGEIIGVAGVDGSGQRGLVSVLSGLAVAASGTISLN
                     GVDMLRADTASWRKKGLAYLPADRFSQGGAPGLSLTENAIAGAGSVTADRQIFRGPFL
                     RWSAIKARVSGMIRQYSVRAGAITERLDSLSGGNAQKLIAARELATNPKFLIADQPTR
                     GIDVSAAAFLHRRIDEVAQGGCAVLLVSADLDELLRLSDRIVVLFNGRIATILDNGPE
                     ITPAVLGPYMLGTRA"
     gene            complement(7622..8728)
                     /locus_tag="BAB_RS26410"
                     /old_locus_tag="BAB2_0009"
                     /db_xref="GeneID:3827444"
     CDS             complement(7622..8728)
                     /locus_tag="BAB_RS26410"
                     /old_locus_tag="BAB2_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine nucleotide translocator 1"
                     /protein_id="WP_002969020.1"
                     /db_xref="GI:489058941"
                     /db_xref="GeneID:3827444"
                     /translation="MIKSTRRGIIHLAFALAASTAIGTFATSAAEAKDKIMLIVNGTL
                     GDKSFFDSAANGMKMIKDKYGDEVETRILEIGDDPTKWEPVLLDASEQDWDLIIAGTY
                     QMAETVGSVAQQYPDKKYILYDASVPYEEGGYDNVYSIQYKQNEGSYLGGLLAASLLK
                     EGKLGDGAKNLGFLGGMDIPVINDFLVGYIAGAQSVIPDAKIAVSYAGSFMDAAKGKE
                     LGLAQYRSGVSLGFVVASQTGLGQLSAAKETGKYVLGVDSDQEAIFKDSDPAIAKQVV
                     SSVLKNIDVSLLQAYERYKAGNLPFGKAEALGLKEGAVGIVQDGNMATMATPDIKDAI
                     KKASDEISEGKITVPTTFGMSTEDLNAIRNKVRP"
     gene            8972..9580
                     /locus_tag="BAB_RS26415"
                     /old_locus_tag="BAB2_0010"
                     /db_xref="GeneID:3827445"
     CDS             8972..9580
                     /locus_tag="BAB_RS26415"
                     /old_locus_tag="BAB2_0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_002968810.1"
                     /db_xref="GI:489058727"
                     /db_xref="GeneID:3827445"
                     /translation="MRKAAVLSVLGFLAASQVMVENGWAEDGWKAVEIVKPYAIAGTT
                     PPELYESIGARGPKIGERRVIAHTSYVLTWDREFDRSNGACTVVSATPRLRITYMLPN
                     PSQTLAPPVKERWDRFYDGIRRHELVHGDHAKAMTREIVRRTVGLSVPNDPKCRKIRK
                     VLAKEITDMVQVQRAQGRDFDHVEMGNGGNVQQLILTFLNGN"
     gene            complement(9552..10292)
                     /locus_tag="BAB_RS26420"
                     /old_locus_tag="BAB2_0011"
                     /db_xref="GeneID:3827446"
     CDS             complement(9552..10292)
                     /locus_tag="BAB_RS26420"
                     /old_locus_tag="BAB2_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_002967156.1"
                     /db_xref="GI:489057032"
                     /db_xref="GeneID:3827446"
                     /translation="MAEQPLAHETAWLAPGAHGVSVITPWADLAADCCFVMARYSASK
                     PLIDPSIPAPARAAPRRKAEFVAGQACAREALRLAGGPAVMPGRGDDHAPIWPPGMVG
                     SISHSKGCAIAVAARQSRYLGLGIDIERLQTESSARKIAPQILGESELRQLPEAGRAF
                     LVSLAFSAKESLFKALYPAVQQFQSFHAAAFSFDGDRQQACLELAVDWSAQWRRGQRF
                     PIRFFCRDGFILTCTAIAAISCRSEMSG"
     gene            complement(10267..11043)
                     /locus_tag="BAB_RS26425"
                     /old_locus_tag="BAB2_0012"
                     /db_xref="GeneID:3827447"
     CDS             complement(10267..11043)
                     /locus_tag="BAB_RS26425"
                     /old_locus_tag="BAB2_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
                     /protein_id="WP_002966566.1"
                     /db_xref="GI:489056429"
                     /db_xref="GeneID:3827447"
                     /translation="MVEAKSYPASWRFAGKRVIVTGAAQGIGRRVAEHFLAEGATVIG
                     LDRQAGEADAPFRLIRLDITDAAEVRAVSDGLKAEGKPLDILVNVAGVLKLGNSDRLS
                     AEDWKTCMDVNASGPFHLLSQWVPVFRDQRHGAIVNVASNAAHVPRLNMAAYCASKAA
                     LASFSHCVALELAPYGVRCNVVSPGSTRTAMLGAMLNDPSGEAQLVRGLPEQFKLGIP
                     LGKIAMPDDIANVILFLASDQAGHVTMQDIVVDGGATLGA"
     gene            complement(11043..11915)
                     /locus_tag="BAB_RS26430"
                     /old_locus_tag="BAB2_0013"
                     /db_xref="GeneID:3827448"
     CDS             complement(11043..11915)
                     /locus_tag="BAB_RS26430"
                     /old_locus_tag="BAB2_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172413.1"
                     /note="2,3 dihydro-2,3 dihydroxybenzoate synthase;
                     catalyzes the formation of 2,3 dihydro-2,3
                     dihydroxybenzoate and pyruvate from isochorismate; with
                     Ent DEF is involved in enterobactin synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_002967157.1"
                     /db_xref="GI:489057033"
                     /db_xref="GeneID:3827448"
                     /translation="MAIPKIADYPMPQKAGFPANKTNWQPDPARAVLLIHDMQRYFLR
                     FYDANGPLMGDLIGNLVRLRNWAHENGVPVVYTAQPHEQPAGDRALLNDMWGPGLPAA
                     APEQQLIVDKLTPGATDTVLAKWRYSAFQRSDLLQRMKDWNRDQLIIGGIYAHIGCMV
                     TAIDAFMNDIQPFMVGDAVADFSEEEHRLALKYVATRCGAVIDTASLIRKPATETTRD
                     WLQKRVLELIEDETELDPQENLILYGLDSLQVMKLSAELKERGVAVGFDDLARVPTLA
                     AWWDLIETKQKAAA"
     gene            complement(11967..13586)
                     /gene="entE"
                     /locus_tag="BAB_RS26435"
                     /old_locus_tag="BAB2_0014"
                     /db_xref="GeneID:3827449"
     CDS             complement(11967..13586)
                     /gene="entE"
                     /locus_tag="BAB_RS26435"
                     /old_locus_tag="BAB2_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005507.1"
                     /note="bifunctional 2,3-dihydroxybenzoate-AMP
                     ligase/S-dihydroxybenzoyltransferase; activates the
                     carboxylate group of 2,3-dihydroxy-benzoate forming
                     (2,3-dihydroxybenzoyl)adenylate then catalyzes the
                     acylation of holo-entB with 2,3-dihydroxy-benzoate
                     adenylate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthase subunit E"
                     /protein_id="WP_002969261.1"
                     /db_xref="GI:489059189"
                     /db_xref="GeneID:3827449"
                     /translation="MTIEFTHWPPARERLYREKGYWIDKPLTRALEEQAAMRPDAPAI
                     LYGERRFTYAELDRLSSNLASRLAAAGIGKGDTALVQLPNIAEFYIVFFALMKAGIAP
                     VNALFSHRKLELGAYASQIEPRLLIGSRQHELFMDDAFARDLGKNLSAPLLTLFAGEA
                     DPASSLDHWIATPADKAVPFSPTGAGEVAFFQLSGGSTGTPKLIPRTHNDYDYSVRAS
                     AEICALTPQTRFLCALPTAHNYPMSSPGALGVFHAGGCVVMAPNPEPLNCFSIIERHG
                     VNMVALVPPAVALWLQAAPDHLAALSSLKLVQVGGASFAEALARQVPQVLGCKLQQVF
                     GMAEGLVNYTRLDDPDEIVFTTQGRPISPDDEIRIVDEDGEPVAEGQPGMLATRGPYT
                     FCGYYRSPEHNAQVFDSEGFYYSGDVVQRTPEGYLRVVGRVKDQINRGGEKVAAEEIE
                     NLILLHPDVTHAALVAMQDELLGEKSCAFIVSRNPDLKPPVLRRHLLALGVAEYKLPD
                     RIRLIETMPLTAVGKIDKKHLRKLSSPSSPG"
     gene            complement(13693..14868)
                     /locus_tag="BAB_RS26440"
                     /old_locus_tag="BAB2_0015"
                     /db_xref="GeneID:3827450"
     CDS             complement(13693..14868)
                     /locus_tag="BAB_RS26440"
                     /old_locus_tag="BAB2_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase EntC"
                     /protein_id="WP_002966563.1"
                     /db_xref="GI:489056426"
                     /db_xref="GeneID:3827450"
                     /translation="MRTSALKYPTSDADHLIENNTYFSFSSGNLKLAASGMREVIATP
                     AIGGSNPDSTFQRAIAQAFERAARAGQRNPIVVGAIPFDPGEPSCLYVPEEMDWQERE
                     PASGASAAAMPQLAGQRSVPDEAGFKHAVEHAIINFRLSDVRKAVLSVMRELTFADDI
                     DVDAMLANLRAQNHDGYQFRVPLPGGGALVGVSPELLIHKDKGKIVSNPLAGSAKRMA
                     DPEADRKNADRLAKSEKDHYEHRLVIEDIRARLQPICTELDIPERPSLIHTAALWHLS
                     TRIEGRLHDPDMTALQLACLIHPTPAVCGFPTERARRLIRFVEPFERGLFTGMVGWSD
                     AEGNGEWVVTIRCGTVKGNLVRLFAGAGIVEASSPDSEWAEVQTKLGTMLRACGLSA"
     gene            15009..16349
                     /locus_tag="BAB_RS26445"
                     /old_locus_tag="BAB2_0016"
                     /db_xref="GeneID:3827451"
     CDS             15009..16349
                     /locus_tag="BAB_RS26445"
                     /old_locus_tag="BAB2_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006076672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="condensation protein"
                     /protein_id="WP_002966562.1"
                     /db_xref="GI:489056425"
                     /db_xref="GeneID:3827451"
                     /translation="MARIDFADGWMPLTLPQLDFWEEFSFHPDQPVSTVAHCVEIEGD
                     VDVEKLLRAISQTVREAEVLSIRFSDEKEQGRPVQLCDPAHMPDVDFVDLSAFPDPRA
                     EAGRRMETDLSAPLDLRRDRMSAHALYRIGARQYIWYIRAHHIIIDGYGLALIEQRCG
                     QLYSHFCGQGESGHPFHPFASFIHEEDAYRASPRWEADRKFWQDYLDGPVRLPILDRG
                     AEDYGEAGYHHDVAFRDDISIGLRAMAKATDIGWPDLLVLLSGLYLSRMLPMQGEDEG
                     LTLWLPFMSRWGSVGAHMPGLLVNILPFHLEFDSGETLFSALRRNMDMLKKHRLHGRY
                     RIEQISADRGLVSGSRFFFSPLINVLPFSTPQFAGCRVAREVLANGPGDGFNLTYRAD
                     VDGAGLTLKIEAASNMMDAQTFARIAAGLPAFLKASLAPHLIERPVSDLRRRLP"
     gene            complement(16397..17185)
                     /locus_tag="BAB_RS26450"
                     /old_locus_tag="BAB2_0017"
                     /db_xref="GeneID:3827452"
     CDS             complement(16397..17185)
                     /locus_tag="BAB_RS26450"
                     /old_locus_tag="BAB2_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_002966561.1"
                     /db_xref="GI:489056424"
                     /db_xref="GeneID:3827452"
                     /translation="MTGPRLSRRRFLTFTGMAGSAVLLSGCDAFDYLGSDDNAVRQVL
                     EKANDLSYTVQHKLEGPGALAREYGESEIRQGQKPNGETNPSTEEYDRLRENAFADYR
                     LEVHGLVEKPLSFSLNELHNMPARTQITRHDCVEGWSTIAKWTGVPLGHILALAKPKA
                     GAHYVVFHCFDEVDTPQGPDLFYGSIDLIDAQHPQTILAYGLNGSALPVANGAPLRVR
                     VERQLGYKMSKYVKSIELVSSFAAIQGGRGGYWEDQGYDWYGGI"
     gene            complement(17182..17991)
                     /locus_tag="BAB_RS26455"
                     /old_locus_tag="BAB2_0018"
                     /db_xref="GeneID:3827453"
     CDS             complement(17182..17991)
                     /locus_tag="BAB_RS26455"
                     /old_locus_tag="BAB2_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HupC"
                     /protein_id="WP_002968213.1"
                     /db_xref="GI:489058113"
                     /db_xref="GeneID:3827453"
                     /translation="MGQLIYRQRLLTRLTHWIWAASIFFLLLSGLQIFNAHPTLYLGN
                     ESGFEYENAVLSIYAVPGDNGPQGRLDILGKTFDTTGVLGVSGTMETPRRQAFPPALT
                     IPSYRDLATGRVVHFFFAWVLVATLLLWFTSSLFNGHLKDISPSFTDIRSLPRDFVEH
                     LKFRFQHGKSYNPLQKLSYFLVLFGLFPLIVATGLAMSPGADSILPLSEWLGGRQTAR
                     TLHFVAMLLLVAFFIVHIAMVLAAGPFNELRSMISGWYRIDRTDEKTEKQS"
     gene            complement(18052..18321)
                     /locus_tag="BAB_RS26460"
                     /old_locus_tag="BAB2_0019"
                     /db_xref="GeneID:3827454"
     CDS             complement(18052..18321)
                     /locus_tag="BAB_RS26460"
                     /old_locus_tag="BAB2_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969263.1"
                     /db_xref="GI:489059191"
                     /db_xref="GeneID:3827454"
                     /translation="MTIKHNIIAFSALALIAGFSLTPAAFAEDAMKTDHMKSDAMKSD
                     NMSKDAMGKEDAMKGDAMHKDSKKMKKHDAMKGDAMKGDAMKSGQ"
     gene            18518..19030
                     /locus_tag="BAB_RS26465"
                     /old_locus_tag="BAB2_0020"
                     /db_xref="GeneID:3827455"
     CDS             18518..19030
                     /locus_tag="BAB_RS26465"
                     /old_locus_tag="BAB2_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006151701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_002972219.1"
                     /db_xref="GI:489062192"
                     /db_xref="GeneID:3827455"
                     /translation="MLLALDGNSAAYRTLLEELSRLLKAYFVRRLFGGRVSEAEDLVQ
                     ETLLAIHTRRMTYDREMTFLPWVNAIARHKLVDHLRRQGRHDTDVLDEDIAIPGEAAN
                     VEARMDVDRMLGGVSERTAGLIRKVKIEGQSIDEAARAGDMSQSAVKVAIHRGLATLA
                     QRFGGKKDDR"
     gene            19020..19655
                     /locus_tag="BAB_RS26470"
                     /old_locus_tag="BAB2_0021"
                     /db_xref="GeneID:3827743"
     CDS             19020..19655
                     /locus_tag="BAB_RS26470"
                     /old_locus_tag="BAB2_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006238014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracytoplasmic function alternative sigma
                     factor"
                     /protein_id="WP_002966558.1"
                     /db_xref="GI:489056421"
                     /db_xref="GeneID:3827743"
                     /translation="MTDDLINRLTGELKPVSRHAMQRLLLGHALLGMVAGVVIMLAFL
                     GARHDLAAAMATPAFWSKLCYAALLLAVLLPALFALSRPLRQNLPWPALLLIFSCLGA
                     AAIYQWEEASPEVRPVLVWGYTALVCPWLIGLISLPTLASLLLAIRKLAPARPTLAGF
                     AAGLVSGGIGVLVYAFHCPESGLPFIALWYTLGIVGTGVLGALGGRFCLRW"
     gene            complement(19701..20441)
                     /locus_tag="BAB_RS26475"
                     /old_locus_tag="BAB2_0022"
                     /db_xref="GeneID:3827744"
     CDS             complement(19701..20441)
                     /locus_tag="BAB_RS26475"
                     /old_locus_tag="BAB2_0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002967158.1"
                     /db_xref="GI:489057034"
                     /db_xref="GeneID:3827744"
                     /translation="MKEIATRAAGRATGHLPEEIARQIEKRILDGEFSVGSKLPSERE
                     LSVEYGVSRPVVREALSQLKLDGLVEARAGSGVFVIDESNQKAFRIQPLVVEEAQSLE
                     QLMELLVAIEVAATRIAAVNRTPEDLKQIKRALIGLEYAIISDKLRDEEDYAFHDAIV
                     IATHNPHFIALCKHLEYGARHVIRQARTNTRSNLKDMLDAVQDEHKAIYEAIELGDPE
                     QAGIAAERHLRNATQRMKVYLSADNRTN"
     gene            20724..21974
                     /locus_tag="BAB_RS26480"
                     /old_locus_tag="BAB2_0023"
                     /db_xref="GeneID:3827745"
     CDS             20724..21974
                     /locus_tag="BAB_RS26480"
                     /old_locus_tag="BAB2_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006014926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein homolog 4"
                     /protein_id="WP_002966556.1"
                     /db_xref="GI:489056419"
                     /db_xref="GeneID:3827745"
                     /translation="MSLKVFLQAGVACAALSLAGAAGASAEPLKIALVETLSGPQAST
                     GLLYRAAVLYQLGKINEAGGFNGEKIQILEYDNQGGPVGAADRVKAAIADGAQIIVQG
                     SSSAVAGQITEDVRKYNLRNKGKEVLYLNLGAEALELTGSKCHFYHFRFSPNAAIRFK
                     TVAQGMKDKGILGERAYSINQNYSWGVDVENTVVANAKEIGYEVVDKTLHEVNKIQDF
                     SPYVAKIQAANVDTVFTGNWSNDLLLLMKAASGAGLKAKFATSFLDQPGNIGNAGAIA
                     EGHIVSTPFNPEANGEASMAFAEDYKKVTGHYPSYVEPAAVFGLQLFGEALKNVKPGE
                     GKINTTDIALAIENASVKTPMGDYSMRSDDHQAKFPMVVQEVSKKARIKADGTEYGFL
                     PFKTFTGDESIDPVQESCSMKRPG"
     gene            22064..23005
                     /locus_tag="BAB_RS26485"
                     /old_locus_tag="BAB2_0024"
                     /db_xref="GeneID:3827746"
     CDS             22064..23005
                     /locus_tag="BAB_RS26485"
                     /old_locus_tag="BAB2_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002966555.1"
                     /db_xref="GI:489056418"
                     /db_xref="GeneID:3827746"
                     /translation="MDQILFAVLNGAIYGLLLFMVSAGLTLIFGMMGVLNFAHASFYM
                     MGAYFAYTLQPLTGFWLAILIAPVIVGIVGVLVERFILRRVHAFGHAHELLVTFGLSV
                     VIAEVIKIFYGNFAVEYRIPAALQFSAFDLGGVSYPFYRLFIGAVALVMFLLIYLLLT
                     RTRIGIVVRSAIYRPRMVEALGHNVPLVFMGVFGVGAFLAGLAGSVAGAFYTTNPNMA
                     LELGVMVFVVVVVGGLGSLGGAMFASLLIGILSSVAVGVKVSIASLLDYVGLGDYARE
                     IGGVLTLEVSSIAATLPFFLMLIVLLVRPSGLFGAKE"
     gene            23009..24229
                     /locus_tag="BAB_RS26490"
                     /old_locus_tag="BAB2_0025"
                     /db_xref="GeneID:3827747"
     CDS             23009..24229
                     /locus_tag="BAB_RS26490"
                     /old_locus_tag="BAB2_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_002966554.1"
                     /db_xref="GI:489056417"
                     /db_xref="GeneID:3827747"
                     /translation="MTIKQSVVALLVVALLVALPYLVSESMTNAAIQMLIAALFATAF
                     SLLCGQAGMLSFGHAAYFGLGSFAAVHVMNAFGGEGLLPTPLLPLAGAGVGLLSGLVA
                     GWFSTKRTGVYFAMITLALAELLHALAPHLKGTFGGEAGVSSFRMPAWGFDFGSTTEV
                     YYLALAWVVGSILLLFLLTLTPFGRVTVGLRENTHRLRFLGYNVHVLGTLVFAISAMF
                     AGIAGALQAINIEAANYVVFEAGISTAVVLNSFIGGVGTFFGPAIGAAAMTFFGHVTS
                     DVTRSWLLYQGLIFVLVMMFLPRGLVGEAVERFRNPKGTGISLGHALGRLVALLVTAA
                     GTIMIVELVQRFFSSDYKALASAGNWPPVTFLGREWLPFAVSTWLIPLALFAAGIALL
                     TIVNRHRAKAKGEA"
     gene            24229..24981
                     /locus_tag="BAB_RS26495"
                     /old_locus_tag="BAB2_0026"
                     /db_xref="GeneID:3827748"
     CDS             24229..24981
                     /locus_tag="BAB_RS26495"
                     /old_locus_tag="BAB2_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_002971304.1"
                     /db_xref="GI:489061266"
                     /db_xref="GeneID:3827748"
                     /translation="MTKDILVLDQLNKSFGPAHIIRGVNLAVRDGERHAVIGPNGAGK
                     STLFHLISGNFTPSSGSIRFQGEEIGGLTPAAVNRKGLARSFQITNIFPGLTVFENIR
                     LAVMRRYKVQFTFWRPVSSMRKVTAEVESLLEQVRLTARAYTLASQLSYSEQRSLEIG
                     MTLASDPRLIILDEPMAGMSQEETDYTVGLIREITQNRTLMIVEHDMYVVFTLADRIS
                     VLVYGEIIATGTPKEIRENARVREAYLGEEAH"
     gene            24981..25697
                     /locus_tag="BAB_RS26500"
                     /old_locus_tag="BAB2_0027"
                     /db_xref="GeneID:3827749"
     CDS             24981..25697
                     /locus_tag="BAB_RS26500"
                     /old_locus_tag="BAB2_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyltransferase"
                     /protein_id="WP_002966552.1"
                     /db_xref="GI:489056415"
                     /db_xref="GeneID:3827749"
                     /translation="MAAENILDVRELHAHYGKSHILQGVTFDLKKGEAISLLGRNGSG
                     RSTTMKAIMGLVPPTSGEVLLNGKNLAGERSFKICRAGIGFVPEERETFLNLTVDENL
                     QMGIQRGAEGATRWTVEQMFDYFPRLKERRNTRAGSLSGGEQQMLTMCRTLLGNPLVM
                     LIDEPTEGLAPKIVSVVGEMIKDINRQGVSVVLVEQKLTIVLKVSSRVCVMGHGRIVF
                     EGTPDELTADEKLMEEWLAV"
     gene            25749..26231
                     /locus_tag="BAB_RS26505"
                     /old_locus_tag="BAB2_0028"
                     /db_xref="GeneID:3827750"
     CDS             25749..26231
                     /locus_tag="BAB_RS26505"
                     /old_locus_tag="BAB2_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bleomycin resistance protein"
                     /protein_id="WP_002966551.1"
                     /db_xref="GI:489056414"
                     /db_xref="GeneID:3827750"
                     /translation="MTQMTAPLEVGLAVRDLKRMRAFYEGALGLPFVSEIHVGGEKAK
                     VAAMSPDGYTVVRLQTAKGERIKLLQPDRLPQAGQAETGLILERAGASYLTFIVDDLK
                     ALVERLIEHGAQPLTGRDPIEVRPGTWLAFLHDPEGHIVEIVQYDDIAAYRPDLAEEK
                     "
     gene            26235..26972
                     /locus_tag="BAB_RS26510"
                     /old_locus_tag="BAB2_0029"
                     /db_xref="GeneID:3827751"
     CDS             26235..26972
                     /locus_tag="BAB_RS26510"
                     /old_locus_tag="BAB2_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_002966550.1"
                     /db_xref="GI:489056413"
                     /db_xref="GeneID:3827751"
                     /translation="MKFEFENRTLVLTGANGGIGRAIAELFHASGANLVLTDLDREGL
                     DAFAASLGSPERIATIKADASSADDAEKTVALAMERFGGIDFLVPSAGIYQAKPFAEM
                     SDADWHRTISINLDGVFYLCKRALPALKEDSSIVTLASLAAYRGAYVNAHYGATKGAM
                     VSMTRALSRELAPKTRVNGVSPGIIETPMTSELLKTRMDETMTQTPLKRLGKPSEIAS
                     VIAFLCSPAASFVTGETIQVNGGIYMA"
     gene            26990..27742
                     /locus_tag="BAB_RS26515"
                     /db_xref="GeneID:23672479"
     CDS             26990..27742
                     /locus_tag="BAB_RS26515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_004687586.1"
                     /db_xref="GI:490825496"
                     /db_xref="GeneID:23672479"
                     /translation="MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAK
                     AQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQP
                     EAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKG
                     AIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGET
                     SEVVDPVVFLASPMASYITGTILPVDGGFLAA"
     gene            27852..30041
                     /locus_tag="BAB_RS26520"
                     /old_locus_tag="BAB2_0031"
                     /db_xref="GeneID:3827753"
     CDS             27852..30041
                     /locus_tag="BAB_RS26520"
                     /old_locus_tag="BAB2_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006210399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002968811.1"
                     /db_xref="GI:489058728"
                     /db_xref="GeneID:3827753"
                     /translation="MPEYKDLVPHSFWREIVPTTEDRAAFDLALGGTMLSQMHLIRAF
                     EAKVLELAGQGLVHGPAHSAIGQEGGAVGSAVSMRPSDQINGSHRAHHQFLAKALGYV
                     AQKGIDPKAAFDQDIRTLAQRTLAEILGLSQGFCRGRGGSMHLRWAESGNLGTNAIVG
                     GGVPMAAGAAWAHRRAGKGDVVYTYFGDGATNIGSVLETMNLAAAWKLPICFFIENNR
                     YAVSTHVEEVTAEPRLSSRGLAFGIPSFKVDGMDPIAVWLASEEANAIMRAGNGPTII
                     EADVYRYFHQNGPLPGSAFGYRSKDEEAEWRGRDPLDALAKTLLERQALGEDAIKALR
                     ERCVSLMDEVAGQLIEMRDGKRRIIPSLWPEESFRDFGLRGDLSEFDGVRFEEQESFS
                     GKLVEDARFIDTVADVMARRMETDERVVVLGEDVHRLKGGTNGATRGLSADYPDRVLG
                     TPISENAFTGIAGGMAADGRVLPVIEFMYPDFMWVAADQVFNQIGKARHMFGGDSDMP
                     VVLRTKVAMGTGYGSQHSMDPAGIFATAPGWRIVAPSTPFDYVGLMNSALLCRDPVLV
                     LEHVDLYASKGAAPAEDFDYFIPLGKAKVVRPGSRVTVLTYLAMVAKTQAVVEALGVD
                     AEIIDLRSLDRAGVDWETIEASVRKTGNVLIVEQGASGTSYGGWLADELQRRCFDWLD
                     QPIARVHGAEASPSISKVLEAAAAARPQDIEAGLRAVMAAQGLPIEN"
     gene            30060..31325
                     /locus_tag="BAB_RS26525"
                     /old_locus_tag="BAB2_0032"
                     /db_xref="GeneID:3827754"
     CDS             30060..31325
                     /locus_tag="BAB_RS26525"
                     /old_locus_tag="BAB2_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="WP_002968812.1"
                     /db_xref="GI:489058729"
                     /db_xref="GeneID:3827754"
                     /translation="MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKA
                     TMELEAEVDGRIGQLLVKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAE
                     TPVAASPVPAAPAVSAPASGEVRHKASPLARRLAAELGVSLDGRAGSGARGRIVRIDV
                     ERAAASKPVPVAAAAAPVAAPAEASSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTT
                     VPHFYLNVDCEIDALLALRSQINEKREGSARISVNDFVIKASAAALRRVPDANVIWTD
                     EALLKLKDVDIAVAVATEGGLITPIIRSADQMSLGAISAQMKSLAARARENRLKPEEF
                     QGGGFSISNLGMYGVKSFSAIINPPQSAILAVGAGERRPIERNGELAFATMMSVTLSV
                     DHRAVDGALGAQLLAAFKAGIEDPMSLLV"
     gene            31426..32211
                     /locus_tag="BAB_RS26530"
                     /old_locus_tag="BAB2_0033"
                     /db_xref="GeneID:3827755"
     CDS             31426..32211
                     /locus_tag="BAB_RS26530"
                     /old_locus_tag="BAB2_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shkimate dehydrogenase"
                     /protein_id="WP_002966545.1"
                     /db_xref="GI:489056408"
                     /db_xref="GeneID:3827755"
                     /translation="MTVTGHTRVFAIIADPVHHVRTPQALNALFAARGYDGIVVPAAV
                     PASGLKYAAAALRAFGNWGGFIVTVPHKTEMPAFCDRLTPRAQAAGAVNVIRREADGS
                     LTGELLDGVGFVRGLANAGHDVKGRSVYLAGAGGAASAIAFALAEAGVVRLTVVNRSS
                     EKAGQLVARLKEHFPAGMFVSQGTPAGHDIIVNGTSLGLKEGDALPVDPQYLRPEMLV
                     AEVIMSPEVTPLLQIAKDSGCSIHPGKAMLDGQLAEMFDFFTR"
     gene            32469..32741
                     /locus_tag="BAB_RS26535"
                     /db_xref="GeneID:23672480"
     CDS             32469..32741
                     /locus_tag="BAB_RS26535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966544.1"
                     /db_xref="GI:489056407"
                     /db_xref="GeneID:23672480"
                     /translation="MRRREVRYEVYGNRSSGRARPASRVPGAEHGTIRPRPVAIWKAD
                     PSTGRIECHWTTDPNEVSAWLARSCFEQAGLIMAAVQQGRFGMPAH"
     gene            33090..35807
                     /locus_tag="BAB_RS26540"
                     /old_locus_tag="BAB2_0036"
                     /db_xref="GeneID:3827758"
     CDS             33090..35807
                     /locus_tag="BAB_RS26540"
                     /old_locus_tag="BAB2_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073184.1"
                     /note="P-type; involved in magnesium transport into the
                     cytoplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-transporting ATPase"
                     /protein_id="WP_002971302.1"
                     /db_xref="GI:489061264"
                     /db_xref="GeneID:3827758"
                     /translation="MNVAVRTANNKNFKKDERRLSMRAVREASNEIELTLANVGSRRD
                     GLTEGDAITRLYRDGPNEVARERRIPALVQFALAFKNPFIMVLVVLGAISAFTDIWLP
                     LETGEEADPTKVIIIAVMVLASALMRFIQEYRSGRAAEALKAMVRTTATVWRRVSAGT
                     SSAPREIPMRELVVGDIVQLSAGDMIPADLRLIESRDLFISQAVLTGEALPVEKYDTL
                     GAISEKSAMATASQDADMLDLPSICFMGTNVVSGTATAVVVATGQRTYFGSLAKAIVG
                     SRAQTSFDRGINSVSWLLIRFMLIMVPVVFLINGFTKGNWVEAMLFGLAVAVGLTPEM
                     LPMIVSSNLAKGAVAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDKIILEHHID
                     VSGKADDKVLRLAWLNSYHQSGVKNLMDQAVVSFANRVPEEVMRTARLYRKVDELPFD
                     FIRRRLSVVVEGVGGEHLLVCKGAVEEMLAICTTVRDGETVRALDAVTREKLIATARA
                     YNADGFRVLVVATREIPGAETSAQYRIADEAGLTVQGFLTFLDPPKETAGPAIAALAE
                     HGVCVKVLTGDNEIVTRKICREVGLEAGIPILGSEIEKLDDEALRVVAEERTVFAKLT
                     PLQKSRVLQALQANGHTVGFLGDGINDAPALRDADVGISVDSGADIAKESADIILLEK
                     SLIVLEEGVVTGRETFGNILKYLNMCASSNFGNVFSVLVASAFIPFLPMLAIHLLIQN
                     LMYDISQLALPWDKMDKEFLAKPRKWDARNIGRFMIWIGPTSSIFDITTFALMWYVFS
                     ANSPQMQSLFQSGWFIEGLLSQTLVVHMLRTQKIPFFQSTAALPVMLMSALIIALGIY
                     IPFSPIGEMVGLVPLPWAYFPWLAATLVSYCLVAQGMKVIYVRRFGQWF"
     gene            35779..36243
                     /locus_tag="BAB_RS26545"
                     /db_xref="GeneID:23672481"
     CDS             35779..36243
                     /locus_tag="BAB_RS26545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966541.1"
                     /db_xref="GI:489056404"
                     /db_xref="GeneID:23672481"
                     /translation="MCAVSGSGSDRGQRILGIGGVTSRRSPPHTQAHQRARKCSPLMR
                     KEGKCPIPLFVFVDTTQGANPPGGRRPGSPRRRGEPPLPGGSPQGLWQWMKGRMDRWI
                     CWAYTVLGTNLASITYWLSRQGLIGRRATFRLLRWTSALQARPVRRLRKASW"
     gene            36374..36577
                     /locus_tag="BAB_RS26550"
                     /old_locus_tag="BAB2_0038"
                     /db_xref="GeneID:3827760"
     CDS             36374..36577
                     /locus_tag="BAB_RS26550"
                     /old_locus_tag="BAB2_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966540.1"
                     /db_xref="GI:489056403"
                     /db_xref="GeneID:3827760"
                     /translation="MYHFRFSGGYKALPTAVPHRGTLVGSIAVATYLVLFALVVLFVV
                     PASQANGPLDGDTQWQGAQAGGK"
     gene            36579..37295
                     /locus_tag="BAB_RS26555"
                     /old_locus_tag="BAB2_0039"
                     /db_xref="GeneID:3827761"
     CDS             36579..37295
                     /locus_tag="BAB_RS26555"
                     /old_locus_tag="BAB2_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q57A43.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein MgtC"
                     /protein_id="WP_002966539.1"
                     /db_xref="GI:489056402"
                     /db_xref="GeneID:3827761"
                     /translation="MVWKPLAHTAACLAGAFLLGGLIGFERQFRHRLAGLRTNTLVAV
                     GAATFVVFSSLVSGDSSPTRVAAQIVSGIGFLGAGIIFKEGFNVRGLNTAATLWCSAA
                     VGVLCGAGLISHAAVATVFIIAVNALLRPLVQVLEFQAMRRGAFQPTYAIDIICHGDA
                     EAQVRALLLRDIGDHLHIHELESSNIEGTNRVEVSATVRADQRQDRLLEQIVGHLSLE
                     PRITSARWRIEDDSGGLSGL"
     gene            37370..38440
                     /locus_tag="BAB_RS26560"
                     /old_locus_tag="BAB2_0040"
                     /db_xref="GeneID:3827762"
     CDS             37370..38440
                     /locus_tag="BAB_RS26560"
                     /old_locus_tag="BAB2_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_002966538.1"
                     /db_xref="GI:489056401"
                     /db_xref="GeneID:3827762"
                     /translation="MLKTIIRRNVTGSTPKILLLACLTAAIFIVDTVTDYAIAAAVFY
                     TVVILLSARLLTGKAVTGLASTCIALSVISFAFTSKGAFYEGLINTGISIIAIIATTY
                     LGLKLVSAEIDVRESRERLLRLARMTTLGQLTSSIAHEVSQPLVAIEISASAGRRWLA
                     QSPPNNERAAAAIERISADSHRAIEILDRVRRLSRGEKPHVAPFDINEVVRDIVELAH
                     NEITRHDIALDLDLTPGLPMALADRVQIQQVIGNLVLNAIEAIQEKDPPVRSLKINTA
                     LTEGARLQVAVRDSGGGIAPADQERLFDAFWTTKKGGFGLGLTISRTIVESSGGTIAL
                     GSTTPHGTTILFEVPTTQETEI"
     gene            38437..39075
                     /locus_tag="BAB_RS26565"
                     /old_locus_tag="BAB2_0041"
                     /db_xref="GeneID:3827880"
     CDS             38437..39075
                     /locus_tag="BAB_RS26565"
                     /old_locus_tag="BAB2_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_002966537.1"
                     /db_xref="GI:489056400"
                     /db_xref="GeneID:3827880"
                     /translation="MNCAYERDPVVFIVDDDHSVRLGLVDLFASIGLKALCFASVNEF
                     LKHAREEVPACLILDVRMPGESGTEFHARMKGLDIRLPVIFITGHGDIAMGVKAIKDG
                     AIDFLAKPFRNQDLLDAVQQAIRTDRKRLREEHNQHRIIARYQTLNQGERAVFKLVVQ
                     GLMNKQIAAELDVAEVTVKVRRSHLMHKMRAKSLADLVRMATELNAQPVKEL"
     gene            complement(39273..39347)
                     /locus_tag="BAB_RS26570"
                     /old_locus_tag="BAB2_1166"
                     /db_xref="GeneID:3827797"
     tRNA            complement(39273..39347)
                     /locus_tag="BAB_RS26570"
                     /old_locus_tag="BAB2_1166"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(39313..39315),aa:Val,seq:gac)
                     /db_xref="GeneID:3827797"
     gene            complement(39461..39823)
                     /locus_tag="BAB_RS26575"
                     /old_locus_tag="BAB2_0042"
                     /db_xref="GeneID:3827881"
     CDS             complement(39461..39823)
                     /locus_tag="BAB_RS26575"
                     /old_locus_tag="BAB2_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002966536.1"
                     /db_xref="GI:489056399"
                     /db_xref="GeneID:3827881"
                     /translation="MKRILLAEDDNDMRRFLVKALEKAGYHVTHFDNGASAYERLQEE
                     PFSLLLTDIVMPEMDGIELARRATEIDPDLKIMFITGFAAVALNPDSDAPRDAKVLSK
                     PFHLRDLVNEIEKMLIAA"
     gene            40142..41032
                     /locus_tag="BAB_RS26580"
                     /old_locus_tag="BAB2_0043"
                     /db_xref="GeneID:3827882"
     CDS             40142..41032
                     /locus_tag="BAB_RS26580"
                     /old_locus_tag="BAB2_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="WP_002967161.1"
                     /db_xref="GI:489057037"
                     /db_xref="GeneID:3827882"
                     /translation="MSLERDFGSVPPFEVSAPAQQRIPFVFNSPHSGRHYPLSFVQAS
                     RLDAISIRNSEDCYVDELFASVMRLGAPLLKANFPRAFLDVNREPYELDPRMFAEPLP
                     PFANSHSARVAGGLGTVPRLVAEGQLIYPGRIPLAEALYRIEDLYKPYHAALDALLEA
                     TRQQFGYAVLIDCHSMPGGTSAGEIGSRPDFIVGDRFGRSCSERLTQAAIELLQDLGY
                     TVAHNKPYAGGFITEHYGRPAMACHALQIEVNRSLYVNEQNLHKLEGFEALCVALHHF
                     VSDLTSLPDDLFIAPPLAAE"
     gene            41194..41970
                     /locus_tag="BAB_RS26585"
                     /old_locus_tag="BAB2_0044"
                     /db_xref="GeneID:3827883"
     CDS             41194..41970
                     /locus_tag="BAB_RS26585"
                     /old_locus_tag="BAB2_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_002966534.1"
                     /db_xref="GI:489056397"
                     /db_xref="GeneID:3827883"
                     /translation="MLIDKAFFSEVAAAAAAQTLPRFRQLTEVDNKYSVGFDPVTEAD
                     RAAERAIRAVIGRTFPDHGILGEEYGAENTDRSHVWIIDPVHGTRAFISGLPVWGTLV
                     GLTVDGDARAGMMSQPFTGELFYSDGDGAYLQRGDGAPRRLCVRKNAVLEDATLFTTT
                     PALFKGDDRKAFDRLESAVRLSRYGVDCYAFAMLAGGFVDIVVEAGLQTYDIAALIPI
                     IEQAGGVVTRRDGGPAEQGGDIVAAATPALHQAALDLLHI"
     gene            complement(42021..43016)
                     /locus_tag="BAB_RS26590"
                     /old_locus_tag="BAB2_0045"
                     /db_xref="GeneID:3827884"
     CDS             complement(42021..43016)
                     /locus_tag="BAB_RS26590"
                     /old_locus_tag="BAB2_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="WP_002966533.1"
                     /db_xref="GI:489056396"
                     /db_xref="GeneID:3827884"
                     /translation="MSELLFETDANPIPSRIRGGLFHAPDGKALRYALLKAESRPCRG
                     TVIVLQGRNEFIENYYETMSDLAGRGFTVATFDWRGQGGSHRLLRDRLRGYVRSFNDY
                     ADDLDHFLTGIVLPDCPPPFFILAHSAGALVALSSLERLSSRITRMVLCAPLMGLGGQ
                     KISDDNVRRITAALRWIGLGRIYAAGGRTLSAARAFADNPLTSDPLRFMRNVEITRTY
                     TDLALGGPTVRWVWSALETAWRINQPDFYKSPIAPVLIIAAGADRVVSTAVIERFVAR
                     TRNISLAVIDGARHEMLQEADFYREQVLAAFDAFIPGSSPVESMPQSLEPDLSQI"
     gene            complement(43366..43764)
                     /locus_tag="BAB_RS26595"
                     /old_locus_tag="BAB2_0047"
                     /db_xref="GeneID:3827886"
     CDS             complement(43366..43764)
                     /locus_tag="BAB_RS26595"
                     /old_locus_tag="BAB2_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966530.1"
                     /db_xref="GI:489056393"
                     /db_xref="GeneID:3827886"
                     /translation="MKKAALALAALATAATGIATPTLAADNGLRVQIQYYDDDGYRVP
                     RQGFDGPGRHDRRPNWGDGYIRREVMNPRRVARSLERRGYDVGDMRLERDTYFVRATR
                     PSGRRVVVMVDAYNGNIIGERRAGPRPSGY"
     gene            44328..44798
                     /locus_tag="BAB_RS26600"
                     /old_locus_tag="BAB2_0050"
                     /db_xref="GeneID:3827889"
     CDS             44328..44798
                     /locus_tag="BAB_RS26600"
                     /old_locus_tag="BAB2_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein IbpA"
                     /protein_id="WP_002966528.1"
                     /db_xref="GI:489056391"
                     /db_xref="GeneID:3827889"
                     /translation="MRHVDFSPLYRSTVGFDRLFTMLDSLASPEGNQSYPPYNIERTG
                     ENAYRITMAVAGFSENELEIEAHRNQLTVKGQKADETASDVGEVLYRGIASRAFERRF
                     QLADFVEVSGASLKNGLLHIDLKREIPEQMKPRKIEVTKAGSGTAQPIEAKTAH"
     gene            complement(44936..45985)
                     /locus_tag="BAB_RS26605"
                     /old_locus_tag="BAB2_0051"
                     /db_xref="GeneID:3827890"
     CDS             complement(44936..45985)
                     /locus_tag="BAB_RS26605"
                     /old_locus_tag="BAB2_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_002966527.1"
                     /db_xref="GI:489056390"
                     /db_xref="GeneID:3827890"
                     /translation="MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFN
                     ELFEREVAVFFVGTGTAANSLALASVNRPGGVSLVHREAHVIEDGCGAPEYFTGGARL
                     HPIDGALGRIDPELLKRELKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQI
                     CRDAGLPLHMDGARFANALVSLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDP
                     ARAKDLPFIRKRAAQLFSKTRFVAAQFDAYLRDDLWRDLARHSNALAARLANHIHASS
                     QMRLAWKPEANEVFAIMKQSVYDRLRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTSF
                     ANTEEEVDRFGDMIA"
     gene            46628..51379
                     /locus_tag="BAB_RS26610"
                     /old_locus_tag="BAB2_0053"
                     /db_xref="GeneID:3828239"
     CDS             46628..51379
                     /locus_tag="BAB_RS26610"
                     /old_locus_tag="BAB2_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="WP_002966525.1"
                     /db_xref="GI:489056388"
                     /db_xref="GeneID:3828239"
                     /translation="MTHLTPSVSNVVSHNVQNEAVKAATTASTRTTRKTKAAGVPPAQ
                     GLYDPRNEHDACGVGFIAHMKGRKSHVVVENGLKMLENLTHRGAVGADPLMGDGAGIL
                     VQIPDRFFREEMARQGIDLPQPGHYGVGYIFMPRDPDLRAHAEEIVREVIAAEGQTFI
                     GFREVPVDNSSLSKAPHIAATEPFHMQVFIGRSPMLETDDDFERRLFVLRKVISNRIY
                     QENDGDDKGFYVVSMSARTVVYKGMFLAYQVGAYYLDLKDPRFESAVALVHQRFSTNT
                     FPSWRLAHPYRMVAHNGEINTLRGNVNRMAARQASVDSELFGNDISKLWPISYEGQSD
                     TACFDNALEFLHQGGYSLAHAMMMLIPEAWSGNKLMSDERRAFYEYHAALMEPWDGPA
                     AVAFTDGRQIGAMLDRNGLRPARYIVTEDDFVILASEAGVLPVDEKKIVRKWRLQPGR
                     MLLIDMEEGRIISDEEIKSQIAQKHPYKQWLANTQLILEDLNPVEPRALRKDVSLLDR
                     QQAFGYTQEDTKFLMAPMATTGQEAIGSMGTDTPISAMSDKSKLLYTYFKQNFAQVTN
                     PPIDPIREELVMSLVSFIGPRPNIFDLVGTSRRKRLEVRQPILTNGDLEKIRSIGHTE
                     DRFDTKTLDITYNTGEGATGMHGAIERLCDRAEAAVHGGYNIVILSDRQVGPDRIPIP
                     ALLATAAVHHHLIRKGLRTSVGLVVESGEPREVHHFACLAGYGAEAINPYLAFDTLLD
                     MHRRREFPPEVDEHEVVKRYIKSIGKGILKVMSKMGISTYQSYCGAQIFDAVGVRTDF
                     VDKFFFGTATTIEGVGLDEIAEETVRRHTDAFGNDPVLLNALEVGGEYAYRMRGEAHM
                     WSPDAVAKLQHAVRTSNPDTFTEYTRMLDAKSSQAKTIRGLFNIRFAEERGLKPVSID
                     EVEPATDIVKRFSTGAMSFGSISREAHTTLARAMNAIGGKSNTGEGGEEPDRFYPLPD
                     GTANPERSAIKQVASGRFGVTTEYLVNSDLIQIKVAQGAKPGEGGQLPGHKVDATIAK
                     TRHSTPGVGLISPPPHHDIYSIEDLAQLIYDLKNVNPAADISVKLVSEVGVGTVAAGV
                     AKARADHITVSGYDGGTGASPLTSLKHAGSPWEIGLAETHQTLVLNGLRSRVALQVDG
                     GLRTGRDVVIGALLGADEFGFSTAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRKRFK
                     GTPEHVINFFFYLAEEVRALLAQMGFTRLEQIIGETELLEKQAMIDHWKAKGLDFSRI
                     FYKPEAEKHEIYWTERQHHPIDDILDRKLIELAAPALEERQPVKIDVEIKNVDRSAGA
                     MLSGEVAKRFRHKGLPEDTISVTLRGTAGQSFGAFLARGISFELIGDGNDYIGKGLSG
                     GRIVVRPPEDTRIVAEDSIIVGNTVLYGALEGECYFRGVAGERFAVRNSGAVTVVEGV
                     GDHGCEYMTGGVVVVIGQTGRNFAAGMSGGVAYVLDEEGDFAQRCNMAMVELEPVPEE
                     DDILEKLHHHGGDLMHKGRVDVSANMTHHDEERLVQLIANHLHYTGSTRAKDILDNWE
                     SYRPKFVKVMPVEYRRALEEMERMQIGVAAE"
     gene            51461..52915
                     /gene="gltD"
                     /locus_tag="BAB_RS26615"
                     /old_locus_tag="BAB2_0054"
                     /db_xref="GeneID:3828240"
     CDS             51461..52915
                     /gene="gltD"
                     /locus_tag="BAB_RS26615"
                     /old_locus_tag="BAB2_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006234465.1"
                     /note="glutamate synthase is composed of subunits alpha
                     and beta; beta subunit is a flavin adenine
                     dinucleotide-NADPH dependent oxidoreductase; provides
                     electrons to the alpha subunit, which binds L-glutamine
                     and 2-oxoglutarate and forms L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidine dehydrogenase subunit A"
                     /protein_id="WP_002972210.1"
                     /db_xref="GI:489062183"
                     /db_xref="GeneID:3828240"
                     /translation="MGKVTGFLEIDRQVAKYQPASDRIRHFREFTIPMTDGEVQKQAA
                     RCMDCGIPYCHGPTGCPVHNQIPDWNDLVYNNNWDQAIRNLHLTNNFPEFTGRICPAP
                     CEEACTLNLEDMPVAIKTVEQALGDKAYELGYIVPQPAASKTGKLVAIIGSGPAGLAA
                     AQQLARAGHMVDVYERESRPGGLLRYGIPDFKMEKHLIDRRVAQMEGEGVRFHCGVNI
                     GVDKPLRGLLDTYDAVLYCGGSETPRPAGIPGADLDGVHDAMPYLVQQNRRVGRENIE
                     SVAWASVPILAGGKHVVVVGGGDTASDCVGTAFRQGAVNVTQLDIRPQPPEKEDKLSV
                     WPYWATKMRTSSSQAEGASREFQVATLEFIGEDGRLTHVKCCQVDEKRRPIAGTEFFI
                     KADLAFIAIGFAGPVEDSVVKEMDGKLEIATDRRGSKSVKANDRDYRTNVDKLYAAGD
                     IRRGQSLVVWAIREGRQAAHAIDADLMGSSVLPR"
     gene            complement(52960..54363)
                     /locus_tag="BAB_RS26620"
                     /old_locus_tag="BAB2_0055"
                     /db_xref="GeneID:3827892"
     CDS             complement(52960..54363)
                     /locus_tag="BAB_RS26620"
                     /old_locus_tag="BAB2_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine glycine permease"
                     /protein_id="WP_002966523.1"
                     /db_xref="GI:489056386"
                     /db_xref="GeneID:3827892"
                     /translation="MNTISKPSVDLHREEEPHLARNLSNRHLQLIAIGGTIGTGLFMG
                     SGKAVSLAGPSILLIYAITGFMLFFVMRALGEILLSNLQYRSFADFAGDYLGPCAQFF
                     TGWTYWLCWIVTAVAEVVAVPGYVSFWFPHLAPWIPALGLITILLILNLPTVRNFGEI
                     EFWFALIKIITIIGLIITGIYMLMTGFVLPNGTQASIAHLWNHGGFFPNGSLGFIAGF
                     QISVFAFVGIELVGTAAAEAENPMRNLPKAINNIPIRIVLFYIGALFVIITVTPWNQV
                     DPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSNSGIYSTSRMVYGLATVGLAPKA
                     FSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTLVTTISALLFIFIWSIILV
                     SYLQYRRKHPERHEKSTFKMPGGRASVVMVFIFFAFVLWALTQEPDTLAAMKVTPLWF
                     VLLGIAYWVMKLKQKQS"
     gene            complement(54581..55732)
                     /locus_tag="BAB_RS26625"
                     /old_locus_tag="BAB2_0056"
                     /db_xref="GeneID:3827893"
     CDS             complement(54581..55732)
                     /locus_tag="BAB_RS26625"
                     /old_locus_tag="BAB2_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967164.1"
                     /db_xref="GI:489057040"
                     /db_xref="GeneID:3827893"
                     /translation="MREALTSGKFLKLAGMMLAAAALLLTSLAAATAQERPRTLFDLL
                     FGSRQAQPQRQYERPAPQRVKPKPKRPRASSPAAHAAAPSAAAPAVEIATKKPDAKKI
                     LVVGDFIGNGLAEGLDAAFATDPDLTVATRVNGSSGFVRDDYFNWPDNIGKILDEEKP
                     AAVVVMIGANDRQAITANGNSLQPRSPEWNAEYQKRVAAFTKVISDRHYPLVWVGQPP
                     FRPKGMSQDMLALNEIYRNAAEKAGGKFADVWDGFVDEEGNFTQTGFDINGQTARLRA
                     NDGINITSTGKRKLAFYAEKPLHAYLGVSREEGNSLPATHSLDPSKPVDRVAPVSLRD
                     INKDDSGILLGGTPAMQAKPLKTEQKKANPSPGRADDFSWPRNGKAPRK"
     gene            complement(55983..56501)
                     /locus_tag="BAB_RS26630"
                     /old_locus_tag="BAB2_0057"
                     /db_xref="GeneID:3827894"
     CDS             complement(55983..56501)
                     /locus_tag="BAB_RS26630"
                     /old_locus_tag="BAB2_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q2YJ83.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_002966521.1"
                     /db_xref="GI:489056384"
                     /db_xref="GeneID:3827894"
                     /translation="MRTLVMVACAVSLAACSSPPKPPTVSGRHRIPINSPAAQEELRL
                     QVFPQEPTAQATMWPARPPKQTVNVYFPQDVTVFRPTSAQINQLHTLLWPVPKHINVR
                     GLTDNNCPPPGDTQVARVRALAIYNWLINQGVPASRITISYAPVKDYASNAPLSPGRV
                     LNRRVDIEILRK"
     gene            complement(56647..57732)
                     /locus_tag="BAB_RS26635"
                     /old_locus_tag="BAB2_0058"
                     /db_xref="GeneID:3827895"
     CDS             complement(56647..57732)
                     /locus_tag="BAB_RS26635"
                     /old_locus_tag="BAB2_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q2YJ82.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein VirB11"
                     /protein_id="WP_002966520.1"
                     /db_xref="GI:489056383"
                     /db_xref="GeneID:3827895"
                     /translation="MSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNR
                     PGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQ
                     IVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEA
                     GDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDH
                     PNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGH
                     GGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDG
                     TGRHISEVWYDPNTKRALSLQHSEKTQ"
     gene            complement(57716..58882)
                     /locus_tag="BAB_RS26640"
                     /old_locus_tag="BAB2_0059"
                     /db_xref="GeneID:3827896"
     CDS             complement(57716..58882)
                     /locus_tag="BAB_RS26640"
                     /old_locus_tag="BAB2_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006210408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB10"
                     /protein_id="WP_002966519.1"
                     /db_xref="GI:489056382"
                     /db_xref="GeneID:3827896"
                     /translation="MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIV
                     VLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMP
                     IAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNAR
                     IQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDS
                     TVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGV
                     VIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQIN
                     LNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK"
     gene            complement(58879..59748)
                     /locus_tag="BAB_RS26645"
                     /old_locus_tag="BAB2_0060"
                     /db_xref="GeneID:3827897"
     CDS             complement(58879..59748)
                     /locus_tag="BAB_RS26645"
                     /old_locus_tag="BAB2_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YDZ1.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB9"
                     /protein_id="WP_002966518.1"
                     /db_xref="GI:489056381"
                     /db_xref="GeneID:3827897"
                     /translation="MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVL
                     VRALPGVGARIVFAPGENIEDVASGFTQGWEFKASHNILYLKARSMTLSHSNQSIDMA
                     PEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRVQFRYPAAAAAAAVAAAQKRV
                     VQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFPAAFLVAED
                     KSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPG
                     VKRVIKSPGENLQ"
     gene            complement(59745..60464)
                     /locus_tag="BAB_RS26650"
                     /old_locus_tag="BAB2_0061"
                     /db_xref="GeneID:3827898"
     CDS             complement(59745..60464)
                     /locus_tag="BAB_RS26650"
                     /old_locus_tag="BAB2_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB8"
                     /protein_id="WP_002966517.1"
                     /db_xref="GI:489056380"
                     /db_xref="GeneID:3827898"
                     /translation="MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRA
                     WKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVM
                     DKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVR
                     TSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARL
                     TNPLGFNVTSYRVDPEMGVVQ"
     gene            complement(60467..60640)
                     /locus_tag="BAB_RS26655"
                     /old_locus_tag="BAB2_0062"
                     /db_xref="GeneID:3827976"
     CDS             complement(60467..60640)
                     /locus_tag="BAB_RS26655"
                     /old_locus_tag="BAB2_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008508782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system putative lipoprotein
                     virB7"
                     /protein_id="WP_002966516.1"
                     /db_xref="GI:489056379"
                     /db_xref="GeneID:3827976"
                     /translation="MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKP
                     PLAQPNPVDTYED"
     gene            complement(60804..61847)
                     /locus_tag="BAB_RS26660"
                     /old_locus_tag="BAB2_0063"
                     /db_xref="GeneID:3827977"
     CDS             complement(60804..61847)
                     /locus_tag="BAB_RS26660"
                     /old_locus_tag="BAB2_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB6"
                     /protein_id="WP_002969266.1"
                     /db_xref="GI:489059194"
                     /db_xref="GeneID:3827977"
                     /translation="MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLY
                     YTAMGILMSVGRIEGPFSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADA
                     FAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGS
                     TLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVAL
                     LSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGS
                     SISAATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSP
                     AYRQHVLGQFNRD"
     gene            complement(62031..62747)
                     /locus_tag="BAB_RS26665"
                     /old_locus_tag="BAB2_0064"
                     /db_xref="GeneID:3827978"
     CDS             complement(62031..62747)
                     /locus_tag="BAB_RS26665"
                     /old_locus_tag="BAB2_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB5"
                     /protein_id="WP_006077544.1"
                     /db_xref="GI:492981242"
                     /db_xref="GeneID:3827978"
                     /translation="MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKF
                     AQQIEQLKQQFEQQKMQFDALTGNRGLGDILRDPTLRSYLPHNWRDLYEAVMSGGYLA
                     AAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEI
                     ESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLRLYQQMAEAQDKLLDERQHEL
                     DAKDNARRGYPQPKALEAAY"
     gene            complement(62752..65247)
                     /locus_tag="BAB_RS26670"
                     /old_locus_tag="BAB2_0065"
                     /db_xref="GeneID:3827979"
     CDS             complement(62752..65247)
                     /locus_tag="BAB_RS26670"
                     /old_locus_tag="BAB2_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q2YIT8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB4"
                     /protein_id="WP_002966513.1"
                     /db_xref="GI:489056376"
                     /db_xref="GeneID:3827979"
                     /translation="MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWR
                     IAGLAFETQDKEKLLIRKDQLNTLFRAIASNNVALWSHNVRRRTWDHLKSFFSNPFCD
                     ALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFNVAVHRSHAEILQEQQLAIRK
                     LDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSGEWQKVRVP
                     SCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYANHTEPGILNGLMYSDYEY
                     VITQSFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHY
                     SLLVFAEDMETVRHNTSHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGL
                     TSLNFAGLSCFHNFRAGKRDGNPWGQALTLLKTPSGQPAYLNFHYSKGDEDNFDKKLL
                     GNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFFDKDQGAKGTILAIGGKYL
                     AIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAIRTVMRM
                     RPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQID
                     FNTHSNYGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFS
                     EFANNKQLTIRKQNGLGVFATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTD
                     GFKVTNEEFDIIRSMSEESRMFLVKQGHHSMICRLELNGFDDELAILSGSSDNNELLD
                     QVIAEVGDDPSVWLPVFQERRKARIASSKSTGR"
     gene            complement(65247..65597)
                     /locus_tag="BAB_RS26675"
                     /old_locus_tag="BAB2_0066"
                     /db_xref="GeneID:3827980"
     CDS             complement(65247..65597)
                     /locus_tag="BAB_RS26675"
                     /old_locus_tag="BAB2_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB3"
                     /protein_id="WP_002966512.1"
                     /db_xref="GI:489056375"
                     /db_xref="GeneID:3827980"
                     /translation="MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGS
                     IVLLSVWISMFILPLIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRAS
                     AYSPIAFTKRKRES"
     gene            complement(65611..65928)
                     /locus_tag="BAB_RS26680"
                     /old_locus_tag="BAB2_0067"
                     /db_xref="GeneID:3827981"
     CDS             complement(65611..65928)
                     /locus_tag="BAB_RS26680"
                     /old_locus_tag="BAB2_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006163924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB2"
                     /protein_id="WP_002967165.1"
                     /db_xref="GI:489057041"
                     /db_xref="GeneID:3827981"
                     /translation="MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVN
                     TSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAAAEIASY
                     LLR"
     gene            complement(66364..67080)
                     /locus_tag="BAB_RS26685"
                     /old_locus_tag="BAB2_0068"
                     /db_xref="GeneID:3827982"
     CDS             complement(66364..67080)
                     /locus_tag="BAB_RS26685"
                     /old_locus_tag="BAB2_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006178499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein virB1"
                     /protein_id="WP_002970474.1"
                     /db_xref="GI:489060418"
                     /db_xref="GeneID:3827982"
                     /translation="MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVR
                     QPVSLDEAITTAQSLEAKGWNFSLGIAQVNRYNLPKYGSTYAQAFDPCKNLKMGSKIL
                     EDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTKPGSPSYVQKVVASADVTTKP
                     IVVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGTANAPVRLKTE
                     QPATTDAPPGKDNTDGVVVF"
     gene            complement(67584..68822)
                     /locus_tag="BAB_RS26690"
                     /old_locus_tag="BAB2_0069"
                     /db_xref="GeneID:3827983"
     CDS             complement(67584..68822)
                     /locus_tag="BAB_RS26690"
                     /old_locus_tag="BAB2_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_002967167.1"
                     /db_xref="GI:489057043"
                     /db_xref="GeneID:3827983"
                     /translation="MLRFPFTPEKKLRIKIAATVALAIIGASLSAGTALADAGFRQWI
                     ANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSV
                     AVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATL
                     AYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMD
                     GNGKRDIWNSVPDALGTAANLLHRNGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQI
                     GLVRANGRAFPDPHEKATLKVPDGHQGPAFLMTKNFFVLKRYNNADKYALAVGLLADR
                     IGGYQGLRQDWNRPFTPISMNERLELQTHLKALGYYDGNIDGKIGATSRAAIEAFQQR
                     NGLEPDGHPSKEVLSVLRRR"
     gene            69231..70115
                     /locus_tag="BAB_RS26695"
                     /old_locus_tag="BAB2_0070"
                     /db_xref="GeneID:3828229"
     CDS             69231..70115
                     /locus_tag="BAB_RS26695"
                     /old_locus_tag="BAB2_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_032448386.1"
                     /db_xref="GI:694105474"
                     /db_xref="GeneID:3828229"
                     /translation="MRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVVDE
                     AREAGIEHLIFVTGRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTSF
                     TRQQVPLGLGHAVWCARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAV
                     QECDPEEAHKYGIVGKGGAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLL
                     SKQEKGAGNEIQLTDAMLKLADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDI
                     RPSVEGSIGHLLKTIQPA"
     gene            complement(70168..71706)
                     /locus_tag="BAB_RS26700"
                     /old_locus_tag="BAB2_0071"
                     /db_xref="GeneID:3827984"
     CDS             complement(70168..71706)
                     /locus_tag="BAB_RS26700"
                     /old_locus_tag="BAB2_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967168.1"
                     /db_xref="GI:489057044"
                     /db_xref="GeneID:3827984"
                     /translation="MFIACAPIGGLAPLARRLRCLLLAGVALALPHFAYAQDADLRGS
                     ISDDIAAAATDADDAGAGADSFYSPEQDNASSGKGDLSQETPAADPVSEDSTFLLDNI
                     RVGAVLPDDDTVRAQRENLRARPGQGRSFTPEADPYAPIGIRAGSFILKPSLEQGIKA
                     TSNGDNSSNGSRAILNETTLRLNALSDWLQHQASLDASGTFSKSISGQDVSEPQANIL
                     GRLRLDLANQTTVNAETSYRLRRESASSPNGVVDALKRPLVHTFAGRLGVERDTGLLF
                     GRVTGGLEHDMYGNAELASGGTVTQKDRNNTYASVAIRGGFSLSPALKPFAEVELGKR
                     MFDERIDSNGYERSGRQYALRGGLIFDRGEKFNGEIAAGYMQADSDDPRLANISGPSI
                     NAMVNWSPLRGTDMRFFARTMVDTSTTPGVAGSLQHFASLDVTRRVRANLSFNGKLDA
                     NIRQNKDGTGTDYTLGAGIGATYWLNRMVAIDARLRHEFQTSQVADREYQSNSIYVGM
                     KFQK"
     gene            71847..72848
                     /locus_tag="BAB_RS26705"
                     /old_locus_tag="BAB2_0072"
                     /db_xref="GeneID:3827985"
     CDS             71847..72848
                     /locus_tag="BAB_RS26705"
                     /old_locus_tag="BAB2_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="KpsF/GutQ family protein"
                     /protein_id="WP_002966506.1"
                     /db_xref="GI:489056368"
                     /db_xref="GeneID:3827985"
                     /translation="MEKLDITQKLADAEAAITSALRTIKTENAGLVALEEALNNGLSG
                     PFVEAVERIVASRGRLVVTGVGKSGHIGSKLAATFASTGTSAFFVHSGEANHGDLGMI
                     GLEDVILAISWSGETVELKGIVNYSQRFRIPLIAITSRQDSALGRAADVVLLLPKATE
                     ACPHGLAPTTSTMMQLAIGDALAIALLEARGFTPSDFKTFHPGGSLGASLIHIRDIMH
                     RGNRLPLVKTGTPMPDAMKVLAQKSFGCVVVTDDAGELAGIVTDGDISRNLSRNLSAL
                     AVDDIMTRSPRTIDQNMLASAALKTINENHIGALIVVEANRPIGLVHFHDLLRIGAA"
     gene            complement(72971..73438)
                     /locus_tag="BAB_RS26710"
                     /old_locus_tag="BAB2_0073"
                     /db_xref="GeneID:3827986"
     CDS             complement(72971..73438)
                     /locus_tag="BAB_RS26710"
                     /old_locus_tag="BAB2_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002966505.1"
                     /db_xref="GI:489056367"
                     /db_xref="GeneID:3827986"
                     /translation="MIPEFLFQLGIWNWLVFGLILLILEILAPGFFFIWFGLAALVIG
                     ALAFLLSSTAGFGWQLQTVIFLVLAIVFTLAGRRFFGSKSNDTGEPLLNRRGEQLVGQ
                     RATLTEPIVNGHGRIHINDTTWRVKGPDLPAGTEIRIVAFDPVSLEIEVGLGE"
     gene            complement(73459..74445)
                     /locus_tag="BAB_RS26715"
                     /old_locus_tag="BAB2_0074"
                     /db_xref="GeneID:3827987"
     CDS             complement(73459..74445)
                     /locus_tag="BAB_RS26715"
                     /old_locus_tag="BAB2_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002966504.1"
                     /db_xref="GI:489056366"
                     /db_xref="GeneID:3827987"
                     /translation="MTGFDITLLILVALVLAALIASIKTVPQGYNYTIERFGRYTRTL
                     NPGLNLIVPFFDRVGARLNMMEQVLDVPTQEVITRDNAIVGVDAVAFYQVLNAAQAAY
                     QVAKLQYAILNLTMTNIRTVMGSMDLDELLSNRDAINDRLLRVVDEAAHPWGIKITRV
                     EIKDINPPADIVTSMARQMKAERDKRAQVLEAEGNRNAQILRAEGQKQSQILEAEGKL
                     EAAKREAEARERLAEAEAKATTMVSQAVANGNVQALNYFVAQKYTEALSNITSAKNQK
                     IVLMPLEASSLIGSLGGIGAIAREVFGDGSQPAGPAPQPPARARSVPPTGRD"
     gene            complement(74578..75636)
                     /gene="hemH"
                     /locus_tag="BAB_RS26720"
                     /old_locus_tag="BAB2_0075"
                     /db_xref="GeneID:3828247"
     CDS             complement(74578..75636)
                     /gene="hemH"
                     /locus_tag="BAB_RS26720"
                     /old_locus_tag="BAB2_0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A3D6.1"
                     /note="protoheme ferro-lyase; catalyzes the insertion of a
                     ferrous ion into protoporphyrin IX to form protoheme;
                     involved in protoheme biosynthesis; in some organisms this
                     protein is membrane-associated while in others it is
                     cytosolic; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_002966503.1"
                     /db_xref="GI:489056365"
                     /db_xref="GeneID:3828247"
                     /translation="MSGTDKVRVNVSQTAQTPLHTSAKLPKVGVLLVNLGTPDGTSYG
                     PMRRYLAEFLSDRRVIEWSRLIWYPILYGIVLNTRPRRSGRLYDRIWNHENNESPLRT
                     YTRAQGEKLAKALSDQPNVVVDWAMRYGQPSIESITDRLLQQGCERIVIFPLYPQYSA
                     TTTATVNDKFFEALMKKRFMPAIRTVPSYEAEPVYIDALARSVEKHLATLSFKPEVIL
                     TSYHGIPKSYSDKGDPYRQQCLETTRLLRERLGLGEDEMRATFQSRFGPEEWLQPYTD
                     ETVKELAKNGVKLVAVLNPGFVADCLETVDEIGNEAAEEFLENGGENFSHIPCLNDSE
                     EGMKVIETLVRRELLGWV"
     gene            complement(75774..76154)
                     /locus_tag="BAB_RS26725"
                     /old_locus_tag="BAB2_0076"
                     /db_xref="GeneID:3828036"
     CDS             complement(75774..76154)
                     /locus_tag="BAB_RS26725"
                     /old_locus_tag="BAB2_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008508755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein omp10"
                     /protein_id="WP_002966502.1"
                     /db_xref="GI:489056364"
                     /db_xref="GeneID:3828036"
                     /translation="MKRFRIVAPLALMSLALAACETTGPGSGNAPIIAHTPAGIEGSW
                     VDPNGIASSFNGGIFETRTTDTNEKLAEGNYLYLSPQLVEINMRSIVRGTTSKVNCAL
                     VSPTQLNCTSSAGSRFSLTRRNAG"
     gene            complement(76296..77741)
                     /locus_tag="BAB_RS26730"
                     /old_locus_tag="BAB2_0077"
                     /db_xref="GeneID:3827988"
     CDS             complement(76296..77741)
                     /locus_tag="BAB_RS26730"
                     /old_locus_tag="BAB2_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homospermidine synthase"
                     /protein_id="WP_002966501.1"
                     /db_xref="GI:489056363"
                     /db_xref="GeneID:3827988"
                     /translation="MAREKWQVYGEITGPIIMIGFGSIGRGTLPLIERHFKFDQSQMV
                     VIDPSEKNRKILDEKNIRFIKQAITRDNYKDVLGPLLKGVKGQPFVVNLSVDTSSLDL
                     MRFVRECGALYIDTVVEPWLGFYFDAQADNAARTNYALRETVRSEKRKNPGGPTAVSC
                     CGANPGMVSWFVKKALVDLAAELKLDFTEPAPQDRHGWAKLMKKAGVKGIHIAERDTQ
                     RARKPKPFNTFWNTWSVEGFIAEGLQPAELGWGSHEKWKPKNARKQKKGNKAAIFLEQ
                     PGGNTRIRTWCPTLGAQYGLLVTHNEAISIADFFTLRDKKGKLDFRLTCHYAYHPCND
                     AIVSLDEMFGAGGKAQPVQHVLEENEILDGADELGVLLYGHARNAYWYGSQLTVQEAR
                     KLAPYQNATGLQVSSAVLAGMVWALENPQSGIVETDEMDYRRCLEVQMQYLGPVKGYY
                     TDWTPLEGRDGLFEEDVDRKDPWQFRNVLVR"
     gene            complement(77853..78533)
                     /locus_tag="BAB_RS26735"
                     /old_locus_tag="BAB2_0078"
                     /db_xref="GeneID:3827989"
     CDS             complement(77853..78533)
                     /locus_tag="BAB_RS26735"
                     /old_locus_tag="BAB2_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966500.1"
                     /db_xref="GI:489056362"
                     /db_xref="GeneID:3827989"
                     /translation="MSSESTVRDGSKAVTSEPDYQLIETMRWEPLAGVLRFDLHMARL
                     ENSARELNFACNMDVIRQKIAESGTGDQALKLRLTLAPDGVATVAALPYEALPQQTVW
                     RIAIARTRLDHTDPLLRYKTTRRQAYIAAREEYSPAEVDEVILLNERGEVCEGTITSI
                     FLDIGGTARTTPALSCGLLDGVMRRELLDKGVASEEVVSVDILKSARNILVGNSLCGM
                     IRAKLIES"
     gene            complement(78467..79636)
                     /locus_tag="BAB_RS26740"
                     /old_locus_tag="BAB2_0079"
                     /db_xref="GeneID:3827990"
     CDS             complement(78467..79636)
                     /locus_tag="BAB_RS26740"
                     /old_locus_tag="BAB2_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138112.1"
                     /note="catalyzes the formation of
                     4-amino-4-deoxychorismate from chorismate and glutamine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate synthase"
                     /protein_id="WP_002966499.1"
                     /db_xref="GI:489056361"
                     /db_xref="GeneID:3827990"
                     /translation="MTRPGNKPLILFRDDKAGRDVLFAAPSRIIRADTPDEFEPAWEA
                     MQRAHEAGEWLAGYLSYEAGYLLEPKLRPLLPEGRKTPLLCFGVFDGPSDEQLHVRDS
                     ENATYLRNPVAQWSFEDYAPRFERLYRHLREGDCYQGNLTFPVTAQWGGDPLILFNML
                     AKRQPVRYATYCDLGGPVVLSRSPELFFKVDGDGWIETHPMKGTMPRGATPEEDERNR
                     QFLLNDPKNQAENRMIVDLLRNDISLVSEVGSLDVPELFRVESYPTVHQMISRVRARL
                     KSGLHLRAVFAALFPCGSITGAPKISAMKILRRLETGPRDIYCGSLGWIEPGGRMRFN
                     VAIRTISLLGGNRAIFNVGGGVVFDSTAQAEYEECLLKARFATGQKPLPANRIIS"
     gene            complement(79646..81508)
                     /locus_tag="BAB_RS26745"
                     /old_locus_tag="BAB2_0080"
                     /db_xref="GeneID:3828044"
     CDS             complement(79646..81508)
                     /locus_tag="BAB_RS26745"
                     /old_locus_tag="BAB2_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_002966498.1"
                     /db_xref="GI:489056360"
                     /db_xref="GeneID:3828044"
                     /translation="MKFMVYRFSSDAILRAPAADAIAAKKHDLGNLPEWNLADLYPAP
                     DSPQLASNLEKAMQDSVRFEERWKGKLADEAAKPNGGNLAEAIREFEALSELMGRIGS
                     YAGLYYYGDTTDPKRMKLFGDAQQKLTDASTPLIFFTLELNRIDDTVLEKAMNENPAI
                     GHYRPWLTDLRMDKPYQLDDKLEQLFHEKSITGYSAWNRLFDETMSGLRFEIGGEQLA
                     IEPTLNMLQDADGAVRKQASEALAKTFTANLRTFTLITNTLAKDKEISDRWRGFKDIA
                     DSQHLSNRVEREVVDALAKAVEDAYPRLSHRYYALKAKWLGLEKLENWDRNAPLPETP
                     QALIPWDEARETVLSAYGNFAPEMADIARKFFDRNWIDAPVRPGKAPGAFAHPTVPSA
                     HPYVLLNYMGKPRDVMTLAHELGHGVHQVLAGSQGALMASTPLTLAETASVFGEMLTF
                     RLLLERTRDKRERKAMLAQKAEDMINTVVRQIAFYQFERRVHTERRAGELTSERIGEI
                     WMDVQRESLGDAVRLNPGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQNSEK
                     GFQQKYFEMLKAGGTKHHKELLAPFGLDASDPGFWNKGLSVIEGIIDELEAMED"
     gene            81856..83346
                     /locus_tag="BAB_RS26750"
                     /old_locus_tag="BAB2_0081"
                     /db_xref="GeneID:3827991"
     CDS             81856..83346
                     /locus_tag="BAB_RS26750"
                     /old_locus_tag="BAB2_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_002967169.1"
                     /db_xref="GI:489057045"
                     /db_xref="GeneID:3827991"
                     /translation="MATRILIADDDPIQRRNLEAIVMRMGYRTILADGGVSALGFISQ
                     RKDIVLVLLDLTMPDMDGLTVLSRMRAAGVAVPVIVLVHSDDMHRVAQAIRLGAADFM
                     IKPLIFERVQVSVANVLKLDALTHEIQRARSSPRVHLSLSEMVAKSPEMERVMVLARR
                     AAALDAPLLVEGETGSGRQTLARAICGGGSRWRGPFVSLDCRGLTMENADDILFGTAK
                     FCPDDPIVSAGKLAEADGGVLFLDEVGALPHHAQLRLFTAMQSGQYESNGSRVTSNAR
                     IMTSSSQPLVDFVHMGRFHAGLYHLLGSFSIAMPPLRERVEDISILVHQFAVRFASEE
                     RLSHITGIAPHLLERLKAYQWPGNVRELKNAVYRAVLLCDKSELTVEDFAQLNLGAAG
                     FAGAQAMWQKPAAPLSVGRAGTAFSGIDADGEVRTLAAAEEEMIRFAIAHYDGQISEV
                     ARRLGIGRSTLYRKLKEYGIDVASISGKGKESDLENESCSWGRAAI"
     gene            83639..85600
                     /locus_tag="BAB_RS26755"
                     /old_locus_tag="BAB2_0082"
                     /db_xref="GeneID:3827992"
     CDS             83639..85600
                     /locus_tag="BAB_RS26755"
                     /old_locus_tag="BAB2_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006110371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_002973499.1"
                     /db_xref="GI:489063475"
                     /db_xref="GeneID:3827992"
                     /translation="MKKYFSKVWTGACSGVMRARASISAGLAIAAVAMVVLPSQASAE
                     TRSLKLYYVHTGEKAEIAFKKDGRFLPDGLKRLNVFLRDWRRNEPTRMDPRLFDLIWQ
                     VYQSTGSREYITVVSAYRSPATNAMLRSSTRGVAKKSQHMLGRAMDYFIPGVPLAKLR
                     AIGMRYQIGGVGYYPRSGSPFVHMDVGNVRHWPRMSRRELLALFPDGKTVHIPTDGKP
                     LPGYEQALAMIEKRKAGGGTIMMASNSSSRKRKSLFAALFGGGGADEEEDNGDTAAPA
                     TARPARATAPTRQAPAAVPAAPVEQPRETMVAALPARDAPVPMQAPRPETGLDAQAAA
                     AETPVAAFNVPVPAHKPQMAPQDAVALAAAEDPAAAARAAVDANTAQAADAGMSAALT
                     NGFVPVPSARPHLETDNVQLAAAVIPTARPERPGEHPARGQDAIAALVNSQSDEPAQM
                     AGEMADATGNAVAPQPGKTAAFPLPTQTPRADTKLAMVSRRDEIGELIAPPEDDYDYD
                     AKPVAAAAPKQAPAPVQMASAAPTKPAAVASAAMRKKAAIIGKTADTGVRTTTKGARH
                     MAKAPSRPRPVIRPAVMPSSEIAMSTEPVSSTVPVTSPVLRNDALRSAPTMVYTAGFQ
                     RGDLPSARANQFSGNAVTFLTVAKFTETN"
     gene            complement(85666..86304)
                     /locus_tag="BAB_RS26760"
                     /old_locus_tag="BAB2_0083"
                     /db_xref="GeneID:3827993"
     CDS             complement(85666..86304)
                     /locus_tag="BAB_RS26760"
                     /old_locus_tag="BAB2_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966494.1"
                     /note="catalyzes the formation of pyruvate and glyoxylate
                     from 4-hydroxy-2-oxoglutarate; or pyruvate and
                     D-glyceraldehyde 3-phosphate from
                     2-dehydro-3-deoxy-D-glyconate 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketohydroxyglutarate aldolase"
                     /protein_id="WP_002966494.1"
                     /db_xref="GI:489056356"
                     /db_xref="GeneID:3827993"
                     /translation="MSQKTDLLLPIMKGQPVIPVLLIDKVEHAVPLARALARGGLPAI
                     EITLRTAAALDAIRAVADEVPEAIVGAGTILNAKQYEDAAKAGSRFIVSPDATKYIVA
                     AANDSDVPLLPAAITPGEMLALREEGYTHLKFFPAEQAGGAPFLKALSSPLAGTFFCP
                     TGGISLANARTYLPLPNVLCVGGSWVAPKELVEAGNWNAITDLAKDAAALKA"
     gene            complement(86463..87074)
                     /locus_tag="BAB_RS26765"
                     /old_locus_tag="BAB2_0084"
                     /db_xref="GeneID:3827994"
     CDS             complement(86463..87074)
                     /locus_tag="BAB_RS26765"
                     /old_locus_tag="BAB2_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein"
                     /protein_id="WP_002966493.1"
                     /db_xref="GI:489056355"
                     /db_xref="GeneID:3827994"
                     /translation="MFDRPTIEALTTMAKEADIDPAALLAIAEVESGGRALYAVKGNM
                     EPAIRFEGHYFDRRISGRIRDFARKNGLSAPEAGKIRNPKSQGERWLLLERAMGLSPK
                     GALESTSWGLGQVMGAHWEWLGYRSVDALVAEARESVAGQVRLMLHFIEKAQLVQALR
                     SHDWPGFARRYNGPAFTRNNYDKRMAEAHQRWQNQIGSFKKAA"
     gene            87205..88122
                     /locus_tag="BAB_RS26770"
                     /old_locus_tag="BAB2_0085"
                     /db_xref="GeneID:3827995"
     CDS             87205..88122
                     /locus_tag="BAB_RS26770"
                     /old_locus_tag="BAB2_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q579Z7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966492.1"
                     /db_xref="GI:489056354"
                     /db_xref="GeneID:3827995"
                     /translation="MSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAA
                     EGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSHASEMPFHRMKVRLKREIVTMGV
                     EGIDPLKSVGTYIAPKDWNALIADENTVVVDKRNDYEYAIGTFEGAIDPQTRTFREFP
                     EWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQ
                     SMWNGECFVFDERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAER
                     TPEDRARYAERQKQVKLAEKRGANKHIGS"
     gene            88403..89158
                     /locus_tag="BAB_RS26775"
                     /old_locus_tag="BAB2_0087"
                     /db_xref="GeneID:3827919"
     CDS             88403..89158
                     /locus_tag="BAB_RS26775"
                     /old_locus_tag="BAB2_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_002966490.1"
                     /db_xref="GI:489056352"
                     /db_xref="GeneID:3827919"
                     /translation="MKKLIATFLITIAAGAASVAQAAEKVTVFAAASMKDMIEEAARQ
                     IKARDGTEVVASFASSSALARQIEQGAPAQIFISADLDWMDYVEKAGLIDKASRKIIA
                     GNALVIAAQKDTPKGDARELLSAGRFAMGDPSNVPAGKYGKAALEKLDIWKEVEKNAV
                     FTENVRVALRYVSLAEVKTAIVYASDRVAAPELVEAYRFPADSHAPILYPAALLKKNE
                     SDAARTFLAFLESDAGQAIIKDKGFVGAAEAAE"
     gene            89169..89855
                     /locus_tag="BAB_RS26780"
                     /old_locus_tag="BAB2_0088"
                     /db_xref="GeneID:3827920"
     CDS             89169..89855
                     /locus_tag="BAB_RS26780"
                     /old_locus_tag="BAB2_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="WP_002966489.1"
                     /db_xref="GI:489056351"
                     /db_xref="GeneID:3827920"
                     /translation="MIMESNIWQIVLLSLRVAGIAIIIALPLAFLVGWLLARFHFPGK
                     SLVQAIVTMPLVLPPVVTGYLLLILFGARGPLGAPLQEWLGLSFAFRWTGAALAAGVM
                     AFPLLVRPIRLSIEGLDRGLEEAARTLGASRFTAFFTVILPPLLPGILAGAVLGFAKA
                     LGEFGATITFVSNIPGETQTLSLAIYTLLQTPSGDAEAFRLIAVSATISIAAVVLSEW
                     LQRRLAGGVK"
     gene            89852..90931
                     /locus_tag="BAB_RS26785"
                     /old_locus_tag="BAB2_0089"
                     /db_xref="GeneID:3827997"
     CDS             89852..90931
                     /locus_tag="BAB_RS26785"
                     /old_locus_tag="BAB2_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006163936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum import ATP-binding protein ModC"
                     /protein_id="WP_002966488.1"
                     /db_xref="GI:489056350"
                     /db_xref="GeneID:3827997"
                     /translation="MSGLTVSIRGRNGAFAIEAGFAAEGGVTALFGHSGAGKTTLLKM
                     IAGTLRPENGRIAVGDFTLFDAQKGINLPPEKRRIGYVFQDARLFAYMSVKRNLTYAR
                     WAGHRPATRSFDEVVALLGIGHLLDRRPSTLSGGERQRVAIGRALLSDPALLLLDEPL
                     SSLDHARRQEILPFIERLRDESHVPIVYVSHEIDEVARLADQIVLLSAGRVTASGAAA
                     DIFPLIDAESEGGGVLLEGIVSAYDERYKLAEIDLGGASFQLSDAGLKQTMHVRLRVR
                     ARDVSIARKIPEAISIRNLLPVTVTGIERGEGPNAHVFLDFRGRRLGARLTRRSVDDL
                     GLSVGDQVVALVKAVSVDRAAIREK"
     gene            91001..91678
                     /locus_tag="BAB_RS26790"
                     /old_locus_tag="BAB2_0090"
                     /db_xref="GeneID:3827998"
     CDS             91001..91678
                     /locus_tag="BAB_RS26790"
                     /old_locus_tag="BAB2_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase GCN5"
                     /protein_id="WP_002966487.1"
                     /db_xref="GI:489056349"
                     /db_xref="GeneID:3827998"
                     /translation="MTDLQNWTPRPKPERKIFEGRYVRLEPLNAQKHGDELFAASSVE
                     DAEQRFTWLFETPPATRAEFEPWLDKASKSDDPLFFAVIDKASGKVAGRQALMRIDPA
                     NGVIEIGSIYWGPLISRRPAATEAQFLFMQYVFDVLGYRRYEWECHNENGPSRRAAER
                     FGFRFEGIFRQHMVVKGRNRDTAWFSVLDSEWPALKQAYQAWLAPENFDSAGQQKKTL
                     QEFRDLG"
     gene            91665..91874
                     /locus_tag="BAB_RS26795"
                     /old_locus_tag="BAB2_0091"
                     /db_xref="GeneID:3827999"
     CDS             91665..91874
                     /locus_tag="BAB_RS26795"
                     /old_locus_tag="BAB2_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966486.1"
                     /db_xref="GI:489056348"
                     /db_xref="GeneID:3827999"
                     /translation="MILAERKESNPAIAAAIILIGFGVLAYFVPSIMLVLGKHSQIAA
                     IIFPIVFVLGFFAIFWLRSKGQNKN"
     gene            complement(92171..92674)
                     /locus_tag="BAB_RS26800"
                     /db_xref="GeneID:23672482"
     CDS             complement(92171..92674)
                     /locus_tag="BAB_RS26800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966484.1"
                     /db_xref="GI:489056346"
                     /db_xref="GeneID:23672482"
                     /translation="MIHAFKHSIWTWLGILGGALTLLSNLQGILDLAEWADWIISKWQ
                     KLIMPAVSSLIKFVGIRVSNDAASMIVMAIFVSFIAIGARTENEFKGKNREIRAIKWS
                     NIFNINIYIGMMLYISQIILIKLIFLFPYFMQMYIKFHIVLLYLHIFYMYYLLLLACG
                     DGHSGRL"
     gene            complement(92816..93919)
                     /locus_tag="BAB_RS26805"
                     /old_locus_tag="BAB2_0094"
                     /db_xref="GeneID:3828002"
     CDS             complement(92816..93919)
                     /locus_tag="BAB_RS26805"
                     /old_locus_tag="BAB2_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel/cobalt exporter"
                     /protein_id="WP_002971298.1"
                     /db_xref="GI:489061260"
                     /db_xref="GeneID:3828002"
                     /translation="MRRTAGFMIALCLTMIVAQAYAQSSLGIGANEVAMKPTGPFAHI
                     ILWMNEQQRSFYLAMTTALKAMREDPLQAAWGLVGLSFIYGIFHAVGPGHGKAVISSY
                     MIANETALRRGIFLSFISSLLQAIMAVAVVGLAWLVLRGTGISMNQTAHYMEIASFAL
                     VLFFGLWLLVRKLPQLFRKRDHAGAGPASPLFAAAPQPAIVSGPAWQGSISQATRTAA
                     TSSTVKLNYKPATAATDHIFIGEGDVCAACGNAHIVDPSTLGDDFNWKTAWSAIFSVG
                     LRPCSGALIVLTFALLNGLMVGGLLSVFAMALGTFITVAVLATLAVTAKNTALRFAGS
                     KAMSGRLKAAIEVCAALFITLTGALLLSAALVK"
     gene            complement(93919..94623)
                     /locus_tag="BAB_RS26810"
                     /old_locus_tag="BAB2_0095"
                     /db_xref="GeneID:3828003"
     CDS             complement(93919..94623)
                     /locus_tag="BAB_RS26810"
                     /old_locus_tag="BAB2_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967172.1"
                     /db_xref="GI:489057048"
                     /db_xref="GeneID:3828003"
                     /translation="MKFSMLVSLWPRRSFVRSAAIALLAGCLPTLAHAHPHVFAEARL
                     ELTIAPDGTVQQLAHVWRFDDVFSSTALMEFDKKGDLQLDHKELVDLAHVINSSIAEF
                     KYFQSVLADGKDVKMARPTDLAAAFTDNRLLIVFTSKPEKPLKLAPGHKVSFGVYDPT
                     FYTAIDYVKDSDLVVKGLPAGCTSKVIRPDPDEAIAQNQATLTDAFFNDPTGTDMSKI
                     FATRLEIDCAAKGKTG"
     gene            complement(94663..95556)
                     /locus_tag="BAB_RS26815"
                     /old_locus_tag="BAB2_0096"
                     /db_xref="GeneID:3828004"
     CDS             complement(94663..95556)
                     /locus_tag="BAB_RS26815"
                     /old_locus_tag="BAB2_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006279860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002966481.1"
                     /db_xref="GI:489056343"
                     /db_xref="GeneID:3828004"
                     /translation="MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDEL
                     GARLLNRTTRQFSLTEAGHTYYHRALEIIREIDALQDAVSETSSDARGRIKLSAPRTF
                     ADAVIGQSLIDFCLAHPEIVLDVRLDDRFVDLVEEGFDLAIRITRLQDSSLIAKRLSP
                     FHSVLCGAPELIARVGKPQRPEDLTDRPCIVDTNARARNNWHFRNMDGSMMTVPVSGP
                     IEINSPVATKNAALAGLGFCMLPAFIAEDEIEQGKLITCLDEFIVRDGGIYAVYPHRR
                     YLPAKIRALVDFMTQWFKERE"
     gene            complement(95560..96765)
                     /locus_tag="BAB_RS26820"
                     /old_locus_tag="BAB2_0097"
                     /db_xref="GeneID:3828005"
     CDS             complement(95560..96765)
                     /locus_tag="BAB_RS26820"
                     /old_locus_tag="BAB2_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681276.1"
                     /note="catalyzes the hydrolysis of a monocarboxylic acid
                     amid to form a monocarboxylate and ammonia; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_002967173.1"
                     /db_xref="GI:489057049"
                     /db_xref="GeneID:3828005"
                     /translation="MANLDPFNALIAKPEKPLAHAASGPLAGERLAVKDIYDIAGMVT
                     GCGNPQILAESPVARKSAPVVEKLLAAGAEFIGKAQTDEVAFSMMGQNSHYPYPINPA
                     APDRVTGGSSSGSAAAVAGKLADIALGTDTGGSIRTPASFCGLIGLRSTHGRIPLEGI
                     MPLAPSLDTIGWFARDIALYEKVGAVLLGDDAQEFKLTQLLYMPVLEQLLLGQAETDA
                     YRAMFAKVRPHFATLKAASQPTLSIDELYLAFRQTQGAEAWENHGAWISSGNRQLGPR
                     IADRFAYGAEMTADMVKNQRARRARFAEEFEAIIGESAVLALPTVPGAAPLTGEPFEA
                     LQAYREQALRLLCLSGLSGLPQITLPLGSLRPGGTMHDAPFGISFIGPRGSDRTLIAL
                     AQTIISERS"
     gene            97350..98483
                     /locus_tag="BAB_RS26825"
                     /old_locus_tag="BAB2_0098"
                     /db_xref="GeneID:3828006"
     CDS             97350..98483
                     /locus_tag="BAB_RS26825"
                     /old_locus_tag="BAB2_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase"
                     /protein_id="WP_002966479.1"
                     /db_xref="GI:489056341"
                     /db_xref="GeneID:3828006"
                     /translation="MATQRIIDFLNTRRPEGPCLVVDTDVVRENYQGFEKALPYSRIF
                     YAVKANPAPEILRLLASLGSSFDTASVAEIEMALEAGATPDRISYGNTIKKERDIARA
                     FDLGIRLYAVDCVEEVEKIARVAPGSRVFCRVLTDGEGAEWPLSRKFGCVPAMAKDVL
                     RRAKALGLDAYGVSFHVGSQQTDLTAWDRALADAAAVFRTLADEGIILRMVNMGGGFP
                     TRYLKDVPTAQAYGMAIFDALSRHFGNRIPETIIEPGRGMVGNAGVIKTEVVLVSRKA
                     DNDNVRWVYLDIGKFGGLAETMDEAIRYQIVTPHDGSETEPCVLAGPTCDSADVLYEK
                     TPYPLPVSLTIGDEILIEGTGAYTTTYSAVAFNGFEPLRSYVI"
     gene            complement(98559..100277)
                     /locus_tag="BAB_RS26830"
                     /old_locus_tag="BAB2_0099"
                     /db_xref="GeneID:3828007"
     CDS             complement(98559..100277)
                     /locus_tag="BAB_RS26830"
                     /old_locus_tag="BAB2_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chain-length determining protein"
                     /protein_id="WP_002969270.1"
                     /db_xref="GI:489059198"
                     /db_xref="GeneID:3828007"
                     /translation="MDGEDKRKSGSEGKPLLAFSDAPVSDSKKSRSTEDQASPTPPWT
                     PPASPRERAQYYRSHQSASSALTDEEIAGLREIGRDAASSEDKASPSDKEQPASDADE
                     NWPRRSNAAQDAEWKPLIDPRIAIDVIRGSRRLLLATTIFGGIVATLYALSLPQTYIA
                     STDILVDPRNIKVVGTELTPGQLPTDASLAVAESQARMIDSSSVLLKVINKAHLIQDP
                     EFNGTLVPTGIVGFFAQLKDLIGKKEQSDSQTMETRVLDNLRKSLTIHRDAKTFIYSI
                     SVTTREANKSASLANEISSVFQDELASLQSDAARRTSEELFQRLADLRASVEGAEKAV
                     ADFRATHDLIDVDGRLISNNELGRLNEQLTNQRAETVRLQARINVLKDATPDSVVAGT
                     LPEDLRSNTLTALRAQYAQARQAANGMATRLGPRHPQLIQLNSQANAVLNDISAELQR
                     VRSSLQVEVQRSQQQETALSARLAQLKARQANDAKDLVKLRELEREAAARRSIYEAFL
                     LRSRETSEQEGLNTVNIRVLSAARPPLEPAGSTRKLIVIAGLIAGFLAGLAITIIRNF
                     GRLLRL"
     gene            complement(100403..101305)
                     /locus_tag="BAB_RS26835"
                     /old_locus_tag="BAB2_0101"
                     /db_xref="GeneID:3828009"
     CDS             complement(100403..101305)
                     /locus_tag="BAB_RS26835"
                     /old_locus_tag="BAB2_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966477.1"
                     /db_xref="GI:489056339"
                     /db_xref="GeneID:3828009"
                     /translation="MARRQNMAEGRSPVKTAIVTASWDQDFERCKLLCETVDKYTTGF
                     TKHYILVESKDVALFRQLESSRRIIIDERDLLPSWLHAFWDPTHLWRRRIWLSLKTKP
                     LRGWHVQQLRRIALAGAMEEDGFLYMDSDMAFLRPFDCSTLWHGEKLRLFVRPNALAN
                     PKWPEHPVWAANAAKLLGIQNGKSGLNDYIGQLVSWRRDSVISMCERIEAHTGQHWVA
                     ALGKIRRFSECILYGRYVDDILKGVGHFHDTGDLCRVYWFSPPPTEDEFRAFIAGLEP
                     HQVAIGMQSFIGLSIDDIRRVINI"
     gene            complement(101263..101907)
                     /locus_tag="BAB_RS26840"
                     /db_xref="GeneID:23672483"
     CDS             complement(101263..101907)
                     /locus_tag="BAB_RS26840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006217782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /protein_id="WP_002969271.1"
                     /db_xref="GI:489059199"
                     /db_xref="GeneID:23672483"
                     /translation="MKQSWLNAHNANIAYENPVFRKALEDFLILPDGIGVDIASKVFY
                     GERFPANLNGTDFVPGLLQHMKRPLKIGLLGGLPGVAANAAQLFKKQVSRHDYRVISD
                     GYFKPANLDAILARLKDFHPDILLVAMGVPRQEFFIDAHITGEHCTIASGVGALFDLH
                     TGRVQRAPQWMRKLRMEWVYRLLQEPQRLAKRYLLGNPAFLWRVAKTWLKGDHR"
     gene            complement(102024..103214)
                     /locus_tag="BAB_RS26845"
                     /old_locus_tag="BAB2_0104"
                     /db_xref="GeneID:3828012"
     CDS             complement(102024..103214)
                     /locus_tag="BAB_RS26845"
                     /old_locus_tag="BAB2_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006163943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_002966475.1"
                     /db_xref="GI:489056337"
                     /db_xref="GeneID:3828012"
                     /translation="MQSFRLLFVTSLVPHAIAATGYEVANAAVIDGLRRAGADVTVLG
                     FTWPGHRAAEDPDTIVLGEVEVRTENAGLKRKVCWVLKSFLTGLTVSSAKLRVIPEQK
                     LRETIRQLGEFDAYVLNGVTLAGAFVDVFKDKPCLFVAHNVEHRSAEENAQNAGGIQK
                     FLFQREAGILKGLETRLCQQASFVFTFAQDDGPALGLDQDHFATLPLVTPGGMQIAQD
                     RPVEYDLALIGTWTWHPNRIGLEWFLHEVKPLLPQDISIAIAGSTPADLIEAWPGVNF
                     VGKVPDATAFVEAGALIPLISRAGTGVQLKTIETFELGMPSVATSHSVRGISQVPANC
                     TIANNPSDFAAAVIKQLEKIRTGDRQKLDGKIFTRSQIKGMDQAIARGLAALRRRLGN
                     TDCI"
     gene            103350..104342
                     /locus_tag="BAB_RS26850"
                     /old_locus_tag="BAB2_0105"
                     /db_xref="GeneID:3828013"
     CDS             103350..104342
                     /locus_tag="BAB_RS26850"
                     /old_locus_tag="BAB2_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_002969272.1"
                     /db_xref="GI:489059200"
                     /db_xref="GeneID:3828013"
                     /translation="MSALPDHIEVISKTSDLRFEDIDIVVTLPTFRRPDHLIRTLDTL
                     KAQKTEKRFAVIVIENEAEKREGAEVAAPLFADGTYRGMLIVESHRGNCNAYNAGWLT
                     AMTCFPNFKYILVIDDDELADPMWIENMVSAAGRFDASLVGGPQYPVFEKPNSQQWAK
                     HPVFMPPYTKTGAVPIIYSSGNLLIARPVLEAIGYPFLDLMFNFTGGGDSDFVGRSKA
                     KGFRIAWCAEGIVRETIPARRLEGDWIRARGLRNGVLSTLTEQRRRKDEPCGQIRVFL
                     KSLALLAYSPIKALRSGLAAGFAPAGMYFIYVGLGRVLAHFGYLNEQYRNPDKN"
     gene            104311..105636
                     /locus_tag="BAB_RS26855"
                     /old_locus_tag="BAB2_0106"
                     /db_xref="GeneID:3828014"
     CDS             104311..105636
                     /locus_tag="BAB_RS26855"
                     /old_locus_tag="BAB2_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008937027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin transporter BioY"
                     /protein_id="WP_002967174.1"
                     /db_xref="GI:489057050"
                     /db_xref="GeneID:3828014"
                     /translation="MSNIVTRTRTDARMPDATGPQARIRRIALVIASVIFGVLLISFR
                     PFTPAGGAETETGGDIINQLGFSCVGAVALASMAMFANLRKLAGIIRPGWLVMLVFLF
                     ASIFASSDPATAVRGVLLTTVGIVAIIAVLVLPQDGDGYSALLVSVASVVIVISYAGV
                     VLLPSLGTHGADAIEPQNSFLWRGVFSHKNIAGPVMAVFAFAGLYLWRRGWKTSGLLI
                     GLSALGFVSQTGSKTTMALVPFAMLLVVLPGLMGLRKLTAGLIFAIQLAFATFIFGVV
                     LFEPIRRLVENMDVDATFTGRVSIWKFALEALSKRPWTGYGYESFWSSAYARHAARPY
                     YLDWDVRGIVHGHNSYLDVAMTMGIPALLCAIAVIIVMPLVHYARCRPVRENMLLADF
                     FLMIVLFGTLNAMMESFYFRRMDPVWLTLILAIFGLGMTAKVVIPKRSV"
     gene            105650..106786
                     /locus_tag="BAB_RS26860"
                     /old_locus_tag="BAB2_0107"
                     /db_xref="GeneID:3828170"
     CDS             105650..106786
                     /locus_tag="BAB_RS26860"
                     /old_locus_tag="BAB2_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011265393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002966472.1"
                     /db_xref="GI:489056334"
                     /db_xref="GeneID:3828170"
                     /translation="MNIAIIGTGFVADYYMTTLRNYPELSLRGVYDRSPERLKAFVAH
                     YNVPAYESYEALLADPDVQIVVNLTTPESHFAVSHAALCAGKHVYSEKPLAMDFDDAK
                     ALLELARQSGLTLAAAPANGLSDAHKLVSSLIKTIGTPRLVYAEMEDGPVFRDKWSTW
                     RSQSGAPWPGLHEFEIGCTLEHAGYALSWLVSLFGPVESVSAFSAITFPDKGPGTEHL
                     HMAPDFSVGCLVFKSGLVARLTSGLAMPKDRSLTVVADKGSIVVDDLWDNRSAVRLER
                     VEEKRRFFARLFANLERRLGKFLSWKPGVGRKIAYPKTGKYALPSFPSQIDFMRGVAD
                     QARSISSGEKAFFSGDVALHITEIALALNNAGQGAAVYRMKSSF"
     gene            complement(106783..107832)
                     /locus_tag="BAB_RS26865"
                     /old_locus_tag="BAB2_0108"
                     /db_xref="GeneID:3828171"
     CDS             complement(106783..107832)
                     /locus_tag="BAB_RS26865"
                     /old_locus_tag="BAB2_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_002966471.1"
                     /db_xref="GI:489056333"
                     /db_xref="GeneID:3828171"
                     /translation="MTQNERIGGDFRWGIWGTDMIASSFAADIAASAGMRVVAVCSHT
                     TQTAQAFCRHIGINKAFGNPHAFLADPEIDAVYIASPNMLHVEQALDAIMAGKACLIE
                     KPLSLDPEGARQIETASKARNIFAMEAMWTRFLPAAQAVKHAIDASRIGTVTHIEADL
                     SYSRAYDPESRFFSPALGGGAAFDLGVYPLSLALYFLGLPEKVDGHCQRAASGVDLRS
                     EFNLGWPSATAWISCGFDRDGENRMLIEGTDGAILIHPPFLKAQRLTFFSRSALHSPF
                     GPKNSKGRIGNIINRLPLPGRTIETHAFAGNGLQFQAQAVRDAIRRGEISTPIMPLAQ
                     SAAVADIISRVLVSG"
     gene            108149..109558
                     /locus_tag="BAB_RS26870"
                     /old_locus_tag="BAB2_0109"
                     /db_xref="GeneID:3828241"
     CDS             108149..109558
                     /locus_tag="BAB_RS26870"
                     /old_locus_tag="BAB2_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686833.1"
                     /note="catalyzes the formation of D-ribulose 5-phosphate
                     from 6-phospho-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="WP_002967175.1"
                     /db_xref="GI:489057051"
                     /db_xref="GeneID:3828241"
                     /translation="MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIE
                     KAGRLRDKIIPCPTFEELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDA
                     GNSDYRDTVRRLKALGPNDPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLA
                     VAAKYQGEPCCALVGPDGAGHFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGD
                     VFEKWNEGPLNSYLIEITAKVLKSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILG
                     VPATGIEAAVAARSLSSMKGEREEAAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIA
                     AYAQGFAVMEAASREHGWNIPLATTARIWRAGCIIRSQLLDDIAQAFEGNESRNLLMA
                     PAFVPRMETSVKSLRQIVAQAALASLPLPALGSALSYFDSYTQALGTANLIQGQRDFF
                     GSHGFKRIDKEGDFHGPWG"
     gene            complement(109654..110715)
                     /locus_tag="BAB_RS26875"
                     /old_locus_tag="BAB2_0110"
                     /db_xref="GeneID:3828172"
     CDS             complement(109654..110715)
                     /locus_tag="BAB_RS26875"
                     /old_locus_tag="BAB2_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010660707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter ATPase"
                     /protein_id="WP_002967176.1"
                     /db_xref="GI:489057052"
                     /db_xref="GeneID:3828172"
                     /translation="MAFLNIKNLKKSFGTNTVVHDFNLAVEKGEFVSFLGPSGCGKTT
                     VLRMIAGFETSDDGSIEIDGKDVVNLRPNQRNIGMVFQAYALFPNMTVAQNVSFGLRV
                     SGKSRSEIDATVKEMLSLIRLDHLADRYPYQMSGGQQQRVALARALATKPQVLLLDEP
                     LSALDAKIRISLREEIRAIQQKLGITTVFVTHDQEEALSISDRIVVMHEGRADQIGSP
                     FDIYNRPASRFVASFVGTLNMLEASVSEPAQNSIDLDGRQITVQETLAHHPKGKPLTL
                     ALRPEAVSLEARKSHDTSLEATIDDVHFLGSVIRTRVILGKNRLSFDTFNDPTHPPPQ
                     RGDKVTVHFASHDLLVLAD"
     gene            complement(110721..111539)
                     /locus_tag="BAB_RS26880"
                     /old_locus_tag="BAB2_0111"
                     /db_xref="GeneID:3828173"
     CDS             complement(110721..111539)
                     /locus_tag="BAB_RS26880"
                     /old_locus_tag="BAB2_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_002972196.1"
                     /db_xref="GI:489062169"
                     /db_xref="GeneID:3828173"
                     /translation="MKSKGSNLRKISAQKIGAWIAFFVGAIYFLVPLIGTFEFSLRMR
                     RGEYSFDAYRVVFADANFQATFTYSIVLGLLTIIFGVLLAVPTAYWVRLRLPQLRPVM
                     EFITLMPLVIPAIVIVFGYLRIYNSSSWLPFTASTRATDVLLMFGYMTLSLPYMYRAV
                     DTAMRTIDVNTLTEAAQSLGAGWGRIMFKVIFPNVISGVMSGAFITFAIVIGEFTLAS
                     LLNRPAFGPYLQLVGANRAYEPSALAIISFGITWLSIIMLQLVSRLNKFKTTAG"
     gene            complement(111536..112429)
                     /locus_tag="BAB_RS26885"
                     /old_locus_tag="BAB2_0112"
                     /db_xref="GeneID:3828174"
     CDS             complement(111536..112429)
                     /locus_tag="BAB_RS26885"
                     /old_locus_tag="BAB2_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_002967177.1"
                     /db_xref="GI:489057053"
                     /db_xref="GeneID:3828174"
                     /translation="MSSVAETTAPTSGVRKRQLPLSWLGVAPFFLFAILFLIWPTMYL
                     IIGAFQDPAGNFTLQNIHDLFQPQIMSAYWISIKVSFASAVGGAIIGFFLAWAVVLGN
                     LPSWLRPTVLTFSGVASNFAGVPLAFAFLATLGRTGFVTILLREWFGFNLYSTGFNLL
                     SFFGLTLTYLFFQIPLMVLILTPALDGLKKEWREASSILGATHMQYWRMVAFPILWPS
                     LLGTTLLLFANAFGAIATAYALTGSSLNIVPILLYAQIRGDVLHNQNLGYALALGMIV
                     ITGVSNLLYIWLRIRAERWQR"
     gene            complement(112638..113741)
                     /locus_tag="BAB_RS26890"
                     /old_locus_tag="BAB2_0113"
                     /db_xref="GeneID:3828175"
     CDS             complement(112638..113741)
                     /locus_tag="BAB_RS26890"
                     /old_locus_tag="BAB2_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006172475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_002966466.1"
                     /db_xref="GI:489056328"
                     /db_xref="GeneID:3828175"
                     /translation="MLSYTARLLSLSTAIAVAGVSIATAEPSAELIAAAKAEGELTTI
                     ALPHDWCGYGDIIKSFKDKYGIKVNELNPDAGSGDEVEAIKANKNNKGPQAPDVIDVG
                     FAFGTSAKKDGLTQAYKVSTWDEIPDSAKDPEGHWYGDYYGVLAFEVNKDIVKDAPQD
                     WEDLLKSDYANAVALAGDPRVSAQAILGVHAAGIARGAEPGEAAGKKGLEFYKELNAN
                     GNFVPVIGKAASLAQGSTPIVIRWDYNSLADRDTLNGNPEVETIIPKSGVIAGVYVQA
                     ISAYAPHPNAAKLWMEHIYSDEGQLGYLKGYCHPIRFNAMAKAGKIPQELLDKLPPAA
                     AYEKAIFPTIEQIEAAQATITKDWDSVVGANVQ"
     gene            complement(114150..115214)
                     /locus_tag="BAB_RS26895"
                     /db_xref="GeneID:23672484"
     CDS             complement(114150..115214)
                     /locus_tag="BAB_RS26895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002969273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_002969273.1"
                     /db_xref="GI:489059201"
                     /db_xref="GeneID:23672484"
                     /translation="MIGLVATLAPTIGGYLSHAFSWHWLFLVNVGPGILVTIAAWNLI
                     DFDEGDLSLLDKFDWWGLFGMAAFLGSLEYVLEEGPRNDWLQDHTIFIMSIILTVGAI
                     VFFYRVFTAEQPIVDFRAFRNMNFAFGSLFSFVMGVGLYGLTYLYPLYLSMIRGYDAL
                     MIGEALFVSGLAMFFTAPVAGFLSNRMDPRLMMMIGFVGFAIGTWLVTGLTADWDFNE
                     LLMPQILRGCSLMLCMVPINNLALGTLPPSLMKNASGLFNLTRNLGGAVGLAEHVRNG
                     NAEAENMIANLTAKYNAAGMDGASIAIAKLSGMVRQQATLLSFIDVFFILTMMFCSLA
                     ICAMLLRKPSPAAGGGGGGH"
     gene            complement(115211..115672)
                     /locus_tag="BAB_RS26900"
                     /db_xref="GeneID:23672485"
     CDS             complement(115211..115672)
                     /locus_tag="BAB_RS26900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006092500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_002969274.1"
                     /db_xref="GI:489059202"
                     /db_xref="GeneID:23672485"
                     /translation="MAADTTIGTVGGKNPADDRIDPKKTIGFMAMVFGMFMAILDIQI
                     VSASLSEIQAGLGASTDEISWVQISYLIAEVIMIPLSGFLGRLLSTRVLFTISATGFT
                     LASMLCATATNIEQMIVYRAIQGFIGGGMIPSVFAAAFTIFPPPSDPSSHR"
     gene            complement(115765..116706)
                     /locus_tag="BAB_RS26905"
                     /db_xref="GeneID:23672486"
     CDS             complement(115765..116706)
                     /locus_tag="BAB_RS26905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="WP_002972193.1"
                     /db_xref="GI:489062166"
                     /db_xref="GeneID:23672486"
                     /translation="MSTPKSVDKADIRPFPTAKTVAPLHQPATNEAPANERTQPHAVP
                     DKAVSAKGGAKKGFGKRVVLPSLVAVAAIGALWYGYNWWTVGRFMVSTDDAYVQGDIA
                     SIAPKVTGYIENIPVAANQQVKAGARLAGVDAQIASAKANISVLEAQYNEAASSTKSL
                     ELARDKAARDLSFTSLRAPFDGVIGNLSGKKGDLVAPGQKIAALVPVDQLYIDANFKE
                     TQLAHIKVGETAHIYVDAIDGTKFDGKVASIAPASGAVFSLLPPENATGNFTKVVQRV
                     PVRITIPKEAFESGKIRAGLSVIVDVDTRTAPDQTAN"
     gene            116831..117574
                     /locus_tag="BAB_RS26910"
                     /old_locus_tag="BAB2_0117"
                     /db_xref="GeneID:3828179"
     CDS             116831..117574
                     /locus_tag="BAB_RS26910"
                     /old_locus_tag="BAB2_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_002966461.1"
                     /db_xref="GI:489056323"
                     /db_xref="GeneID:3828179"
                     /translation="MKPARNTSRIGDISDDKKGELRSAPDKAELSASCLPETECGRTR
                     LAAGQDPAKRSQILEGAQSVFLRMGFDAASMNDITREAGVSKGTIYVYFNSKEDLFVA
                     LCEHYRQTLFSSFIGQLEKGFSNRQELIDFGVALTTLITSSIAIRAQRIVVGVSERKP
                     ELAARFYERGPKRSHAIMAQSLQAMIDAGVLEQHDVTRTAYQLSDLFFAGLYRPRLFG
                     ALAEAPSEQAIRDNVESAVDFFFRAYGKK"
     gene            117848..118627
                     /locus_tag="BAB_RS26915"
                     /old_locus_tag="BAB2_0118"
                     /db_xref="GeneID:3828180"
     CDS             117848..118627
                     /locus_tag="BAB_RS26915"
                     /old_locus_tag="BAB2_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006128260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type quorum sensing-dependent
                     transcriptional regulator VjbR"
                     /protein_id="WP_002966460.1"
                     /db_xref="GI:489056322"
                     /db_xref="GeneID:3828180"
                     /translation="MSLDLVHFPNYKKTFFGSSFQSDTLALLTRIRDEIGCRYVTHTY
                     RGRVGDCTKVNSADLTVLMTLPATWVARYSSKNYFAIDPVFQEDAPYYRNDTSAIARD
                     LKEDADICPAVAELLHDAEKHGLGNLFIAVSARNPKGVAGCTVFTFEVEDEDRTQFLA
                     RMRPRLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEIAEILSIAR
                     WTVVTYLQNAKIKLNCSNRTSAVATALSLGIIDMPEVQHLV"
     gene            complement(118593..119123)
                     /locus_tag="BAB_RS26920"
                     /old_locus_tag="BAB2_0119"
                     /db_xref="GeneID:3828181"
     CDS             complement(118593..119123)
                     /locus_tag="BAB_RS26920"
                     /old_locus_tag="BAB2_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002970489.1"
                     /db_xref="GI:489060433"
                     /db_xref="GeneID:3828181"
                     /translation="MKSLQFSKERETIIAENIRDVVSDLRLVDPADYIAFIRCELFAN
                     IADLVSSAAELYFYPGTLGLGHGGEFHCDWQSPPSITLDMEFRHQGVYAYFRITLTDR
                     TAGVELNHIAFEDADGDPSANTVRLAKAFEDARCPCANAPETRLSFSFRLLRRRAEGF
                     RATMLIRRDAVPRAYR"
     gene            complement(119234..120304)
                     /gene="flhB"
                     /locus_tag="BAB_RS26925"
                     /old_locus_tag="BAB2_0120"
                     /db_xref="GeneID:3828182"
     CDS             complement(119234..120304)
                     /gene="flhB"
                     /locus_tag="BAB_RS26925"
                     /old_locus_tag="BAB2_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444205.1"
                     /note="membrane protein responsible for substrate
                     specificity switching from rod/hook-type export to
                     filament-type export; Bradyrhizobium has one thick
                     flagellum and several thin flagella; the Bradyrhizobium
                     protein in this cluster is associated with the thin
                     flagella; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="WP_002967179.1"
                     /db_xref="GI:489057055"
                     /db_xref="GeneID:3828182"
                     /translation="MADDADKESKTEEATEQKIRDAQDKGNMPFSREAPILAGIASFL
                     VIAVFVAAPAATRLAVFLRELIDRPEDWLLNSAEDATRLFSVLALAVGAALVPVFIII
                     PLAGIAASAFQNAPRFVGERIRPQASRISPLKGWQRIFGRAGQVEFLKSLAKLLAASV
                     IVFLVFFKGDSLFTDAVATDPGALPEFLRKNVVRLLVANVLAIAAIAGFDLAWSRIHW
                     RQELRMTRQEVKDELKQSEGDPLVKSRLRSLGRDRARRRMINAVPTATLIVANPTHFS
                     VALRYKPNEDAAPVVVAKGQDLIALKIREIAASHSIPVFEDVQLARALYKQVNVDQMI
                     APEFYKAVAELIRIINTRRAIS"
     gene            complement(120321..120767)
                     /locus_tag="BAB_RS26930"
                     /db_xref="GeneID:23672487"
     CDS             complement(120321..120767)
                     /locus_tag="BAB_RS26930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006076651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="WP_002972190.1"
                     /db_xref="GI:489062163"
                     /db_xref="GeneID:23672487"
                     /translation="MPWCSDAGPLKAHHGQIANIFNQLDRSEMEKLMASLQDLNRDDL
                     NRIKAKLFTFEDIERLSQRARLLLFDEVQTEQIATALREADPKLQELVLSSLSARGRR
                     MVESELSAEQGNITSQNIAEARRIIARIAIDLSERGIITLDATPET"
     gene            120853..121047
                     /locus_tag="BAB_RS26935"
                     /db_xref="GeneID:23672488"
     CDS             120853..121047
                     /locus_tag="BAB_RS26935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972188.1"
                     /db_xref="GI:489062161"
                     /db_xref="GeneID:23672488"
                     /translation="MLVAEIGLQAFHRQAGNLYPYRFLHQLRLHTVFENRVHFFLRQR
                     IAQQPLKALGGFRNGCAFGE"
     gene            complement(121308..121655)
                     /locus_tag="BAB_RS26940"
                     /old_locus_tag="BAB2_0122"
                     /db_xref="GeneID:3828184"
     CDS             complement(121308..121655)
                     /locus_tag="BAB_RS26940"
                     /old_locus_tag="BAB2_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006191659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="WP_002966456.1"
                     /db_xref="GI:489056318"
                     /db_xref="GeneID:3828184"
                     /translation="MSAETKDRNMQQELNEAIEELREEKPRSAQKSASKPNLDLIMGI
                     PVDVQVVLGGTTMPVSSLMKLGRGAVITLDKQIGDPVDIVVNGRVIARGEVIVLEDDS
                     SRFGVSLTEIIGK"
     gene            complement(121652..122113)
                     /locus_tag="BAB_RS26945"
                     /old_locus_tag="BAB2_0123"
                     /db_xref="GeneID:3828185"
     CDS             complement(121652..122113)
                     /locus_tag="BAB_RS26945"
                     /old_locus_tag="BAB2_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966455.1"
                     /db_xref="GI:489056317"
                     /db_xref="GeneID:3828185"
                     /translation="MSLLLANVLSTLMALASLAALIVVGRKANETIRLGKVLALRVAA
                     ASNGLERAVKAIRNERTDLTDASAKLDARLAETQRVRREMDEAIEELNRLRKALSRDM
                     RQARILAETPPPRQEKTPSAAEQPLPADKNALPVFVRRAVKKATVELAGQA"
     gene            complement(122094..122390)
                     /locus_tag="BAB_RS26950"
                     /db_xref="GeneID:23672489"
     CDS             complement(122094..122390)
                     /locus_tag="BAB_RS26950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="WP_002972184.1"
                     /db_xref="GI:489062157"
                     /db_xref="GeneID:23672489"
                     /translation="MDQADPAWAKKLRQEVSRARIELEAFMQQGSMSLDALSRLEIGQ
                     VLKLPVDAMEQVRLRAGNQQLFKCTLGKSGIHFTVKVGDPVNQEEDLIDELVAG"
     gene            complement(122342..123043)
                     /locus_tag="BAB_RS26955"
                     /db_xref="GeneID:23672490"
     CDS             complement(122342..123043)
                     /locus_tag="BAB_RS26955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="WP_002966454.1"
                     /db_xref="GI:489056316"
                     /db_xref="GeneID:23672490"
                     /translation="MDDATTLEHNRKNDALAENLLRAAGLSGDDLKSLAHVFKDASSH
                     FCARLKQGSAAAFDAETGSVESTDKTAFNDIFDKAAIITPLKAERWGCSLYLALDAVL
                     VFSVIEAMFGAQGNLGPVDADHPFGMVEQKIANLLAGHLAGALDRVFNTSSSQPLFAP
                     GDCIDTADFDRENFELSRLFTCRIAVTAAGKTGQMHLLLPRSTQKRCRMQLPPFFAAR
                     WIRPTRPGPKSFARR"
     gene            complement(123045..123917)
                     /locus_tag="BAB_RS26960"
                     /old_locus_tag="BAB2_0126"
                     /db_xref="GeneID:3828188"
     CDS             complement(123045..123917)
                     /locus_tag="BAB_RS26960"
                     /old_locus_tag="BAB2_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_011265394.1"
                     /db_xref="GI:499584611"
                     /db_xref="GeneID:3828188"
                     /translation="MGIIVGLVITLGCMLGGFIAMGGHVSVLIQPWEFIIILGAALGT
                     FFVANPFSLVKDTGRACMEAFTDAVPKQRDYLDVLGVLYSLMRELRAKSRNEVEVHID
                     NPKESPIFLAYPSVLKKEDLTNFICDYCRLIIVGNVRSYEIEALMDEEIRTIARDKLK
                     PYQAMITISEALPALGIVAAVLSVIKAMGALDQSPEVLGHLIGAALVGTFAGIFFSYG
                     VIGPIANKIKSTREKNNRLYIVVKQTLLAYMNGSLPQIAVEYGRKTISAYERPTIDVV
                     EQETMASVPTQQAA"
     gene            124063..124851
                     /locus_tag="BAB_RS26965"
                     /old_locus_tag="BAB2_0127"
                     /db_xref="GeneID:3828189"
     CDS             124063..124851
                     /locus_tag="BAB_RS26965"
                     /old_locus_tag="BAB2_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgF"
                     /protein_id="WP_002966452.1"
                     /db_xref="GI:489056314"
                     /db_xref="GeneID:3828189"
                     /translation="MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKS
                     VDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFAT
                     VFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAY
                     EILGDKALLTMLQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTA
                     MHEMNNPTASSPASIASFLLGGTSSIGISMNILATLQNFKPGGR"
     gene            124851..125582
                     /gene="flgF"
                     /locus_tag="BAB_RS26970"
                     /old_locus_tag="BAB2_0128"
                     /db_xref="GeneID:3828212"
     CDS             124851..125582
                     /gene="flgF"
                     /locus_tag="BAB_RS26970"
                     /old_locus_tag="BAB2_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006236266.1"
                     /note="FlgF, with FlgB and C, makes up the proximal
                     portion of the flagellar basal body rod; Bradyrhizobium
                     have one thick flagellum and several thin flagella; the
                     protein in this cluster is associated with the thin
                     flagella; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgF"
                     /protein_id="WP_002966451.1"
                     /db_xref="GI:489056313"
                     /db_xref="GeneID:3828212"
                     /translation="MQNNSIYVGLSSLITLERRMDAIAHNVANASTVGFRGEGTKFDT
                     IVSDKASDDVSFATAGKSYIRTEAGPLIKTDNPLDVAVKGDAWMSFSTPQGQVYSRDG
                     RMKMLSTGDPVSVTGNAILDVGGAPIVLNPGGGAPRISSDGAIYQNGVQVGAIGLYTI
                     PADADLAYAGTSGVIPSKPAQPVVDDNSVGVVQGMIEGSNVDAMTEMTRLISISRAFE
                     QVNNLLSQQEATVSEAIKTLGSKNG"
     gene            125579..126940
                     /gene="fliI"
                     /locus_tag="BAB_RS26975"
                     /old_locus_tag="BAB2_0129"
                     /db_xref="GeneID:3828221"
     CDS             125579..126940
                     /gene="fliI"
                     /locus_tag="BAB_RS26975"
                     /old_locus_tag="BAB2_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934440.1"
                     /note="involved in type III protein export during
                     flagellum assembly; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase"
                     /protein_id="WP_002966450.1"
                     /db_xref="GI:489056312"
                     /db_xref="GeneID:3828221"
                     /translation="MTPDLPLTRLAAFVRQQTIAPEPLTGIGGTVSDVSRSSIAVRGL
                     SRDARLGDTVAIRAGEGAPSLAEIIRVADLQVLVKPFDDRIMPSLGAAVFEEGPLRIR
                     PAPEWRGRVINALGNAIDGKGALKPGTRPMAAESLAPAALRRARVDRGLRTGVNVIDI
                     FTPLCFGQRIGIFAGSGVGKSTLLAMMTRAADFDTVVLALTGERGREVREMLEETMAG
                     HLGKTITVVATGDESPMMRRLAPNTATAIAEYFRDLGQNVLLIVDSVTRFAHAAREVA
                     IAAEEPPVARGYPPSVFSQLPRLLERAGPGSAEAGGSITGIYSVLVDGDDHNDPVSDT
                     IRGTLDGHIVLDRAIAAQGRFPAVDIPASVSRLAKHNWTPEQRKLVMQLRSMVARFEE
                     TRDLRAIGAYQKSHDGLLDQAVDFVPRIYEALQQSPETGLSDDPYNDLAAALRGDRQA
                     QNA"
     gene            126937..127542
                     /locus_tag="BAB_RS26980"
                     /old_locus_tag="BAB2_0130"
                     /db_xref="GeneID:3827184"
     CDS             126937..127542
                     /locus_tag="BAB_RS26980"
                     /old_locus_tag="BAB2_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966449.1"
                     /db_xref="GI:489056311"
                     /db_xref="GeneID:3827184"
                     /translation="MMTGFRKPKEDKNLTRLTAAVAAAARKEGMKKPLSKGDRYLVIA
                     VIALAAASALLPIVTYLQRVDFNPANKAERKIIDPLDRSEQKTVRRFPSFRPSEQVAP
                     ASEVDKTMTGSVMSNGKGLPGAGKGEGEIGDGRGQPFPKPVFALRDVVGGMAMIEDAS
                     GYWFVEKGSLLPDGSRLVSIGRGAGTWQLTTSSGDIIDMRR"
     gene            complement(127567..128544)
                     /locus_tag="BAB_RS26985"
                     /old_locus_tag="BAB2_0131"
                     /db_xref="GeneID:3827185"
     CDS             complement(127567..128544)
                     /locus_tag="BAB_RS26985"
                     /old_locus_tag="BAB2_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_002966447.1"
                     /db_xref="GI:489056309"
                     /db_xref="GeneID:3827185"
                     /translation="MKQAHGPDDNRSMWMLMGIGIVCVFGFFIQILVLSRYLDRPLAL
                     FMASQKGTALVDIAAHITKFGKAYWFLVPAAALFVFYRFINRSPQKSFNCFFIIASIA
                     VSGIVIKILKIIFGRARPGVLIDDGFYGFTFFRLDREFNSFPSAHTGVAIAAGVALAL
                     IMQKHRWVPIILGIVIASSRIIINAHYLSDVVASSLISTVTVLLLYDILGYFGYRAGE
                     PDRHSPDMQGSLKLMSNVIGAPVAEHENGQRPQDGLTTRIIGVMNIAAILILIGLIFD
                     FVLIEWFEWQYQPAELIPGWWLPAAITLCALGVGASLYVGRAGRGCARR"
     gene            129088..129483
                     /locus_tag="BAB_RS26990"
                     /old_locus_tag="BAB2_0132"
                     /db_xref="GeneID:3827186"
     CDS             129088..129483
                     /locus_tag="BAB_RS26990"
                     /old_locus_tag="BAB2_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966445.1"
                     /db_xref="GI:489056307"
                     /db_xref="GeneID:3827186"
                     /translation="MAPRAMFKRFPIFVGGSAIGAVIDYVVTLSASNYINLYPPVALA
                     LAMLISGSVVFFFHIRITFQYSTHKIFRQYALFMGWTCAIYFLRAAMLQICLYAGLPL
                     AVALILAIGLASVINFVISSVIIFAKSPA"
     gene            129480..130460
                     /locus_tag="BAB_RS26995"
                     /old_locus_tag="BAB2_0133"
                     /db_xref="GeneID:3827187"
     CDS             129480..130460
                     /locus_tag="BAB_RS26995"
                     /old_locus_tag="BAB2_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bactoprenol glucosyl transferase"
                     /protein_id="WP_002966444.1"
                     /db_xref="GI:489056306"
                     /db_xref="GeneID:3827187"
                     /translation="MNAKTLCIIVPVYNEAEGLSDLLDRLHSAADSIASQFTLNIEFI
                     FIDDGSSDGSFALLKAHDFGSRPVRLLRFSRNFGKEAALSAGIDAAEGADAAILMDAD
                     LQHPPEMIADFVRIWQEEDADSVYAYKASRLASEGPVKAALSRAFFWVINRDQRYKIP
                     PGAGGFRLVNRRFMAALRSLPESDRFMKGLYGWVGFNQVGLPLQPPPRMRGTSYYNPL
                     QLLLMSLGAMTSFSTTPLRLMALAGIVVAGLSAAYGLYVLSEYFFFPGVPVGLTSILA
                     LTAFFGGIQLMFLGLLGEYIGKSVLEAKKRPIYILAEDIRRKESDDADRG"
     gene            130441..131193
                     /locus_tag="BAB_RS27000"
                     /old_locus_tag="BAB2_0134"
                     /db_xref="GeneID:3827188"
     CDS             130441..131193
                     /locus_tag="BAB_RS27000"
                     /old_locus_tag="BAB2_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006124843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid dehydrogenase"
                     /protein_id="WP_002966443.1"
                     /db_xref="GI:489056305"
                     /db_xref="GeneID:3827188"
                     /translation="MMRIADDFGLGRGHDRVILSLLETGRLDGTSVMMNDAMNPEDIA
                     RLRKLRAGGAKVGLHLNLTQALPGGGPIWPLGELIRPLLGAPFLGAITASLVRQVDAF
                     VTQFGSLPDYYDGHQHCHCFPAIAPLVARLSYGPATWVRVPLPATWEGRWLNIRAGGA
                     KVLLILALAARARAIFVRAGLKTNHDFSGFLRLGDPASVRRWLPELLARATPDCLIML
                     HPGDGADPVQCAGHAAGSRAIEARILFESPIK"
     gene            131190..132626
                     /locus_tag="BAB_RS27005"
                     /old_locus_tag="BAB2_0135"
                     /db_xref="GeneID:3827189"
     CDS             131190..132626
                     /locus_tag="BAB_RS27005"
                     /old_locus_tag="BAB2_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016149374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /protein_id="WP_002969003.1"
                     /db_xref="GI:489058923"
                     /db_xref="GeneID:3827189"
                     /translation="MMKNRAIVWGLFLLLFVRLLAMIWVPLTDPTEARYAEIARKMFE
                     TGNWITPQFDYGVPFWAKPPLHTWLSAAGIAIFGTTAFTARLGILLASLATLTILWQW
                     ACTLTDRRTATIAVLVAASSGLFYVSAVFVQTDMVLTLGVTASMAGFYNGLAGSRRWG
                     WLFFLGLAIGLLAKGPVAVVLSATPIAVWMLWRGNWRDLKHLPWAGGLTLCAVLVIPW
                     YVAAEIAPPGFLKYFLIGEHIQRFLQPGWSGDLYGAGREHARGSIWLFWIVATLPWSP
                     LLPVLIWRLRKNGMPDGKGLHLYLLLFALTPLVFFTPAANILLAYVLPGVPAAALLAV
                     ILWTRTGPAGAGWLKLGVVEVLLIFLVITIGSFFGLGRSFLPTQAPLIASYSGPGRLA
                     ILGGRSFSAEFYTQDKIVRFQTLNELAAWLKPGDGVLVPKSAYDAFAARFGNAVKPIS
                     EDRKYLLFIPIPAASVAKGTGAAAGAVI"
     gene            132623..132808
                     /locus_tag="BAB_RS27010"
                     /db_xref="GeneID:23672491"
     CDS             132623..132808
                     /locus_tag="BAB_RS27010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006643157.1"
                     /db_xref="GI:493693254"
                     /db_xref="GeneID:23672491"
                     /translation="MKAMQTEMSARFLLEATTTHLPKPKNIITPRWTKRWRLHNLHQI
                     PPVNLALFTSRRTHDDK"
     gene            132798..133826
                     /locus_tag="BAB_RS27015"
                     /old_locus_tag="BAB2_0136"
                     /db_xref="GeneID:3827190"
     CDS             132798..133826
                     /locus_tag="BAB_RS27015"
                     /old_locus_tag="BAB2_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006210427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_002966441.1"
                     /db_xref="GI:489056303"
                     /db_xref="GeneID:3827190"
                     /translation="MTNNAFFSTDMVESRFRNDLVRAAMKPMYEIIMDPNDRSYELSG
                     SAKLYASGLITIGTTTFNTQSYARTPKIIAQGGLDFYVLQLLTGGHLLGDFDGTDVAA
                     KPGDIVIIDMAKTLVSRAFKGSRTTVFIPRAELEEVVGGRNLHGLVLSGTRPITRLLF
                     SYIQELNAVVPDLSMDEAIAAQKVMLTFLRTGITGLEEDLVGFLPVNLPMKKRILSFI
                     DQNLSDPLLGPRTIIQNFHVSRSHLYRAFENDGGVAKTIRDKRLDRAFRILAEERNRT
                     VYSKEVAYRCGFNDPAQFASAFKNRFGMSPRDVQASGATLLSLDVDGFSFPKYISQEI
                     AKVVPPSS"
     gene            134183..134620
                     /locus_tag="BAB_RS27020"
                     /old_locus_tag="BAB2_0138"
                     /db_xref="GeneID:3827192"
     CDS             134183..134620
                     /locus_tag="BAB_RS27020"
                     /old_locus_tag="BAB2_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966440.1"
                     /db_xref="GI:489056302"
                     /db_xref="GeneID:3827192"
                     /translation="MATEFEHGPDMYTPEDVIKNFKDHSSQSRSRGTKTLENEKHTAN
                     GRMVKRYTPEERRKVFSEIATSVKSGQSSLKDALATAGISEQTYYNWKKIFTGNGPAS
                     STTLGKDLQELIELEAENQRLRQELADKLRMENAELRRRLGKV"
     gene            complement(134814..136115)
                     /locus_tag="BAB_RS27025"
                     /old_locus_tag="BAB2_0140"
                     /db_xref="GeneID:3827194"
     CDS             complement(134814..136115)
                     /locus_tag="BAB_RS27025"
                     /old_locus_tag="BAB2_0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002972182.1"
                     /db_xref="GI:489062155"
                     /db_xref="GeneID:3827194"
                     /translation="MKNSNTAITSPEVVENMTYRKVAFRIIPLLMICYIIAYLDRVNV
                     GFAKLQMSEELGFSEAIYGLGAGLFFIGYFFFEIPSNILLHKLGARLWIARIMITWGL
                     LSALFAFVQTEWQFYILRFLLGAAEAGFYPGVILYLTYWFPSHRRGKMFALFQAGSPA
                     AGIFGNPLSGWIMDQFHDTAGWQGWQWMFVLEAIPAVVLGVVILLYLDNSVKAAKWLT
                     EEEKAIISRDIEADSKGKAASHSLMSLVKNPMLWVMTLIYFCFVMGQYGLTLWMPTLI
                     RASGVTSNVTIGLLGAIPFICAIIAMVIFSRSADHYRERRWHLVVPALLGAVGFVVAA
                     SATNTTVSIIFLSMAAAGVLACAPLFWSLPTAILSGAAAAAGIALINSVANLAGFISP
                     YMVGIIRDATHSSELGMYVLAGFLILGAAIVLCIPASKVNR"
     gene            complement(136141..136773)
                     /locus_tag="BAB_RS27030"
                     /old_locus_tag="BAB2_0141"
                     /db_xref="GeneID:3827195"
     CDS             complement(136141..136773)
                     /locus_tag="BAB_RS27030"
                     /old_locus_tag="BAB2_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_002966437.1"
                     /db_xref="GI:489056299"
                     /db_xref="GeneID:3827195"
                     /translation="MTEQEIRELIVELGASLFARGYCVGSAGNISVRLADGYLMTPTN
                     SCLGRLRADRLSKLDKGWNHIGGDRPSKEVFMHRAVLGARPQAGAVVHLHSTYATAIS
                     CLSSPADTMPITPLTPYFVMRIGKHLPTIPYYRPGDPAMEREIHDAAQNASAMLLANH
                     GPVVSGNSLVDAVYAAEELEESARLSIMLQGLPARKLTDEQIEDLLHTFK"
     gene            complement(136799..137764)
                     /locus_tag="BAB_RS27035"
                     /old_locus_tag="BAB2_0142"
                     /db_xref="GeneID:3827196"
     CDS             complement(136799..137764)
                     /locus_tag="BAB_RS27035"
                     /old_locus_tag="BAB2_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006105221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966436.1"
                     /db_xref="GI:489056298"
                     /db_xref="GeneID:3827196"
                     /translation="MAKIVVTGGAGFLGSRLIRGLLASRGQNGVPSFDSIVSVDLVAC
                     SIDDPRITSVTGDIADPAFARSVITKGTVGVYHMAAALSGQSEAEFDVGMRVNIDGTR
                     ALLEAARATQEAPKFIFTSSLAVFGGEMPDVVPENLALLPQSSYGAEKAIGEFLVGDY
                     SRRGFIDGRICRLPTIVVRPGKPNSAASSFASGIIREPLAGIASNNPVPPATRMWLSS
                     PDIAARNLVHAITVEGSALGINRVLNLPGICVTVADMLDSLERIAGKDVRALVSAEPE
                     QRVIDIVCSWPGEFDIARPLALGFTRDADFDAVVRQYRDEFAHSS"
     gene            complement(137764..138555)
                     /locus_tag="BAB_RS27040"
                     /old_locus_tag="BAB2_0143"
                     /db_xref="GeneID:3827197"
     CDS             complement(137764..138555)
                     /locus_tag="BAB_RS27040"
                     /old_locus_tag="BAB2_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_002966435.1"
                     /db_xref="GI:489056297"
                     /db_xref="GeneID:3827197"
                     /translation="MIPAERQALIVSRLSARGILSIAELAEMLGVSPMTVRRDIHSLE
                     EQGRALSVAGGVQLPERIFSEPSHIVKAALYHNEKAAIGQLAAQMIRSGTVIYLDAGT
                     TTLEIAYRLTDRQDLTVVTNDFVIAAFLSQESNCKLFHTGGEVERENQSCVGSAAGEA
                     IRRFNFDLAFISTSSFGARGVSTPSENKIAVKRAVVESAVRRVLVTDSSKYGLIGTFN
                     AIPLDVLSAVVTDAGLPENARETITQRGVELHLVEAGTGKVEGKI"
     gene            complement(138552..139337)
                     /locus_tag="BAB_RS27045"
                     /old_locus_tag="BAB2_0144"
                     /db_xref="GeneID:3827198"
     CDS             complement(138552..139337)
                     /locus_tag="BAB_RS27045"
                     /old_locus_tag="BAB2_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate isomerase"
                     /protein_id="WP_002966434.1"
                     /db_xref="GI:489056296"
                     /db_xref="GeneID:3827198"
                     /translation="MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDADV
                     IARELKQHNLTQVLFNMPPGDWAAGERGMAAISGREQEFRDNVDIALHYALALDCRTL
                     HAMSGITEGLDRKACEETFIENFRYAADKLAPHGITVLVEPLNTRNMPGYFIVHQLEA
                     VGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHEPDEGEL
                     NYPYLFSVLESVGYRGWVGCEYNPRGKTESGLAWFAPYRDQSA"
     gene            complement(139337..140611)
                     /locus_tag="BAB_RS27050"
                     /old_locus_tag="BAB2_0145"
                     /db_xref="GeneID:3827199"
     CDS             complement(139337..140611)
                     /locus_tag="BAB_RS27050"
                     /old_locus_tag="BAB2_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002969002.1"
                     /db_xref="GI:489058922"
                     /db_xref="GeneID:3827199"
                     /translation="MRLGVIADDFTGATDIAGFLVGNGLRTIQLNGVPADDLAVDADA
                     VVISLKTRSCPTGQAIAESLAALKWLQKNNCQQFFFKYCSTFDSTPKGNIGPVTDALL
                     EALGEEFTVICPALPVNGRTIYNGYLFVNGVLLSETGMRNHPVTPMTDSNIMRVMESQ
                     SRGRAGNISSTIVDQGSDAVRDALRKLQSEGIRYAVLDALNDQHIETLGRAVSQMKLV
                     TGGSGLADGMARAWTQLRGKNVAAAEAAGAPVKGRTVILSGSCSQMTNAQVAAYKAKA
                     PALAMDVEKAINDAAYIDVLAEWVLAQSGDALPPLVYATMPPEALKAVQERFGGERAS
                     AAIEDLFGQLAKRLEAEGFTRFIVAGGETSGAVTQALAIDGFTIGPQIAPGVPWVRGI
                     GKPLSLALKSGNFGTEAFFFEAQKIANQEGDK"
     gene            complement(140613..141517)
                     /locus_tag="BAB_RS27055"
                     /note="oxidoreductase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23672492"
     gene            141887..142267
                     /gene="flgB"
                     /locus_tag="BAB_RS27060"
                     /old_locus_tag="BAB2_0148"
                     /db_xref="GeneID:3828211"
     CDS             141887..142267
                     /gene="flgB"
                     /locus_tag="BAB_RS27060"
                     /old_locus_tag="BAB2_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073289.1"
                     /note="with FlgF and C makes up the proximal portion of
                     the flagellar basal body rod; Bradyrhizobium have one
                     thick flagellum and several thin flagella; the proteins in
                     this cluster are associated with the thin flagella;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="WP_002966431.1"
                     /db_xref="GI:489056293"
                     /db_xref="GeneID:3828211"
                     /translation="MSSIHLFDLAARQAQWLSVRQATVAGNVANADTPDFRARDVQPF
                     ADVLDKTQLTMTATSPLHLEAEADGIAATRLRPDDVTEQTHSGNTVDVEQEMMKAGEI
                     AREYSLNTSIVKAFHRMMLSVAKG"
     gene            142270..142692
                     /gene="flgC"
                     /locus_tag="BAB_RS27065"
                     /old_locus_tag="BAB2_0149"
                     /db_xref="GeneID:3827202"
     CDS             142270..142692
                     /gene="flgC"
                     /locus_tag="BAB_RS27065"
                     /old_locus_tag="BAB2_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006469416.1"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod; Bradyrhizobium have one
                     thick flagellum and several thin flagella; the protein in
                     this cluster is associated with the thin flagella; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="WP_002966430.1"
                     /db_xref="GI:489056292"
                     /db_xref="GeneID:3827202"
                     /translation="MSSDALQSTLKIAASGLSAQSTRLRIVSENIANAQSTARTADTD
                     PYRRKTVSFRTELEQGTGAAEVRVAEVGKDTSPFIEQYDPSHPAADARGYVKYPNVNM
                     VVEMADMREANRSYEANLQVVRQARELISMTIDLLRST"
     gene            142692..143027
                     /gene="fliE"
                     /locus_tag="BAB_RS27070"
                     /old_locus_tag="BAB2_0150"
                     /db_xref="GeneID:3828219"
     CDS             142692..143027
                     /gene="fliE"
                     /locus_tag="BAB_RS27070"
                     /old_locus_tag="BAB2_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363836.1"
                     /note="forms a junction between the M-ring and FlgB during
                     flagella biosynthesis; Bradyrhizobium has one thick
                     flagellum and several thin flagella; the protein in this
                     cluster is associated with the thin flagella; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body complex protein FliE"
                     /protein_id="WP_002966429.1"
                     /db_xref="GI:489056291"
                     /db_xref="GeneID:3828219"
                     /translation="MYDSIMSVSARNALSRLSETVAEKGVGSASAPQAVPAAPGASFG
                     EVLSQMTGSVSQKLQAAEATSIQGIKGDAPVRDVVSSVMEAEQSLQTAIAIRDKIVQA
                     YLEISRMPI"
     gene            143113..143901
                     /locus_tag="BAB_RS27075"
                     /old_locus_tag="BAB2_0151"
                     /db_xref="GeneID:3828213"
     CDS             143113..143901
                     /locus_tag="BAB_RS27075"
                     /old_locus_tag="BAB2_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgG"
                     /protein_id="WP_002966428.1"
                     /db_xref="GI:489056290"
                     /db_xref="GeneID:3828213"
                     /translation="MKALTIAATGMNAQQLNLEVIANNIANINTTGFKRARAEFTDLL
                     YQSERTAGVPNQANQAIVPEGALVGLGVQTAAVRNLHIQGSFNQTGNPYDVALTGRGW
                     FQIQSPTGETLYTRAGAFNKNADGQLVTLDGNPVEPAITIPPDAIEVTITDTGQVFAK
                     LQDQINQVDLGQLTLANFTNEAGLEPLGGNLYRETEASGGPLVGVPGDPGYGSIKQGY
                     LEASNVDPVKEITDLITAQRAYEMNSKVIQAADEMAATVSKNLR"
     gene            143913..144395
                     /gene="flgA"
                     /locus_tag="BAB_RS27080"
                     /old_locus_tag="BAB2_0152"
                     /db_xref="GeneID:3827802"
     CDS             143913..144395
                     /gene="flgA"
                     /locus_tag="BAB_RS27080"
                     /old_locus_tag="BAB2_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006256599.1"
                     /note="required for the assembly of the flagellar basal
                     body P-ring; Bradyrhizobium japonicum has two types of
                     flagella, a single thick flagella and a few thin flagella;
                     the protein in this cluster is associated with the thin
                     flagella; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring biosynthesis protein
                     FlgA"
                     /protein_id="WP_002966427.1"
                     /db_xref="GI:489056289"
                     /db_xref="GeneID:3827802"
                     /translation="MDRVKAIFQTARLALAGGFLLAAMAGAGAADRIAFVVPSATVYP
                     GQIVSDTALLEKQFFINAPAATQYVLSLDQAVGKVARKTLLPGKPILVSALGEPSLVT
                     RGIPAPLVFTAGTLTITAMGTPLESGVAGDFIKVRNVDSGIIVSGTVLANGRIQVGMQ
                     "
     gene            144431..145396
                     /locus_tag="BAB_RS27085"
                     /db_xref="GeneID:23672493"
     CDS             144431..145396
                     /locus_tag="BAB_RS27085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring protein"
                     /protein_id="WP_002967183.1"
                     /db_xref="GI:489057060"
                     /db_xref="GeneID:23672493"
                     /translation="MALFCVPVLMYVQYTALRYSKITIFASACRFWIQALRKTCATLI
                     TASALIFQPAAGFADESARNVREFGSAVDADADWLGADGDPSKMTYAELGRGSAVARL
                     KDIATIQGVRENQLVGYGLVIGLKGTGDSLRNSPFTEQSMRAMLDNLGISAPRNSTRS
                     KNTAAVIVTANLPAFAGAGSRIDVTVSSLGDATSLQGGTLVMTQLMGADNQIYAVAQG
                     NMIVSGFSAEGEAASVTQGVPTSGRIPNGALVEREVAGSFGKDREMIVELRDPDFTTA
                     VRAADTINVFAKRRYGRGVAIARDAKTIRLSRPKNVPAARFLAEL"
     gene            145421..145765
                     /locus_tag="BAB_RS27090"
                     /db_xref="GeneID:23672494"
     CDS             145421..145765
                     /locus_tag="BAB_RS27090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972173.1"
                     /db_xref="GI:489062146"
                     /db_xref="GeneID:23672494"
                     /translation="MARVVVDERTGTVVIGEKVRISKVAISHGSLTVRVTETPMVVQP
                     EPFSDGETAVEPNTDIAVNQQNAKIGILSGANLENLVKGLNQIGVKPTGIIAILQAIK
                     TSGALHAELVVQ"
     gene            145762..146322
                     /locus_tag="BAB_RS27095"
                     /old_locus_tag="BAB2_0155"
                     /db_xref="GeneID:3827803"
     CDS             145762..146322
                     /locus_tag="BAB_RS27095"
                     /old_locus_tag="BAB2_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966425.1"
                     /db_xref="GI:489056287"
                     /db_xref="GeneID:3827803"
                     /translation="MIMAHKMIRYGSAVALFLAASVPAFADPPALGNLDEIRKFCGNI
                     DDQAADARYALQAKQLTELKADVEERMRALEEKRREYELWLKRRDEFVSKAQDALVDI
                     ISKMKPDAAAAQMALIGDEAAAALILKLNPRVSSIILNEMPPEKAAKLARVIVGSQRT
                     SSAAQPVKDQSGRDQRAAAQTGNTVQ"
     gene            146319..147047
                     /locus_tag="BAB_RS27100"
                     /old_locus_tag="BAB2_0156"
                     /db_xref="GeneID:3828214"
     CDS             146319..147047
                     /locus_tag="BAB_RS27100"
                     /old_locus_tag="BAB2_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar L-ring protein FlgH"
                     /protein_id="WP_002967184.1"
                     /db_xref="GI:489057061"
                     /db_xref="GeneID:3828214"
                     /translation="MKNSMNKAILAVAMVLLLAGCATKPEEIGRAPDLSPVAAHLGMQ
                     NNPQFNGYPARPGKASYSLWDQRSTNFFKDPRAATPGDVLTVIISINDRANLDNKTDR
                     ERVSKGIYGGGGSFATSSITGAAAGGDMDASVNTHSDSKSKGKGTIERSEDIRLQIAA
                     IVTDTLPNGNLIIRGSQEVRVNNELRVLNVAGVVRPRDISGNNTISYDKIAEARISYG
                     GRGRLSEIQQPPYGQQILDQFSPF"
     gene            147060..147551
                     /locus_tag="BAB_RS27105"
                     /old_locus_tag="BAB2_0157"
                     /db_xref="GeneID:3827804"
     CDS             147060..147551
                     /locus_tag="BAB_RS27105"
                     /old_locus_tag="BAB2_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body protein FliL"
                     /protein_id="WP_002966423.1"
                     /db_xref="GI:489056285"
                     /db_xref="GeneID:3827804"
                     /translation="MSDAAREKDGKAKGSMMGLLAAVAVLTAIAGGGGWYLGNMISAG
                     QQASAKPSGKEDKPKPGSFESRSIGAVVPLQPIITNLGIPQTTWVRLEASLVAKPGHE
                     IPPAMAANVSDDFMRFLRSVNLMQLQGAAGLAYLRTDLEERARLRSEGAVDRVFISAL
                     VVE"
     gene            147548..148288
                     /locus_tag="BAB_RS27110"
                     /old_locus_tag="BAB2_0158"
                     /db_xref="GeneID:3828222"
     CDS             147548..148288
                     /locus_tag="BAB_RS27110"
                     /old_locus_tag="BAB2_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="WP_002966422.1"
                     /db_xref="GI:489056284"
                     /db_xref="GeneID:3828222"
                     /translation="MKHSLGLGVILTLALTVSAQAQQALPLDKLLPAGSGAASGQIVQ
                     LFGLLTVLSIAPGLLIMVTSFTRFAIAFSLLRSGLGLQTAPASMVMISLALFMTFYVM
                     APAFDRAWNNGVQPLMRNEITQEAAFGEISQPFREFMMAQVRDKDLCLFEDLADPSFR
                     TSDDGIVDFRVLVPAFMISELRRGFEIGFLIVLPFLVIDLVVATLTMSMGMMMLPPTV
                     ISLPFKILFFVLIDGWNILVGSLIRSFS"
     gene            148491..148877
                     /locus_tag="BAB_RS27115"
                     /db_xref="GeneID:23672495"
     CDS             148491..148877
                     /locus_tag="BAB_RS27115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006076644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972170.1"
                     /db_xref="GI:489062143"
                     /db_xref="GeneID:23672495"
                     /translation="MDFPAWTWWAVAIGLFLLIEALMAIWYIRRLSRQRVETTAALKE
                     VQHTGEPGSALVLEATDTGKRLGAYSFLGVRLRLRVTRANGEEFETAIDAHISPVRIA
                     DFAEGKHIKVSIDPHARTVVLNQPIQ"
     gene            148890..149306
                     /locus_tag="BAB_RS27120"
                     /old_locus_tag="BAB2_0160"
                     /db_xref="GeneID:3827806"
     CDS             148890..149306
                     /locus_tag="BAB_RS27120"
                     /old_locus_tag="BAB2_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966420.1"
                     /db_xref="GI:489056282"
                     /db_xref="GeneID:3827806"
                     /translation="MLAACGKPMNIMALISILHLSSGGVALAADTGRIIIRNDLAACV
                     DMRVEKPPFEYPNGSNIVAINANFKLRKPIGACGCMSALARYASSVNERESRLFLQQG
                     LFNLKKSDTKTLPLATEPALVKDGNIEITVGCARPR"
     gene            complement(149502..150386)
                     /locus_tag="BAB_RS27125"
                     /old_locus_tag="BAB2_0161"
                     /db_xref="GeneID:3827807"
     CDS             complement(149502..150386)
                     /locus_tag="BAB_RS27125"
                     /old_locus_tag="BAB2_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006268353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002966419.1"
                     /db_xref="GI:489056281"
                     /db_xref="GeneID:3827807"
                     /translation="MRFDVTDLRLFVSIAETGSITHGAAMVNMALGAASARVRGMEEL
                     AGVALLNRERLGVSITPAGRALLQHGRIVLQQLGRMHSELDEFAHGLKGHVRLFSNTN
                     ALAEFLPVALSSFLMDNPGVNIDLQEHLSDEIVRSVVEGIADIGIVAGTVDVASLETF
                     PFREDYLVVVVPQGHPFARRRRIAFKDTLDYDFIGLSQGAALQNFLSAHAMRMGQRLR
                     LRVQLRSFDSICQMVESRAGIAIVPASAAKRLRRIMAIRIIALDDAWALRRLTICVRS
                     LQDLPAHAARLVEHLRQT"
     gene            150566..151783
                     /locus_tag="BAB_RS27130"
                     /old_locus_tag="BAB2_0162"
                     /db_xref="GeneID:3827808"
     CDS             150566..151783
                     /locus_tag="BAB_RS27130"
                     /old_locus_tag="BAB2_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_002966418.1"
                     /db_xref="GI:489056280"
                     /db_xref="GeneID:3827808"
                     /translation="MTAPFSVQPPESALRPLDGITVVSLEHAIAAPFATRQLADLGAR
                     VIKVERPGVGDFARAYDDRVNGMASHFVWCNRSKESLAIDLKHPDARGILHDLVSKAD
                     VLVQNLAPGAAARLGLSAEALRADCPHLIVCDISGYGSDGPYRDRKAYDLLIQSEAGF
                     LSVTGTPDEQAKAGISIADIAAGMYAYSGILSALLMRERTGQGSHIEVSMLEALGEWM
                     GFPLYYTYGGKEPPPRTGASHATIFPYGPFPTGDGKTVMLGLQNEREWAIFCEKVLHQ
                     PALAQDERFVSNVLRVRNRDALTEIIVASFAASNAEAITMQLDEAGIANARVRTMAEV
                     WDHPQLQARGRWTEITTPAGQVPALLPPAFPNGMEPRMDPVPALGAHNISILTELGLD
                     EAQIAALREAGAI"
     gene            151851..152687
                     /locus_tag="BAB_RS27135"
                     /old_locus_tag="BAB2_0163"
                     /db_xref="GeneID:3827809"
     CDS             151851..152687
                     /locus_tag="BAB_RS27135"
                     /old_locus_tag="BAB2_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011005802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966417.1"
                     /db_xref="GI:489056278"
                     /db_xref="GeneID:3827809"
                     /translation="MELNIEQLRSWIGREETRHELVTPSLVERFNATFDHEGDTANDA
                     VAPLLIHLCLTQPAALTSRLGPDGHPARGGFLPPVPLPRRMWAGGAFTFRDDIRVGDI
                     VTRTSRIQDVVVKEGRTGTLCFVTVGHEFHSNGRHAVTERQDIVYRGADMSNPAAKTQ
                     PAVPHGPHCRFITPSAPLLFRYSALTFNGHRIHYDAPYVRNVENYPGLIVHGPMQATM
                     LVRFATEIRGKPPVRFDFRSLSPLFDDADFTLNAIDDGEGLKLWTSYANGPVAMEARA
                     LW"
     gene            152681..153505
                     /locus_tag="BAB_RS27140"
                     /old_locus_tag="BAB2_0164"
                     /db_xref="GeneID:3827810"
     CDS             152681..153505
                     /locus_tag="BAB_RS27140"
                     /old_locus_tag="BAB2_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_002966416.1"
                     /db_xref="GI:489056277"
                     /db_xref="GeneID:3827810"
                     /translation="MVSIASIRAPLFVPADRPDRFSKAAASGTDCVILDLEDAVAPKA
                     KDAARAALDTSFTDLPVMVRINPHGTPWHEADMAAVARLDVAGVILPKAETAERIEAA
                     ARMLDLPLIALVETARGLANARSIAAASGVVRLAFGSIDFCADLACAHMREILLPARV
                     ELVMASRLAGIAAPIDGVTPGFNDPVMCHQDAAHARALGMMGKLCIHPRQISEVLRAF
                     AWSDQEIDWARRVLASGEGAISIDGMMVDEPVRIRARTILEQADIGAAPVLTKPTG"
     gene            153538..153690
                     /locus_tag="BAB_RS27145"
                     /db_xref="GeneID:23672496"
     CDS             153538..153690
                     /locus_tag="BAB_RS27145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966415.1"
                     /db_xref="GI:489056276"
                     /db_xref="GeneID:23672496"
                     /translation="MHGRIGYGADELAPALAIKPEFDAWSRQREQDFLKADFQKIPTQ
                     IETRSR"
     gene            153955..154533
                     /locus_tag="BAB_RS27150"
                     /old_locus_tag="BAB2_0165"
                     /db_xref="GeneID:3827811"
     CDS             153955..154533
                     /locus_tag="BAB_RS27150"
                     /old_locus_tag="BAB2_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_002966413.1"
                     /db_xref="GI:489056274"
                     /db_xref="GeneID:3827811"
                     /translation="MTQSKAIFDSPIGYGVVSRVLHWAMALMFAWQFTSAILHYFAKG
                     SAIFKFFWAAHFQLGFALLLLVLLRGVWGLINCNRRPRAESSGGRIVALGHGLIYILM
                     IAVPTVAMLRSYNSGRGFSFLGMEIFAKTAVQNPAGGAPAAAVNAGLSLHGLLGWILL
                     AVVIAHILLALAHHFIMQDNTLRYMTGRRAVS"
     gene            155931..161798
                     /locus_tag="BAB_RS27155"
                     /db_xref="GeneID:23672497"
     CDS             155931..161798
                     /locus_tag="BAB_RS27155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006221894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter-associated beta strand"
                     /protein_id="WP_005976747.1"
                     /db_xref="GI:492821568"
                     /db_xref="GeneID:23672497"
                     /translation="MYVVGNSAIVTIINNGTITGGAGGLNSAWPDNYGATGGMGEGGA
                     AGSIRTGGSQGTSSQGGAGIIGANIAVINNGTITGGIGGTGGLNAGVQNDAVTFQSGI
                     NSLTLTTKSVINGVVSANGNDDTLTLQNTLSKIDGGQSDGANISATQYKGFEHLVVNG
                     GRWTVSGSAIVSGETTLNGGALVVTGPAALGVQAITAQGGAIEASGDQVLDQSFVLKN
                     NPYGASTSGLVVQGADNLVLSGVLSDVGRLTKNGSGTLTLTADNTYTGGTVFAGGVVS
                     VDKEVRLGGGDLTFNGGTLQVTGTGWTSTSRAVSLQAGGGTFDIENAANNFAVTQGVA
                     GAGGLTKSGSGTLTLSGANSYTGATTVSAGTLVVANDNTGGGTTTVDVGAGLQIGTGG
                     VSGSLAGDIVNNGTLVVDRSNAFDLANVISGTGSLTKNGAGTLTLSGVNSYTGGTTVS
                     AGTLAVRADNNLGDASGGLAINGGATLQLTDNLTTARGVTLGAGTATITIDGGKTAQF
                     SNKLTGSGTLAVSGSGTLILSAANDYSGNTTIASGSTLQLGDGSTDGRLAGNVANAGT
                     LTFHNKGGTTFAGEISGTGSLVQNGAGALTLSGDSQGFAGTTTVSSGSLLVSGKLGGT
                     VTVNSGATLDGSGEIGGNTTVNGTLEGASGNGLTFKGDLKLGSGSIINASFDHPGGAR
                     IFDVTGDIALDGTVNVSSFGTGGPGLYHLFHYAGTSSGSGLTLGSLPGGVSVDKVYIN
                     QQVNDIYVVNTTGATLNYWNGTQSRPQGDGLLHGGNGTWTAATGNFNWTNSPSYDLNG
                     AWDNGAFAVFGGGKGLVTVDTSAGAISASGMQFITTGYKLSGDKLTLVPTTSNPSAKP
                     LIRVGSGSPGDSALIAIISTELTGTHGLEKADGGTLILTGANTYTGGTAISGGTLQLG
                     DGATNGSVQGAISTGADAAHKGVLAIRAAAGTPATIGNTISGTGSVSVLGGTVTFSVA
                     NSYTGGTTLAGGTTIVTADANLGAVGTNVALNNGATLRFGANLDATHSFTHAFQLGTV
                     ASDVGTLDTDGHDVAMSGVISGAGGLMKSGTGTVTLSGANSYTGGTKVSAGTLVVAND
                     NTGGGTTTVDAGAGLQIGTGGTSGSLAGDIANNGALVVNRSDALNLAGAISGTGSLTK
                     NGAGTVTLSGANSYTGGTKVSAGTLVVANDNTGGGTMTVDVGALLQIGTGGTSGSLAG
                     DIANDGTLVVDRSDAIGLSGAISGAGGLTKNGAGTLTLSGANSYTGATTVSAGILTLT
                     GDNTGGGTTTVDARAELHIGTGGASGSLAGNIVNDGALVVDRSGVIGLSGVISGTGGL
                     MKSGTGTVTLSGVNTYTGGTTLTAGTLAAASDNNLGGASGGLTFNGGTLQVMGTSWTS
                     TNRAVSLQAGGGTFDIEDAANNFAVTQGVAGAGGLTKSGSGTLTLSGANSYTGATTVS
                     ASTLVVANDNTGGGTTTVDVGAGLQIGTGGVSGSLAGDIVNNGTLVVDRSNAFDLANV
                     ISGTGSLTKNGAGTLTLSGVNSYTGGTTVSAGILTLTGDNTGGGTTTVDAGAVLQIGT
                     GGTSGNLAGDIANNGALVVNRSDALNLANAISGAGSLMKSGAGTLTLSGANSYTGATT
                     VSAGTLTQGAAGGFSTASSRYDVDTDGTLDLGGFDTMLAALYNAGTINMNVGAAGSTL
                     MVNGDYVGHDGTIVFNTVLGDDNSKTDKLMVGGDTAGNTNVQVVNRDGLGAQTVKGIE
                     IITVGGQSNGVFSLVSDYRTKDGQKAVVGGAYAYTLHQGPARGANDGDWYLISQLEDI
                     KPDNPATRRVSDTPDAPDTPAPRYSANVPVYEGYVQTMQALNKPSTLQERVGKRYMTG
                     ENGDGRTSGGMVDAHGIWARIQGAHDRLEPTTLTGMKQEINTFILQAGVDGQFYEDEN
                     GKLIAGITGQYDTVLHAAILWRGMVMAVSPPMPGASALQPPGLVMTGSMSTPRVR"
     gene            161837..162337
                     /locus_tag="BAB_RS27160"
                     /db_xref="GeneID:23672498"
     CDS             161837..162337
                     /locus_tag="BAB_RS27160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014299687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin"
                     /protein_id="WP_014299687.1"
                     /db_xref="GI:504065693"
                     /db_xref="GeneID:23672498"
                     /translation="MGLASGRKATGYALSVETGKRIALNGNWVLTPQAQLIWSSINAD
                     DFEDVWQANISVARGNSFAARFGLAASYDSSWQGSDGRVVNTSVYGITNLYQEFLGGT
                     RVNISGVDFSTDNDRTWAGIGAGGTYAWAGGKYLIFGQGTINTSLDHFADSYAIKGDV
                     GFKVKW"
     gene            162573..162968
                     /locus_tag="BAB_RS27165"
                     /old_locus_tag="BAB2_0169"
                     /db_xref="GeneID:3828140"
     CDS             162573..162968
                     /locus_tag="BAB_RS27165"
                     /old_locus_tag="BAB2_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_002966407.1"
                     /db_xref="GI:489056268"
                     /db_xref="GeneID:3828140"
                     /translation="MRAAMTAISAIAASLLISTVAQGADIESGKKIFNACKACHQIGE
                     GAKNMVGPELNGLFGRHSGSVEGYKYSDANKNSGIVWDEEIFRKYIKKPREVIPKTKM
                     VYAGLKDEGKIDDLIAFLKQYDLGGKIKE"
     gene            complement(163192..163431)
                     /locus_tag="BAB_RS27170"
                     /old_locus_tag="BAB2_0170"
                     /db_xref="GeneID:3827815"
     CDS             complement(163192..163431)
                     /locus_tag="BAB_RS27170"
                     /old_locus_tag="BAB2_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966406.1"
                     /db_xref="GI:489056267"
                     /db_xref="GeneID:3827815"
                     /translation="MSNTPHTLGEEFPGQLEAIHALKAKDAHFARILEESDSVNDLIH
                     RAETNIQPVSQEEETNLRKQRLALKDKIASALAAA"
     gene            163861..163998
                     /locus_tag="BAB_RS27175"
                     /old_locus_tag="BAB2_0171"
                     /db_xref="GeneID:3827816"
     CDS             163861..163998
                     /locus_tag="BAB_RS27175"
                     /old_locus_tag="BAB2_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966405.1"
                     /db_xref="GI:489056266"
                     /db_xref="GeneID:3827816"
                     /translation="MTAKNATLLTVLMVSAIVFMAVGIFTVDAGNQTAPTDGYGISSA
                     H"
     gene            complement(164076..164888)
                     /locus_tag="BAB_RS27180"
                     /old_locus_tag="BAB2_0172"
                     /db_xref="GeneID:3827817"
     CDS             complement(164076..164888)
                     /locus_tag="BAB_RS27180"
                     /old_locus_tag="BAB2_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002966404.1"
                     /db_xref="GI:489056265"
                     /db_xref="GeneID:3827817"
                     /translation="MADTVFSRIQASRTADDVVHQIESLILEGVLRGGDRLPGERELA
                     RQFDISRPILRDALKRLETAGLLTSRHGGGTFVADVIGQVFSAPVVKLFADHHKATAD
                     YLEYRREIESVAAEYAALRATPADRALLTEIMNAMEKAHGADDFATEARLDVELHNAI
                     GEAAHNIVLLHTLRSCYQLLKDGVFYNRSVIYNHPGVADVFLSQHRAIYDAVMAGNPQ
                     AAREAVQKHIRFVEQATHDRALNDERERVARLRYRQRAGSKELKEIREDESE"
     gene            complement(165010..165930)
                     /locus_tag="BAB_RS27185"
                     /old_locus_tag="BAB2_0173"
                     /db_xref="GeneID:3827818"
     CDS             complement(165010..165930)
                     /locus_tag="BAB_RS27185"
                     /old_locus_tag="BAB2_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011949921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002967187.1"
                     /db_xref="GI:489057064"
                     /db_xref="GeneID:3827818"
                     /translation="MMSSLADMEIFARVVATGSMSAAARDLGLSPAVVSKRLGRLEER
                     LGTSLLQCTTRQIALTEAGQGYHERVLAILANIEEAEAFVARRSADARGTLKISAPTT
                     FGRMHIAPYLVPFMRANADLTVNMQLSDEMVDIVGDGYDLAIRIGELSDSTLVARRLA
                     PVRRIFVAAPRYLKERGTPQTIEDLQDHICLAPHNNDPWRLEGPKGPIVIRPTGPLQT
                     NSSEIVREAVLAGLGIAQRSTWDVGPELAAGKLVQVLPDYAASRNVAIHAVYPSKQFL
                     PAKVRLFIDYLADLYGPVPYWESGTFPEEN"
     gene            166281..167777
                     /locus_tag="BAB_RS27190"
                     /old_locus_tag="BAB2_0174"
                     /db_xref="GeneID:3827819"
     CDS             166281..167777
                     /locus_tag="BAB_RS27190"
                     /old_locus_tag="BAB2_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding protein"
                     /protein_id="WP_002966402.1"
                     /db_xref="GI:489056263"
                     /db_xref="GeneID:3827819"
                     /translation="MSGLIMPEPDAGVLQRREQIVADLRVIVPGEGVVDTVNAMRVFE
                     TDGLTAHRQLPLVVVLPETVEQVAQVLRYCHDNAIRVVPRGAGTSLSGGSMPLEDAVL
                     LVMSRFNRILEIDYPNRVAVVQPGVTNLGITKAVEHEGFYYAPDPSSQIACSIGGNVA
                     ENAGGVHCLKYGLTANNVLGIEMVLITGEVMRLGGKHLDSEAYDLLGLMTGSEGLLGV
                     VTEITVRILQKPETARAIMVGFPSSEQAGQCVADIIGAGIIPGGMEMMDRPAIKAAED
                     FVRVGYPLDVEALLIVELDGPPVEVDYLLGRVEKIALQNGSTTCTLSQSEEQRLAFWA
                     GRKAAFPAVGRISPDYLCMDGTIPRKELPRVLSGMRALSEKYGLRVANVFHAGDGNLH
                     PLILYDANNPGELEAAEDFGADILRLCVKVGGVLTGEHGVGIEKRDLMPEMFNETDLD
                     QQMRVKCAFDAKHLLNPGKVFPQLRRCAELGRMHVSRGALAFPDLPRF"
     gene            167793..169025
                     /locus_tag="BAB_RS27195"
                     /old_locus_tag="BAB2_0175"
                     /db_xref="GeneID:3828235"
     CDS             167793..169025
                     /locus_tag="BAB_RS27195"
                     /old_locus_tag="BAB2_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-acid oxidase"
                     /protein_id="WP_002966401.1"
                     /db_xref="GI:489056262"
                     /db_xref="GeneID:3828235"
                     /translation="MSDANILKPQDEAGVLEMVQAALASSTPLEIIGHGSKRGIGRPV
                     EAGHVLDVSGLSGVTLYEPDELVLSARAGTPMAEIQKLLADHNQCFHFEPMDYGPLLG
                     AEPGRGTIGGTLAANLAGPRRLKAGAARDHVLGVRVVSGRGEVFKSGGRVVKNVTGYD
                     LSKGMANSWGTLGVATEVTFKVLPAPETVATLAVRGLDDEQAARVMALAMGSREEVSS
                     AAHLPPTVAWRFLDGKLGGDAATILRLEGFAPSVAHRSRQLQDLLGRTGTIDVLDDSQ
                     SRQLWREVRDVLPYAQAGDGRAVWRVSMAPMQGWRMVDEFRRHAGVDAYYDWQGGLIW
                     MRMEAEPEADVLRKLIARHGGGHATLIRAPERVRGSVDVFQQQPAALAALSARLKQQF
                     DPENILNPGRMYPHQAGA"
     gene            169030..170331
                     /locus_tag="BAB_RS27200"
                     /old_locus_tag="BAB2_0176"
                     /db_xref="GeneID:3828236"
     CDS             169030..170331
                     /locus_tag="BAB_RS27200"
                     /old_locus_tag="BAB2_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-acid oxidase"
                     /protein_id="WP_002966400.1"
                     /db_xref="GI:489056261"
                     /db_xref="GeneID:3828236"
                     /translation="MQTHFSPEQLRDPGVLEAEKILRKCVHCGFCTATCPTYVTLGNE
                     LDSPRGRIYLIKDMLENGRPADEEIVRHVDRCLSCLACMTTCPSGVNYMHLVDHARAH
                     IEKTYKRPFMNRLLRSVLAQVLPYPARFRLALKLAKLGKPFASLFRKSPVLRPVAAML
                     DLAPQSLPAMPAATNAVRGEKRGRVAILNGCAQPVLNPGINAATLRLLNRFDIEVATP
                     KGEGCCGSLVHHMGREEQALEQARHNVDVWTREIETGGLDAIIVTASGCGTTIKDYGY
                     MLRLDPAYKDKAARVSALAKDITEYLATLELPEPDAPKTLTVAYHSACSMQHGQKIVR
                     EPKDLLVKAGFTVKEPLEGHLCCGSAGTYNIMQPEIATKLRDRKVKNIEATGAALIAT
                     GNIGCMTQMATGSDLPIVHTVELIDWAYGGPTPQALEKAGA"
     gene            complement(170554..171381)
                     /locus_tag="BAB_RS27205"
                     /old_locus_tag="BAB2_0177"
                     /db_xref="GeneID:3827820"
     CDS             complement(170554..171381)
                     /locus_tag="BAB_RS27205"
                     /old_locus_tag="BAB2_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002968994.1"
                     /db_xref="GI:489058914"
                     /db_xref="GeneID:3827820"
                     /translation="MTVPTVKLNDGNHIPQLGYGVWQISNDEAVSAVSEALKAGYRHI
                     DTATIYGNEEGVGKAINGSGIARADIFLTTKLWNSDQGYESTLKAFDTSLKKLGTDYV
                     DLYLIHWPMPSKDLFMETWRAFIKLKEEGRVKSIGVSNFRTADLERLIKESGVTPVLN
                     QIELHPQFQQDELRLFHGKHDIATEAWSPLGQGKLLEDPTLKSIAEKHAKSVAQIILR
                     WHIETGNIVIPKSITPARIKENFDIFDFTLNGTDHDAITKLDMADGRIGPNPSVFSA"
     gene            171406..171615
                     /locus_tag="BAB_RS27210"
                     /db_xref="GeneID:23672499"
     CDS             171406..171615
                     /locus_tag="BAB_RS27210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014315908.1"
                     /db_xref="GI:504081914"
                     /db_xref="GeneID:23672499"
                     /translation="MRRFPGRWPPHYPSRQLFDEYSSDFANGSIWVFARKGKALSHIF
                     AARRFFPCRKFGYFKLVKNNWVAFP"
     gene            complement(171707..172390)
                     /locus_tag="BAB_RS27215"
                     /db_xref="GeneID:23672500"
     CDS             complement(171707..172390)
                     /locus_tag="BAB_RS27215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972156.1"
                     /db_xref="GI:489062129"
                     /db_xref="GeneID:23672500"
                     /translation="MKPRHLLLIGSLTAIAVSIVSTGMAFADDRYSDLPPVRVSQAIS
                     APWVAQLQDAPARPRIARQETRKTKTHYNKVSYQRPATNPATTARKKQFDPIYLPQIV
                     SYSGKEKPGTIVIDTASRFLYLVQADGKARRYGVGVGKQGFSWKGTQRISRKAEWPTW
                     TPPSEMIARERKKGRFLPARMDGGINNPLGARALYLGSTLYRIHGTNQPWTIGRPCPR
                     AAFVCVTRM"
     gene            172630..173286
                     /locus_tag="BAB_RS27220"
                     /old_locus_tag="BAB2_0179"
                     /db_xref="GeneID:3827782"
     CDS             172630..173286
                     /locus_tag="BAB_RS27220"
                     /old_locus_tag="BAB2_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_002967189.1"
                     /db_xref="GI:489057066"
                     /db_xref="GeneID:3827782"
                     /translation="MSDMAEARAGLVVGADGRTRCFWPGELPDYLAYHDNEWGVPVAD
                     DFRLFEKICLEGFQSGLSWLTILRKRENFRAAFDGFNFHRIATYDESDVERLLADKGI
                     VRHRGKIVSVINNAGRAIELIEEKGSLAAYFWSFEPGAENRPAVVDYPTLVANPITAT
                     STRISKDLKKRGWSFVGPTTVYAFMQAMGLVNDHIEGCHCRATIEKLRQNFKRPGKKL
                     "
     gene            173405..174022
                     /locus_tag="BAB_RS27225"
                     /old_locus_tag="BAB2_0180"
                     /db_xref="GeneID:3827673"
     CDS             173405..174022
                     /locus_tag="BAB_RS27225"
                     /old_locus_tag="BAB2_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012783804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_002966396.1"
                     /db_xref="GI:489056257"
                     /db_xref="GeneID:3827673"
                     /translation="MDLMSLVAFAGILVVAAGTPGPKVGALVARVISRGHKGVFPFMF
                     GLWLGDAVWLSLAVWGLSALAHTFQTAFLVLKYAGVAYLIYLSWKMWFAPVDEEADEN
                     TIPRQGEGKRLFLSALGVTLGNPKIMVFYLAILPTVVDITHVSLTGWVELLLVMFMVL
                     AAVDTAWVVLAAQARKFLRSPRMMRLANRTSAGMMAGAAVAIAAR"
     gene            174133..175641
                     /locus_tag="BAB_RS27230"
                     /old_locus_tag="BAB2_0181"
                     /db_xref="GeneID:3827165"
     CDS             174133..175641
                     /locus_tag="BAB_RS27230"
                     /old_locus_tag="BAB2_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5VTT4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_002968826.1"
                     /db_xref="GI:489058743"
                     /db_xref="GeneID:3827165"
                     /translation="MADKADKMKARLPRGFVDRVPDDLRAAEKMMATIREVYDLYGFE
                     PVETPLVEYTDALGKFLPDQDRPNEGVFSFQDDDEQWLSLRYDLTAPLARYVAENFET
                     LPKPYRSYRNGWVFRNEKPGPGRFRQFMQFDADTVGAPNVSADAEMCMMMADTLERLG
                     IQRGDYAIRVNNRKVLDGVLDAIGLEGEGNAAKRLNVLRAIDKLDKFGPEGVRLLLGK
                     GRLDESGDFTKGAQLPEAAIEKVLAFTAAGGADGAQTIANLQAVVAGNAKGEEGVQEL
                     ADMQALFFAGGYEGRVKIDPSVVRGLEYYTGPVFEAELLFDVTNEDGQKVVFGSVGGG
                     GRYDGLVSRFRGEPVPATGFSIGVSRLMTALKNLGKLDVSDTVGPVVVLVMDKDTQNL
                     GRYQKMVSDLRKAGIRAEMYVGGSGMKAQMKYADRRAAPCVVIQGSQEREAGEVQIKD
                     LVEGKRLSAEIEDNVTWLESRPAQITVREDGLVDAVREILDAQARDRAEQSK"
     gene            175650..176780
                     /gene="hisZ"
                     /locus_tag="BAB_RS27235"
                     /old_locus_tag="BAB2_0182"
                     /db_xref="GeneID:3827674"
     CDS             175650..176780
                     /gene="hisZ"
                     /locus_tag="BAB_RS27235"
                     /old_locus_tag="BAB2_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363020.1"
                     /note="May allow the feedback regulation of ATP
                     phosphoribosyltransferase activity by histidine; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase regulatory
                     subunit"
                     /protein_id="WP_002972153.1"
                     /db_xref="GI:489062126"
                     /db_xref="GeneID:3827674"
                     /translation="MVGSRTSPIFNALRVELNAREAELVEIPLIQPADPFLDMAGEDL
                     RRRIFLTENENGDSLCLRPEFTIPVCRNHIALNAATPKRYAYLGEVFRQRRDGAAEFL
                     QAGIEDLGAADEAASDARSLADALSCVKAIAPDAPLEIVLGDQSVFAGMLKALGLPQG
                     WRKKLLRSFGDAHSMDLALAELTGTQRRDPLPESLAVLVAEGDEIGLARMLEAEMLEA
                     GISPGAGRTPVEIARRLIEKEDLAATHFPAAALDLLRQFLAIRVSLDMAAVTLRAFAA
                     DNALDLGAVLQKFEARADAIAQAGIEMKDIIYDASFGRPLDYYTGLVYEIRDASNRQD
                     GVLAGGGRYDRLLTMLGACEAIPGVGFSIWLDRLQALAGEKQ"
     gene            176777..177472
                     /gene="hisG"
                     /locus_tag="BAB_RS27240"
                     /old_locus_tag="BAB2_0183"
                     /db_xref="GeneID:3827675"
     CDS             176777..177472
                     /gene="hisG"
                     /locus_tag="BAB_RS27240"
                     /old_locus_tag="BAB2_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509512.1"
                     /note="short form of enzyme; requires HisZ for function;
                     catalyzes the formation of N'-5'-phosphoribosyl-ATP from
                     phosphoribosyl pyrophosphate; crucial role in histidine
                     biosynthesis; forms heteromultimer of HisG and HisZ;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_002966393.1"
                     /db_xref="GI:489056254"
                     /db_xref="GeneID:3827675"
                     /translation="MSVTLALPSKGRLKEKTLAVLEKAGYKVVLPDDDRNYRARVEGE
                     DDLDILFLSASEIARELGYGSVDLGVTGEDLVRETLAHADERVAIEAQLGFGHADVVV
                     AVPEVWRDVTTMADLDDVAADFRQRHGRRLRIATKYWRLTQQFFSQKHGIQVYRIVES
                     LGATEGAPAAGSADMIVDITSTGSTLRANRLKVLEDGIILRSQACLVSARRSHTSRRV
                     EEIAARIRAGLEI"
     gene            complement(177545..178783)
                     /locus_tag="BAB_RS27245"
                     /old_locus_tag="BAB2_0184"
                     /db_xref="GeneID:3827676"
     CDS             complement(177545..178783)
                     /locus_tag="BAB_RS27245"
                     /old_locus_tag="BAB2_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/galactose transporter"
                     /protein_id="WP_002966392.1"
                     /db_xref="GI:489056253"
                     /db_xref="GeneID:3827676"
                     /translation="MATSIPTNNPLHTETSSQKNYGFALTSLTLLFFMWGFITCLNDI
                     LIPHLKNVFQLNYTQSMLIQFCFFGAYFIVSLPAGQLVKRISYKRGIVVGLIVAAIGC
                     ALFIPAASYRVYALFLGALFVLASGVTILQVAANPYVTILGKPETAASRLTLTQAFNS
                     LGTTVAPVFGAVLILSAATDATVNAEADAVRFPYLLLALAFTVLAIIFAILKPPDVQE
                     DEPALSDKKEGSAWQYRHLVLGAIGIFVYVGAEVSVGSFLVNFLSDPTVAGLSETDAA
                     HHVAYFWGGAMVGRFIGSAAMRYIDDGKALAFNAFVAIILLFITVATTGHIAMWSVLA
                     IGLFNSIMFPTIFSLALHGLGSHTSQGSGILCLAIVGGAIVPLIQGALADAIGIHLAF
                     LMPIICYAYIAFYGLIGSKS"
     gene            178770..179009
                     /locus_tag="BAB_RS27250"
                     /db_xref="GeneID:23672501"
     CDS             178770..179009
                     /locus_tag="BAB_RS27250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014517351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014517351.1"
                     /db_xref="GI:504330249"
                     /db_xref="GeneID:23672501"
                     /translation="MEVAIFLYKLNYYKMRRWAGACVKSGGCLISQDIAMQSFRTLSA
                     GFPPIVGIRRIANIFFVVPPLQLRKISMEKQVAVM"
     gene            complement(179069..179470)
                     /locus_tag="BAB_RS27255"
                     /old_locus_tag="BAB2_0185"
                     /db_xref="GeneID:3827677"
     CDS             complement(179069..179470)
                     /locus_tag="BAB_RS27255"
                     /old_locus_tag="BAB2_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002966391.1"
                     /db_xref="GI:489056252"
                     /db_xref="GeneID:3827677"
                     /translation="MSSITPKANGAATLIIRVFLSVLFIIAGYNKLTALDGTADYFAS
                     IGLPMPIVTAVVVGLIEFVGGLAILFGFKTRIAAVIVGLFTLGATLVAHMDFAEGMNL
                     LIAQKNLAIAGGLFLLFLHGAGSLSIDARRG"
     gene            complement(179573..180964)
                     /gene="fumC"
                     /locus_tag="BAB_RS27260"
                     /old_locus_tag="BAB2_0186"
                     /db_xref="GeneID:3828227"
     CDS             complement(179573..180964)
                     /gene="fumC"
                     /locus_tag="BAB_RS27260"
                     /old_locus_tag="BAB2_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936400.1"
                     /note="class II family (does not require metal);
                     tetrameric enzyme; fumarase C; reversibly converts
                     (S)-malate to fumarate and water; functions in the TCA
                     cycle; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase class II"
                     /protein_id="WP_002966390.1"
                     /db_xref="GI:489056251"
                     /db_xref="GeneID:3828227"
                     /translation="MAATRTETDTFGPIDVPADRYWGAQTQRSLQNFRIGGERMPLPL
                     VHALGVVKRAAAETNIALGKLDPVLGQVIAVAASEVIEGKLDDHFPLVVWQTGSGTQS
                     NMNANEVISNRAIELLGGEMGSKKPIHPNDHVNMSQSSNDSFPTAIHIATAVETVNRL
                     YPALEHLTKALKVKEEAFKDIIKIGRTHTQDATPVTLGQEFSGYRAALEYARHRLEQS
                     LADVFLLAQGGTAVGTGLNAPVGFDKGFAEAVSEITGLSFKTAPNKFEALASHGAVLN
                     FHGSLNALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQAEAMT
                     MVATQVFGNQTAVTVAASQGHFELNVFKPVIAYNVLQSIRLLSDTMVSFADHCVEGIE
                     PNTARIKELLERSLMLVTALAPAIGYDNAARIAKTAHKNGTTLREEALASGLVSEEDY
                     DRLVRAERMIAPQ"
     gene            complement(181114..181368)
                     /locus_tag="BAB_RS27265"
                     /old_locus_tag="BAB2_0187"
                     /db_xref="GeneID:3827678"
     CDS             complement(181114..181368)
                     /locus_tag="BAB_RS27265"
                     /old_locus_tag="BAB2_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972151.1"
                     /db_xref="GI:489062124"
                     /db_xref="GeneID:3827678"
                     /translation="MRKELPIETAPKDGRKITVIWIDDDDQRNESIAQYRTLEQLRAG
                     GGQWDEADTGWWTFTDNKTQRKIEPTAWIRETDDDESQED"
     gene            complement(182121..183761)
                     /gene="groEL"
                     /locus_tag="BAB_RS27270"
                     /old_locus_tag="BAB2_0189"
                     /db_xref="GeneID:3828243"
     CDS             complement(182121..183761)
                     /gene="groEL"
                     /locus_tag="BAB_RS27270"
                     /old_locus_tag="BAB2_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643166.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_002966387.1"
                     /db_xref="GI:489056248"
                     /db_xref="GeneID:3828243"
                     /translation="MAAKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSF
                     GAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQE
                     GAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGK
                     MIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDA
                     YILLHEKKLSNLQALLPVLEAVVQTSKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTGGQVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVD
                     GAGQKAEIDARVGQIKQQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEK
                     KDRVDDALNATRAAVEEGIVAGGGTALLRASTKITAKGVNADQEAGINIVRRAIQAPA
                     RQITTNAGEEASVIVGKILENTSETFGYNTANGEYGDLISLGIVDPVKVVRTALQNAA
                     SVAGLLITTEAMIAELPKKDAAPAGMPGGMGGMGGMDF"
     gene            complement(183852..184148)
                     /locus_tag="BAB_RS27275"
                     /old_locus_tag="BAB2_0190"
                     /db_xref="GeneID:3828244"
     CDS             complement(183852..184148)
                     /locus_tag="BAB_RS27275"
                     /old_locus_tag="BAB2_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_002966386.1"
                     /db_xref="GI:489056247"
                     /db_xref="GeneID:3828244"
                     /translation="MADIKFRPLHDRVVVRRVESEAKTAGGIIIPDTAKEKPQEGEVV
                     AAGAGARDEAGKLVPLDVKAGDRVLFGKWSGTEVKIGGEDLLIMKESDILGIVG"
     gene            184629..185477
                     /locus_tag="BAB_RS27280"
                     /old_locus_tag="BAB2_0191"
                     /db_xref="GeneID:3827680"
     CDS             184629..185477
                     /locus_tag="BAB_RS27280"
                     /old_locus_tag="BAB2_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_002972147.1"
                     /db_xref="GI:489062120"
                     /db_xref="GeneID:3827680"
                     /translation="MILPERLDDLTDRYDAIFCDVWGVVHNGETSFAPAIAALQRARA
                     KGVTIILVTNSPRPHPGVVAQMSLLGVPEDAYDRVVTSGDVTRDLIAEGPRRIFHIGC
                     ERELAIYDGLDVELVEEFEAAGVVCTGLYDDEVETPEDYRELLQRLRARNLPFICANP
                     DIMVERGPRLIWCAGALAREYGQLGGRTLIAGKPHRPIYEAALRAVESIRGGSVDKSR
                     ILGIGDGVLTDVKGAADFGLDVLYISGGVHAADYAVNGDLDMAKMEAFLEKHGHRPIA
                     SLHALV"
     gene            185565..186554
                     /locus_tag="BAB_RS27285"
                     /old_locus_tag="BAB2_0193"
                     /db_xref="GeneID:3827682"
     CDS             185565..186554
                     /locus_tag="BAB_RS27285"
                     /old_locus_tag="BAB2_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin kinase"
                     /protein_id="WP_002966383.1"
                     /db_xref="GI:489056244"
                     /db_xref="GeneID:3827682"
                     /translation="MKKSSFQRLTGTEGLPPALHDCVVAIGNFDGVHRGHQAVLERAL
                     ELAERESRPAVVLTFEPHPRSFFKQDQPVDRLTDAAEKAEILRLMGFDAVMEQPFTAE
                     FSQRSAEDFVQHILVEKLRASRVVTGYDFHFGKGRRGTPEFLCEAGKKAGFSVTLVDA
                     FTDEGGMLVSSTRIRNLLSEGEVAEAAGLLGYRYRICGEVIHGKKLGRTLGFPTANMA
                     LAPQTSLKHGIYAVRFRLDDAMLYDGVASFGRRPTVDDEGAPLLETFLFDFSGDLYGK
                     TAAVSFFGFLRGEVKFDGLDPLIDQMKQDEAQARALLADVRPISGLDRMLSFN"
     gene            186898..189816
                     /gene="ileS"
                     /locus_tag="BAB_RS27290"
                     /old_locus_tag="BAB2_0194"
                     /db_xref="GeneID:3827171"
     CDS             186898..189816
                     /gene="ileS"
                     /locus_tag="BAB_RS27290"
                     /old_locus_tag="BAB2_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006108284.1"
                     /note="IleRS; catalyzes the formation of
                     isoleucyl-tRNA(Ile) from isoleucine and tRNA(Ile); since
                     isoleucine and other amino acids such as valine are
                     similar, there are additional editing function in this
                     enzyme; one is involved in hydrolysis of activated
                     valine-AMP and the other is involved in deacylation of
                     mischarged Val-tRNA(Ile); there are two active sites, one
                     for aminoacylation and one for editing; class-I
                     aminoacyl-tRNA synthetase family; some organisms carry two
                     different copies of this enzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_002966382.1"
                     /db_xref="GI:489056243"
                     /db_xref="GeneID:3827171"
                     /translation="MTDTTKIDYSKTLYLPQTEFPMRAGLPQREPLFVQRWEEMNLYK
                     KLREQAKDRPLYVLHDGPPYANGNIHIGHALNKILKDVITRSFQMRGYNSNYVPGWDC
                     HGLPIEWKIEEKYRAAGKNKDEVPINEFRKECREFASNWIKVQTEEFKRLAILGDFEN
                     PYTTMNFHAEARIAGELLKFAASGQLYRGSKPVMWSVVERTALAEAEVEYHDIESDMI
                     WVKFPVAGEVATENDLSGSAVVIWTTTPWTIPGNRAVSYSSRIEYGLFEITEAENDFG
                     PRPGERLVFADKLVEECCAKAKLQFKRLRSVSAEELGKIVLDHPLKGFGGGYEFVVPM
                     LDGDHVTDDAGTGFVHTAPSHGREDFEAWMDNARQLEARGIDPNIPFPVGDDGFYTKD
                     APGFGPDREGGPARVIDDNGKKGDANKVVIEQLIAADKLFARGRLKHSYPHSWRSKKP
                     VIFRNTPQWFVYMDKNLGDGTTLRSRALKAIDETRFVPAAGQTRLRSMIEGRPDWVLS
                     RQRAWGVPICVFVDEEGNILQDDAVNKRIMDAFEKEGADAWFADGARERFLGARAGEG
                     WTQVRDILDVWFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCGTRG
                     RAPYNAVVTHGFTMDEHGKKMSKSLGNTVTPQDVIKESGADILRLWVMTTDYWEDQRL
                     GKSIIQTNIDAYRKLRNTIRWMLGTLAHDEGENVAYADLPELERLMLHRLTELDELVR
                     SGYDTFDFKRIARALVDFMNVELSAFYFDIRKDALYCDAPSSIRRKAALQTVREIFVR
                     LTTWLAPMLPFTMEEAWLDRYPQSVSIHAEQFRPTPAEWRDDVLAEKWRKVRAVRRVV
                     TGALELERADKRIGSSLEAAPVVYIADKSLSDSLEGLDFAEICITSGISVSDAAAPEG
                     AFTLGDVKGVAVVPERAKGEKCARSWRYTTDVGADPEFPEVSARDAAALRELQALGKL
                     "
     gene            190008..190679
                     /locus_tag="BAB_RS27295"
                     /old_locus_tag="BAB2_0195"
                     /db_xref="GeneID:3827683"
     CDS             190008..190679
                     /locus_tag="BAB_RS27295"
                     /old_locus_tag="BAB2_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971287.1"
                     /db_xref="GI:489061249"
                     /db_xref="GeneID:3827683"
                     /translation="MKIEGRVLVLMTALAGLSLSGCVSSPTYGTDKSAGAQLLDDVSN
                     MASFGQGKKKERIDYKPRPDLVRPAPGDKGYLPAPQQSLASSSDPNWPESPEQRRKRV
                     RDEITAHRDDPNYVSPVLQDAPVADNIRTALPRGNSRREDYASRTPTSDPAKVAALKA
                     ARAQQNQGSATTRRYLSEPPLAYRQPASTAAVGELGPDEAQKERERKKAASGSRGWRD
                     YLPWN"
     gene            191024..191584
                     /locus_tag="BAB_RS27300"
                     /old_locus_tag="BAB2_0196"
                     /db_xref="GeneID:3827684"
     CDS             191024..191584
                     /locus_tag="BAB_RS27300"
                     /old_locus_tag="BAB2_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_002967192.1"
                     /db_xref="GI:489057069"
                     /db_xref="GeneID:3827684"
                     /translation="MSSKTYIWDDRSGYGLVSRGFHWLMALLFLWQFASAILRVFAKD
                     TPIYSFFWSAHFQLGFALLVLALLRGVWGLMNIHRRPHKDGAIGKLAVLGHLAIYVLM
                     ITIPSLALLRAYGSGRGFSFLGMPIFAKTDIQNAMLTAPANALHGPLGWALLAAIVGH
                     VAMALVYHFALRDDTLRYMTGHGTPN"
     gene            complement(191638..192111)
                     /locus_tag="BAB_RS27305"
                     /old_locus_tag="BAB2_0197"
                     /db_xref="GeneID:3827685"
     CDS             complement(191638..192111)
                     /locus_tag="BAB_RS27305"
                     /old_locus_tag="BAB2_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_002966379.1"
                     /db_xref="GI:489056240"
                     /db_xref="GeneID:3827685"
                     /translation="MRKAASITKANSATPMDIALEEAHAAGERGEVPIGAVIVRDGEI
                     IARAGNRTREFNDVTAHAEILTIRQAGEMLGSERLIDCDLYVTLEPCAMCAAAISFAR
                     IRRLYYGASDPKGGGIEHGGRFYTQPTCHHAPEIYPGFCEADARKILKDFFREKR"
     gene            192252..193997
                     /locus_tag="BAB_RS27310"
                     /old_locus_tag="BAB2_0198"
                     /db_xref="GeneID:3827686"
     CDS             192252..193997
                     /locus_tag="BAB_RS27310"
                     /old_locus_tag="BAB2_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridylate synthase"
                     /protein_id="WP_002966378.1"
                     /db_xref="GI:489056239"
                     /db_xref="GeneID:3827686"
                     /translation="MMAQGDAVTLLKGLYQMTTEDDNKGGKPPHGRKGHSDRPGRPDW
                     DSRPRREGGDRDKPRKFGSRGAPVEEETSERIAKRLARAGIASRREAETMIAAGRIAV
                     NGKVLESPAVNVKRTDIITVDGKPLRQTERTRLWLYHKPAGLVTTNRDPEGRPTVFEA
                     LPPEMPRVLSVGRLDINTEGLLLLTNDGGLSRVLELPSTGWLRRYRVRAHGKVTQQQL
                     DELKNGIAVDGVFYGSVEAELERVQGANVWISIGLREGKNREVKNILGALGLTVGRLI
                     RVSFGPFQLGDLEEGAVREIKGRTLRDQLGDKLIEESGADFDAPVLNEFSNAAVQGRT
                     RREMEEGELPQEGERRRAPREREWISSTGERRRGREEKTEKVEPRRRGNANVWMAPGA
                     RPKGEKEAAKPARVEHQQPHRSAKFSGDLQMRPRRFSEEERGGEESGERRYKRPEGRF
                     EREGGRPDNREKYEKHEGAGKERRPGKRERAELRNAEGQTTERGKGGFEGRKPGKPGG
                     PRSEGRFGGADRDTRSGPRGSGPRGAGDGPRRGHDGKPGGKPGGKPTGRPGGKPGTKP
                     GGGGRSGGGGADRRR"
     gene            193978..194541
                     /locus_tag="BAB_RS27315"
                     /old_locus_tag="BAB2_0199"
                     /db_xref="GeneID:3827687"
     CDS             193978..194541
                     /locus_tag="BAB_RS27315"
                     /old_locus_tag="BAB2_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_002966377.1"
                     /db_xref="GI:489056238"
                     /db_xref="GeneID:3827687"
                     /translation="MRIVGGKFRGRALVTPSTNAIRPTTDRTRESLFNILAHSFPDKV
                     EGVRVLDLFAGTGALGLEALSRGARYATFVEESAEGRGILRQNIEALGLQGHTKILRR
                     DACQLGIVGTMEPFDLVFADPPYGRRMGEKAFLSALQGGWLNPDALLVLEEDAQAALE
                     LDDRFAVREERNYGGTVIRLIELKAAS"
     gene            194627..196171
                     /locus_tag="BAB_RS27320"
                     /db_xref="GeneID:23672502"
     CDS             194627..196171
                     /locus_tag="BAB_RS27320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006214470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc protease"
                     /protein_id="WP_002969286.1"
                     /db_xref="GI:489059214"
                     /db_xref="GeneID:23672502"
                     /translation="MNTPHSGCLLLSTVLGFALALPLAGGAVRAEMQPAAPAETQPAP
                     AAPAAPVAPAALPEIFRLDGVSNFTLPNGMQVVVIPDHRAPVVTQMVWYHVGAADEAP
                     GVSGIAHFLEHLMFKGTKNHPAGEFSARIASIGGQENAFTSYDYTAYFQRVSPEALEM
                     VMDFESDRMENLVLDEEAVKTEREVILEERRMRIDSNPGAMLMENTDAVLFYNHPYRK
                     PVIGWQQEMEKLSLKNAIDFYNQYYTPNNATLVIAGDVTPERVRELAMKTWANVHKRA
                     EVLLRERPQEPAKHAARVVTLHDERVSTPSFRISWLVPSYANEKRFANAKPGDAPALD
                     LLSEILGGSQLSQLYQQLIVKQGIAAETGASYDGDALDDGTFSVYGVPRNGASLGDVE
                     KAVAAQVDRIIRDGVTQAELDQARNRFLKAVIFARDSQTGMARIYGSALSVGQTVDDI
                     QKWPDLIKSVTVDQIKDVARRYLVKDQAVTSYLLPPDTEAESARKKPNAPANDASASG
                     AGGAIQ"
     gene            196171..196785
                     /locus_tag="BAB_RS27325"
                     /db_xref="GeneID:23672503"
     CDS             196171..196785
                     /locus_tag="BAB_RS27325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_002972144.1"
                     /db_xref="GI:489062117"
                     /db_xref="GeneID:23672503"
                     /translation="MNLSMSNFKRAFPLRGALHDARAVAGLLAASFTMLIVCALPARA
                     IEIQEVVSPKGIHAWLVEDNSVPLVSMRFSFKGGASQDPSGKEGIANLMTGLFDEGAG
                     DLDSDAFQERIDNLGAEMSFPLRRIRFPAASVCWPKIVMPRPISWRLPSTSRASIRKP
                     STAFASRLLQALRPHSAIRLRLRRASLPKCFTATTLMRVTMREP"
     gene            196782..197534
                     /locus_tag="BAB_RS27330"
                     /db_xref="GeneID:23672504"
     CDS             196782..197534
                     /locus_tag="BAB_RS27330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_002972142.1"
                     /db_xref="GI:489062115"
                     /db_xref="GeneID:23672504"
                     /translation="MKSLQSISRDDLANFHRKNFARDKLTVGVVGAINAKDLGVMLDR
                     IFGDLPASAELVPVPDAKLALGTTTSLNFDMPQTSISFVYPAIPRKDPEFFAAYLMNH
                     ILGGGFTSRLYNEVREKRGLAYSVSSSMVMHDHVSELMISTATRPDKAQDSLKIIREQ
                     VAAMANDGPTEEELAAAKSFLKGSYAVNNLDSSGAIANTLVSLQEAGLPSDYIDKRSE
                     LIDAVTLDQVKAIAWKLLQAEPAILIYGPAQS"
     gene            197545..198426
                     /locus_tag="BAB_RS27335"
                     /old_locus_tag="BAB2_0203"
                     /db_xref="GeneID:3827691"
     CDS             197545..198426
                     /locus_tag="BAB_RS27335"
                     /old_locus_tag="BAB2_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006015223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_002966373.1"
                     /db_xref="GI:489056234"
                     /db_xref="GeneID:3827691"
                     /translation="MDKALSSSPRFAVAFGGGGARGIAHIHVVDVLNELGIQPVAIAG
                     SSIGSIIGSSMANGMSGKDIYDYMASIFTNRSEVVRRMWQTRPAHWAELFKGGLRVSQ
                     FNIEKVLDVFLPDSFPSNVEDLKIPMTITAVDFHGAREIHISDGDLRSAIAASCAIPP
                     VFAPVRRNGRILVDGGLFNPVPFDLLFDKADIVIGIDVVGGPVGPDDHMPTTFEAVIG
                     TSQLTMCSIIENKFRYRPPHIFVRPNVERIGLLDFLKFEQVISQSAAVRDELKRAIEQ
                     ALDGKVAPILPEKLPDL"
     gene            complement(198439..200283)
                     /locus_tag="BAB_RS27340"
                     /old_locus_tag="BAB2_0204"
                     /db_xref="GeneID:3827203"
     CDS             complement(198439..200283)
                     /locus_tag="BAB_RS27340"
                     /old_locus_tag="BAB2_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006153255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_002966372.1"
                     /db_xref="GI:489056233"
                     /db_xref="GeneID:3827203"
                     /translation="MVANGGSLYLQSLIILGGAIIAAPLFKRLGLGTVLGYLAAGITI
                     GPVARLIADGEEFLHFSELGVVFLLFIIGLELNPSRLWSLRHSIFGLGTAQVLLCGAA
                     LAALGVYLAGLDTEAAIIIGFGLALSSTAFAMQVLEDRAETNQKHGQRAFAILLFQDL
                     AIVPILAIIPALSPNEPSQASAGFHLATAIASIAALVIAGRYLINPMFRIIANTGARE
                     VMITAALFVVLGSASLLQYAGLSMAMGAFIAGVLLAESSYRHELEADIEPFRGIFLGL
                     FFVAVGLSLNLSVILEYWAVILAAVPIFMATKIVIIYLLCRIFRSSHNDAVRIAFLLP
                     QGGEFAFVLFSAASAAAIISSALGSELVAAVTVSMALTPLSVAIGSRLLIKDKADDII
                     EENFDGAGSDVLMIGFSRYGQIAAQILLAGGIDVTVIDSSSNRVRAAGKFGFRIYFGD
                     GTRKDVLEAAGIRKAKIVAICTHKKSTTNHIVNLIQSEYPDVRLFVRSYDREHTLQLR
                     AQGVEYELRETFESGLLFGQRTLEGLGLSEANAYAIREDVRQRDEDRLHVQASEGIMA
                     GRHLLFNKPVTPEPLVKPTREGQRIDKSDDGQRAPSPQETAAAPVAAE"
     gene            200485..201828
                     /locus_tag="BAB_RS27345"
                     /old_locus_tag="BAB2_0205"
                     /db_xref="GeneID:3828047"
     CDS             200485..201828
                     /locus_tag="BAB_RS27345"
                     /old_locus_tag="BAB2_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modulator protein"
                     /protein_id="WP_002971281.1"
                     /db_xref="GI:489061243"
                     /db_xref="GeneID:3828047"
                     /translation="MISDNSADKLVERAAELVAAAKRAGADEVDAVVMRARSVSVSVR
                     LGKVEGTESSESDDFALRVFVGRRIASVSANAGADPHRLAERAVAMARVAPEDPYERL
                     ADPSLLVKSPRDLDLFDATEIDTARLTEDALAMEAAALAVSGVTNSGGAGASRSLGGM
                     VLVTSTGFSGHYAATRFGRSVSAIAGEGTGMERDYDFSSRLHFADLDAPEAIGRSAGE
                     RAVRRLGARQAKTGPVTVVYDPRLARGIAGHLASAINGASVARKTSFLRNSLGKPVLK
                     QGINVTDNPLRVRGPSSRPFDGEGIEGQPLTMVEDGVLQHWLLSGSSARELGLQGNGR
                     GVRSGSGVTPASTNFAIEPGTQSPEELIRAVGTGFYVTEVFGQGVDMISGQYSRGASG
                     FWIENGELAYPVSEVTIASNLKDMFLNMTPASDIDRNFGMAAPTLVIEGMTLAGN"
     gene            201815..202624
                     /locus_tag="BAB_RS27350"
                     /old_locus_tag="BAB2_0206"
                     /db_xref="GeneID:3827204"
     CDS             201815..202624
                     /locus_tag="BAB_RS27350"
                     /old_locus_tag="BAB2_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_002966370.1"
                     /db_xref="GI:489056231"
                     /db_xref="GeneID:3827204"
                     /translation="MPETDKYSDIGTELDLLREAAREAGRIAMHYFGRSPEVWLKDGV
                     SPVSEADLAVDRFLKETLLAARPDYDWISEETVDERAAAERSRAFVVDPIDGTRAYIG
                     GQDQWCVSIAIIENGSPVAGVLECPVREELLEAGKGLGARQNGCRIHTKVPLAGEEIT
                     IAFARNQINALPEQWRGPVRVHPYVPSLAYRIAMVARGDIAGTFIRPNSHDWDLAAAD
                     LILSESGGAILTSKALPLVYGGPTRSHGALVAASGNLLREMLSVVADQPLS"
     gene            202663..202914
                     /locus_tag="BAB_RS27355"
                     /old_locus_tag="BAB2_0207"
                     /db_xref="GeneID:3827205"
     CDS             202663..202914
                     /locus_tag="BAB_RS27355"
                     /old_locus_tag="BAB2_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966369.1"
                     /db_xref="GI:489056230"
                     /db_xref="GeneID:3827205"
                     /translation="MSDAGDNKQLLHLVFGGELKKLDSLEFRDLQNLDIVGIYPDYES
                     AKTAWKSKAQQTVDNAHMRYFIVHLHRLLDPNNMTLKAE"
     gene            202945..203721
                     /locus_tag="BAB_RS27360"
                     /old_locus_tag="BAB2_0208"
                     /db_xref="GeneID:3827206"
     CDS             202945..203721
                     /locus_tag="BAB_RS27360"
                     /old_locus_tag="BAB2_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966368.1"
                     /db_xref="GI:489056229"
                     /db_xref="GeneID:3827206"
                     /translation="MKHEDGVTERGMQKKKGGLAKRLWRRIRGPLARSAAVKSILVWL
                     IASYLKLVHATNPRLKDSASSEDIVHDFAPFIVTFWHGQHLMGPFLRPKGLELVAMFS
                     RSADAELNARVAEKLGLLTVRGSGGRGTRANPEKGGARALLTLKNALRKGQSTSMIAD
                     IAHGKAREAGEGIILLAKLSGRPIIPLAYAFSRNHVLEKTWDKTTIPLPFGRSTIVRG
                     DPVWVDADADDVQLEEKRVELTRQLNRATDRAYAALEKAK"
     gene            203718..205058
                     /locus_tag="BAB_RS27365"
                     /old_locus_tag="BAB2_0209"
                     /db_xref="GeneID:3827172"
     CDS             203718..205058
                     /locus_tag="BAB_RS27365"
                     /old_locus_tag="BAB2_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_002966367.1"
                     /db_xref="GI:489056228"
                     /db_xref="GeneID:3827172"
                     /translation="MSERWARSILSAYRFLGSAAYPFVGSYIAYRASRGKEDRSRRGE
                     RYGKSAIARPQGPVIWAHAASVGETIALVPLVERIVATGIHVVMTTGTVTSAKVVADQ
                     LGSRVIHQYAPLDLQPAVDHFLDHWKPDLVIGCESEVWPATVLSLGSRHIPHVLVNGR
                     MSDRSFAAWQKRPALAEALFENFAHVVAQSELDGERFRALGARPVSVSGNLKVDTPPP
                     PSDPQALSLMQRQVAGRRTWAAISTHDGEEEIAAEVHQMLKMRYPRLITIIVPRHPDR
                     APAIEAMLAAKGLKVARRSTGQPIEADTDVLLGDTIGEMGLYLQLTEIAFIGNSLTKE
                     GGHNPLEPAMMGTAVLTGRNVQNFRESFQRLIKNGGARIVKDRNMLAGAINFLFNNPQ
                     HLRAMINAGVTTVRDMRGALDRTLAALEPFIQPLVLQAQLPGNRNEPAFSLDEH"
     gene            205061..206086
                     /locus_tag="BAB_RS27370"
                     /old_locus_tag="BAB2_0210"
                     /db_xref="GeneID:3827177"
     CDS             205061..206086
                     /locus_tag="BAB_RS27370"
                     /old_locus_tag="BAB2_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="WP_002966366.1"
                     /db_xref="GI:489056227"
                     /db_xref="GeneID:3827177"
                     /translation="MASEAPPFWWDEPDWRALALAPAAWIYGRVSGRRLIRAVPPRVS
                     LPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKPGIVSRGYGGNYSGLHLVDPGHDGA
                     RHVGDEPLLLARHAAVALSPDRVKAAEYLKSLGCDFIIMDDGFQSARLHADFSLLVVD
                     ASRGIGNGRVIPAGPLRAPLTDQMRKTDALLCIGKGNGADFVIRQAARAGRPIYHAQL
                     RPSSSATVAGRRWLAFAGIGNPDKFYESVRQAGGEVVETHSFADHYSFEPDDIRGLVD
                     MARRQGLGLITTAKDHVRLATMPGVPPEFLSKLAVLDVDLEFDRTDALDHILDTVVER
                     FKSRLHG"
     gene            complement(206100..206336)
                     /locus_tag="BAB_RS27375"
                     /old_locus_tag="BAB2_0211"
                     /db_xref="GeneID:3827207"
     CDS             complement(206100..206336)
                     /locus_tag="BAB_RS27375"
                     /old_locus_tag="BAB2_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966365.1"
                     /db_xref="GI:489056226"
                     /db_xref="GeneID:3827207"
                     /translation="MNRFESPRSSEAVLRYLDGDYEIVKHGSFVSCAVTGAPIPLDEL
                     KYWSVARQEPYASGLISFERELEMNPELRSRKKA"
     gene            complement(206434..208305)
                     /locus_tag="BAB_RS27380"
                     /old_locus_tag="BAB2_0212"
                     /db_xref="GeneID:3827922"
     CDS             complement(206434..208305)
                     /locus_tag="BAB_RS27380"
                     /old_locus_tag="BAB2_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_002966364.1"
                     /db_xref="GI:489056225"
                     /db_xref="GeneID:3827922"
                     /translation="MTIRHLSETIINQIAAGEVIERPASVIKELVENAIDAGATRIEV
                     VTAGGGKTLLRVTDNGSGIPADELALAVSRHCTSKLTDDVHDIRALGFRGEALPSIGS
                     VSKLTLKSRPQDADSGFEVCVTGGHLDGPRPTALNRGTIVEVRDLFYATPARLKFMKT
                     DRAEATAITDVVKRIGIAFPHIRFSLAGTDRTPFEMPATGTGAEATLERIGQVLGREF
                     GENALAIDAERDGVRLAGFVGIPSFNRGNALHQFAYVNGRPVRDKQIFGALRGAYSDV
                     IARDRHPVAVLFLTLDPALVDVNVHPAKADVRFRDPGLVRGLIVGAIKQALAQSGIRP
                     ATSGAEAMLQAFRAEGFGAQQSAPRPANSYSPASWRTAPPAPRSEWSPQTAHPAHRPL
                     DLQAAPALRENGQAVLGDVAVPAADARASVAEAPVELMQKPLGAARAQIHENYIVAQT
                     EDSLVIVDQHAAHERLVYEALKNALHARPIAGQMLLIPEIVDLPEEDAQRLAGHAETL
                     ARFGLGVEQFGPGAIAVRETPAMLGEMNVQQLIRDLADEIAEHDTADGLKAMLHHVAA
                     TMACHGSVRSGRRLKPEEMNALLRDMEATPGSGTCNHGRPTYIELKLTDIERLFGRR"
     gene            complement(208489..209772)
                     /locus_tag="BAB_RS27385"
                     /old_locus_tag="BAB2_0213"
                     /db_xref="GeneID:3827921"
     CDS             complement(208489..209772)
                     /locus_tag="BAB_RS27385"
                     /old_locus_tag="BAB2_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006162199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_002969288.1"
                     /db_xref="GI:489059216"
                     /db_xref="GeneID:3827921"
                     /translation="MRTINENTATKTSRAAVRPEHNRIWILVFIFSFLGLMIDGADLM
                     LLSYSLTSIKAEFGLTSVEAGSLGSITLAGMAIGGIYGGWACDRFGRVKTVSWTIVLF
                     SIGTAVLGLTHSYFQFAVARFVSSLGLGALYVACNTLMAEYVPTKYRTTALGTLQAGW
                     SVGYIVATVLAGAILPVYGWRYLFFVAIVPVIIALLMHKGVPEPESWVRAKAERESGG
                     SKFTTAKRESAFKAIFGNPRVRTLFIFWALTAGFLQFGYYGVNNWLPSYLETEMGMNF
                     KSMTAYMIGSYTAMILSKVLAGVAADWLGRRAVFALGALGTAAFLPIIVLYHSPDTIL
                     WMLVVFGFLYGVPYGVNATYMAESFEAKYRGTAVGGAYNIGRAGAALAPVAIGFFASQ
                     ISIGFGFLVMGGAYFICGVIPALFIREKQFDPEKQ"
     gene            complement(209870..211024)
                     /locus_tag="BAB_RS27390"
                     /old_locus_tag="BAB2_0214"
                     /db_xref="GeneID:3827208"
     CDS             complement(209870..211024)
                     /locus_tag="BAB_RS27390"
                     /old_locus_tag="BAB2_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_002967196.1"
                     /db_xref="GI:489057073"
                     /db_xref="GeneID:3827208"
                     /translation="MIRDPETLEILRDTVSQFVSETLIPRENEVAETNAIPADIIAQM
                     KELGFFGLTIPEEFGGLGLTMEEEVNVAFELGRASPAFRSYIGTNNGIGSIGILIDGT
                     DEQKRNYLPRLASGELLSSFCLTEPDAGSDAASLKTTAVRDGDFYILNGTKRFITNAP
                     IADIFTVMARTAADVKGADGISAFIIERNSPGLSLGKPDQKMGQKGALTSDVIFENVR
                     VPASQLIGGVEGKGFKTAMKMLDKGRLHIAALSTGAAERMLADTLAYALDRKQFGKPI
                     ADFQLIQAMLADSKAEIYAAKCMVLDAARKRDSGQNVSTEASCAKMFATEMCGRVADR
                     CVQIHGGAGYVSEYAIERFYRDVRLFRIYEGTTQIQQIVIARNMIREARR"
     gene            complement(211081..211935)
                     /locus_tag="BAB_RS27395"
                     /old_locus_tag="BAB2_0215"
                     /db_xref="GeneID:3827209"
     CDS             complement(211081..211935)
                     /locus_tag="BAB_RS27395"
                     /old_locus_tag="BAB2_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_002966361.1"
                     /db_xref="GI:489056222"
                     /db_xref="GeneID:3827209"
                     /translation="MRSRTGSDASRRQERSAEMRKPTMLTPLEAGVEEEDRQFVTALA
                     RGLEVLRCFTPTENTLGNQEIAHKTGLPKPTVSRLTHTLVRLGYLRQDALSGLYQLDI
                     GILRLGYAMLSNLMIRTVASPLMQVLADYAKAAVAMAARDRLSMVYLDVVQGEGNMTM
                     RRQIGSTLPLAGSSVGRACLAAMPEDERTFILEHIREREPENWPSIRKGLDRALRDFE
                     DYGYCLSIGEWHRDVNSVAVPLVHKQYGVLVFNCGGPSFQLPREKLEDDIGPRLIEMV
                     HNISSAVP"
     gene            212960..214537
                     /locus_tag="BAB_RS27400"
                     /db_xref="GeneID:23672505"
     CDS             212960..214537
                     /locus_tag="BAB_RS27400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974634.1"
                     /note="converts 3-hydroxyadipyl-CoA to beta-ketoadipyl-CoA
                     in phenylacetate degradation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_002967198.1"
                     /db_xref="GI:489057075"
                     /db_xref="GeneID:23672505"
                     /translation="MERSINHIAIVGAGVMGTGIAQIAAQAGLVTQIFDAREGAAAAS
                     RDRLASTLAKLAEKGKISAEDAQTAVSRIEICSSIQELADCDLVVEAIVEKLDAKQAL
                     FLELEAVVSGNCILATNTSSLSVTSIARVCRHPERVAGFHFFNPVPLMKVVEVIDGLT
                     TDPAVGDALLVLAKRMGHHGIRAKDMPGFIINHAGRAYGTEALKILGECVAPRGDIDR
                     ILRESAGFRMGPLELFDLTGLDVSHPVMESIYNQFYQEPRYSPSALTRQMLEGGYVGR
                     KVGQGFYRYEDGKMVAPPVPQPVPAVDIMPSVWISADCDEDKEQLYALLRSLGATVET
                     GALPSAEALCLLAPYGYDATTACELAGSDPARTVCIDMLPGLDRHRTLMMTPATSPAF
                     RDAAHALLARDGVNVTVIRDSVGFVAQRTLAAIVNLACDIAQQGIATADDIDQAVRLG
                     LGYPQGPLAWGGFSDPENIVAYAGINRRPPLQAKPMVAPQGRAGPFPALRGAGYRLEH
                     FRAKSAKRLRGEISPLD"
     gene            214701..215840
                     /locus_tag="BAB_RS27405"
                     /db_xref="GeneID:23672506"
     CDS             214701..215840
                     /locus_tag="BAB_RS27405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cag pathogenicity island protein Cag19"
                     /protein_id="WP_002966358.1"
                     /db_xref="GI:489056219"
                     /db_xref="GeneID:23672506"
                     /translation="MGALTGYRVLDMSRVLAGPWCGQILADLGAEVIKIERPRTGDDT
                     RDWGPPWMKDEQGNPTREASYYQSANRGKFSVALNIASPEGQDLLRKMVAECDVLIEN
                     YKAGSLAKYGLDYETLSAINPGLVYCSVTGFGQTGPRAPEPGYDFIIQGIGGLMSITG
                     ERDDKPGGGPQKVGVAVADLMTGLYSAIAIEAALLSRAKTGKGQHIDMALLDVQVAAL
                     CNQSQNYLASGRPPGRYGNAHANIVPYQVFRASDRDFIIACGNDAQFVSLCDAIGLPD
                     LPKDPRFTRNSDRVIHRDEIIGILAAHFLTGTADEWIGRIHPRGVPVGAINDIARTLD
                     EPQVKARNMLVQIPHPLNKDFVTVGSPHQAFGNAGGIQACRPHAG"
     gene            215806..215943
                     /locus_tag="BAB_RS27410"
                     /db_xref="GeneID:23672507"
     CDS             215806..215943
                     /locus_tag="BAB_RS27410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972135.1"
                     /db_xref="GI:489062108"
                     /db_xref="GeneID:23672507"
                     /translation="MEYKRAAPMLGEHTDTLLQQLAKLDDDRLNDLKSRGIIEQFNSG
                     E"
     gene            complement(215927..217201)
                     /locus_tag="BAB_RS27415"
                     /old_locus_tag="BAB2_0219"
                     /db_xref="GeneID:3827213"
     CDS             complement(215927..217201)
                     /locus_tag="BAB_RS27415"
                     /old_locus_tag="BAB2_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="WP_002966357.1"
                     /db_xref="GI:489056218"
                     /db_xref="GeneID:3827213"
                     /translation="MSLFSPLVLNNGATIPNRIAKAAMEENMADADHAPSAGLLRLYK
                     AWAEGETGLIITGNVMVDARAMTGPGGVVLEDDRHLDRFQAWAEAGRTRGAHIWMQIN
                     HPGRQMPAALGQETLAPSAIALDLGAQSKRFPIPREMSEADIADVERRFINTAQLAER
                     ADFTGVEIHAAHGYLLSQFLSPLSNRRQDRWGGSLENRARLLVNIVRGIRAAVSPGFC
                     VAVKLNSADFQRGGFSPEDARAVVMMLAPLGVDLVELSGGSYEAPAMMGSARDERTLA
                     REAYFLDFARDIAEIATMPLMVTGGIRRREVAEQVIESGIAMAGIATALAIEPNLPRN
                     WRLGRADAPKLKPIAWKNKPLAASAHMAAVKYQLTRLSCQRRTAPGISPVWALAVSQI
                     DAFFRARRYRQWMVDRRATPGRYRPDQFIRQS"
     gene            217287..217751
                     /locus_tag="BAB_RS27420"
                     /old_locus_tag="BAB2_0220"
                     /db_xref="GeneID:3827214"
     CDS             217287..217751
                     /locus_tag="BAB_RS27420"
                     /old_locus_tag="BAB2_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008509637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_002966356.1"
                     /db_xref="GI:489056217"
                     /db_xref="GeneID:3827214"
                     /translation="MKIGELAKRSGLAASRIRFYESIGLLKTVDRRSNGYRTYPEEAV
                     LVLHLIATAQKAGFSLDEIRTLLPPDLDNWEHDALIEVLRRKVADIEALEARLARSKL
                     QLLGLISDIEAKPDDMACADNARRVLSRLMAEEMEAPASLQDEGRPHRRTTI"
     gene            complement(217849..219192)
                     /locus_tag="BAB_RS27425"
                     /old_locus_tag="BAB2_0221"
                     /db_xref="GeneID:3827215"
     CDS             complement(217849..219192)
                     /locus_tag="BAB_RS27425"
                     /old_locus_tag="BAB2_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006218981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_002966355.1"
                     /db_xref="GI:489056216"
                     /db_xref="GeneID:3827215"
                     /translation="MMRPRSLQWRISLWLGLGISMLWAIAALVTASQLSREMNVVFDS
                     ALEETAQRILPLAVLDITERESDDEMNQRMATLRKHDEYFTYVVRNTAGEVLLQSHSA
                     DLSIFPPFTTMGFQTTPTHRIYFDAALQGAVNIAVAEPLGARRGVAMQVLWRLALPLG
                     LVIPLSLIGVWAIVRVSMAPLWAFRSDIEARGSGDLSPVTVNDLPSEVSPIAQAVNRL
                     MDKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHR
                     LSRLSEKLMQLAKAEGGRLHAAEPIDMGVILRMVVRELSQPHGNENRIRLSIPDMAVK
                     IDIDADAFAILARNLIENALKHGPHDEPVEVLLTASGKLVVSNGGPAVPPDILERLSH
                     RFERGATKAEGTGLGLAIAKAIAAGTGGTIDLFSPREGRKDGFEVRFTPGGRVLH"
     gene            complement(219189..219866)
                     /locus_tag="BAB_RS27430"
                     /old_locus_tag="BAB2_0222"
                     /db_xref="GeneID:3827216"
     CDS             complement(219189..219866)
                     /locus_tag="BAB_RS27430"
                     /old_locus_tag="BAB2_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966354.1"
                     /db_xref="GI:489056215"
                     /db_xref="GeneID:3827216"
                     /translation="MRIILIEDDPILGAAVRDHIAAEGHCVDWVSRLDTAHDYMESAR
                     YDLVLLDLMLPDGQGLSFLRDLRTKGCSTPVIILTALDQISDRIQGLNAGADDYLTKP
                     FDLSELSARLNAVARRYSGNPNPLIEIGGLQIDLAAKSVMRDGRALCLTAREWALLEA
                     FLQHPGQTLSKAQLEEHLYSFDTEVESNTMEVHVSRLRKKLGHAIIETVRGIGYRLGN
                     SKSKAAR"
     gene            220007..220402
                     /locus_tag="BAB_RS27435"
                     /db_xref="GeneID:23672508"
     CDS             220007..220402
                     /locus_tag="BAB_RS27435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966353.1"
                     /db_xref="GI:489056214"
                     /db_xref="GeneID:23672508"
                     /translation="MKKIILMTALIAAIAAPQAALADNDCNVPMDKWQSRDAVQQMAA
                     SLGWNVKRIKIDDGCYEIKGLNEAGKPFKAKINPQSLAIMKLKVKGMDDDRDHRRNRQ
                     QHGDAPGPLDGVPANKLIQKGSTPKVQVQ"
     gene            220570..221040
                     /locus_tag="BAB_RS27440"
                     /old_locus_tag="BAB2_0224"
                     /db_xref="GeneID:3827218"
     CDS             220570..221040
                     /locus_tag="BAB_RS27440"
                     /old_locus_tag="BAB2_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006204531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="WP_002966352.1"
                     /db_xref="GI:489056213"
                     /db_xref="GeneID:3827218"
                     /translation="MKSLLSALAITTALTFPGLALAQPVTLSTTLNNYGGDGAYIALY
                     VTDAQGAYAGSLWMAGGKSKYYQHLSGWYRATGGDTAEIDGITGASVGAGRKLEITLD
                     LADALFDAGYTLHVDAAVEDMQDSPDEIALPLTSKGSGVPVRGRRYIANFTYTK"
     gene            221051..221356
                     /locus_tag="BAB_RS27445"
                     /db_xref="GeneID:23672509"
     CDS             221051..221356
                     /locus_tag="BAB_RS27445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002972134.1"
                     /db_xref="GI:489062107"
                     /db_xref="GeneID:23672509"
                     /translation="MIRWLHRWSGIIAAVLLMVLALSGAALSVFPAMERLSAPQAETG
                     LSVADLMARIQANYPAVEQVRRTPSGKITAYWFDDGAPQAAVIDPATGKSVAPAKPE"
     gene            221421..223256
                     /locus_tag="BAB_RS27450"
                     /db_xref="GeneID:23672510"
     CDS             221421..223256
                     /locus_tag="BAB_RS27450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006097756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972133.1"
                     /db_xref="GI:489062106"
                     /db_xref="GeneID:23672510"
                     /translation="MAIGALIMLGLSISGAFLIARRTGGWKNWFKPPRGAASGRLHTE
                     VARIAVLGLLLSSTTAVWMSASTFDLLPKSPVVAEPTGVSGETGMKPALIAKLEETPV
                     SSFKELSFPYPGDATDMFVLKTDRGTGYLDQGTGAVLDWHDYTVWQRISQTVKMLHTG
                     KGAALLGIILGLASLTVPFLGITGIVLWFAGLRGRPRIRDNAAAGKAETIVLVGSEGG
                     STWGFAATLHAALREAGQSVHVGPMSSFNPARYGKAQRILIFAATYGNGDAPASAKGF
                     LDRLAALPKSPAAPLAVLGFGDRSFPDYCAFAKAIADGARAKGWKELIPFETVDRQST
                     QDFARWGRDLGAAIGIKLELVHQPVIPAVAALTLVSRRDYGADVQAPTAILRFALPKP
                     TFWQQLSGAGFSRFEAGDLLGIVPEGSAVPRFYSLASGSRDGFVEIVVKKHPAGLCSG
                     QLFELQPGDTMRAFLRRNANFHAGKGRTPLILVGAGTGIGPLAGIVRANRQHRPVHLF
                     FGMRHPESDFFYHEDLQEWQGEGRLQNLTTACSRVHNPSYVQDALRKDAAEIARLVNK
                     GARVMVCGGRDMAAGVSEALADILAPAGLTPAVLKAEGRYVEDVY"
     gene            223237..224214
                     /locus_tag="BAB_RS27455"
                     /old_locus_tag="BAB2_0227"
                     /db_xref="GeneID:3827221"
     CDS             223237..224214
                     /locus_tag="BAB_RS27455"
                     /old_locus_tag="BAB2_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis lipoprotein ApbE"
                     /protein_id="WP_002966350.1"
                     /db_xref="GI:489056211"
                     /db_xref="GeneID:3827221"
                     /translation="MSKMFTDLKRHGLNGPTMRTRWSAIFYAAADFDIAPLRRALQQA
                     VDEVDMQMSTWKPDSDLMRLNRAPVGVWVEVPARLMEVLRLAIEIGRATGGAFDAAMG
                     DAVKAWGFGPMEADQRLISEALAGPRVAAHDALELDISAMRVRKRAAVTLDLNGIAKG
                     YGVDRLADTLESFGIHSGLVGIDGEMRALELRPDGTPWAIAVEMPDYNRRAPHSVLAL
                     HNGAVATSGDYRHWVVAGGHRLSHTMDPHRGAPLSTPPASVTVVAKTCAQADAFATAL
                     MVLGPIAGSKLAQSLGLDVLFLLRDGETIRPQPVGALFSGHPYPLQKLG"
     gene            complement(224257..225207)
                     /locus_tag="BAB_RS27460"
                     /db_xref="GeneID:23672511"
     CDS             complement(224257..225207)
                     /locus_tag="BAB_RS27460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_002967200.1"
                     /db_xref="GI:489057077"
                     /db_xref="GeneID:23672511"
                     /translation="MLCRFVEKQIPGTRCSVLILDPSGKKVGKSIAPSLPTHYNKALI
                     GLEIGPNIGSCGAAMFLRRPVIISDIATHPNWLSFRDLALPCGLRACWSMPAINGAGK
                     VLGAFAIYSDTPRTPAQNELMVGQIAVELSMIAVDTAQTQERLASQAMHDDLTQLPNR
                     RYIGKLLTQKKSARDGLSRDGFLLLIDLDDFKPVNDTYGHLTGDEVLKEVAQRLLRIV
                     CEEDTVARMGGDEFMIVLNGGTSKEQTDIIASRIIREVSKPIEVSQHKPVKVGCSIGI
                     VSTREWRSNKYIFDCADKAMYSAKSKGKNRFEYFEEKQAA"
     gene            225229..226473
                     /locus_tag="BAB_RS27465"
                     /db_xref="GeneID:23672512"
     CDS             225229..226473
                     /locus_tag="BAB_RS27465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967201.1"
                     /db_xref="GI:489057078"
                     /db_xref="GeneID:23672512"
                     /translation="MSASHSRGSRLPFGFKGLGRVAAFVATGLVAGGWAITALGTLET
                     VIPAFAPVTPVLRRVPLTTPQALAVVDPRIVPSRRVRQGFIDAYTANTAYSNLDWRRS
                     KSAHDEPIIADIGPDAVIEDKPVETALLVELRADRVRRKEPAITVLQAPIAPAAGENV
                     LAYAEMPAASPAVSAFAKIEPLSRAEEADAGENQAGLPSGRAVPVPAMAPDQTMDMAA
                     DREAGHDLFLPDDVPLPGAKPALRRSRLHDKTQLAYAPESGATEEPQPGIFSPLLNQA
                     ARSRVAVYDISAATVYLPSGEKLEAHSGLGQMRDNPRYVSQKNRGPTPPHTYDLRMRE
                     ALFHGVQAIRLTPVDGNNRYNRDGLLAHTFMLGRRGDSNGCVVFKDYARFLRAFKRGE
                     VNRMVVVAHMPSSKPARIASLF"
     gene            226577..227182
                     /locus_tag="BAB_RS27470"
                     /old_locus_tag="BAB2_0230"
                     /db_xref="GeneID:3828095"
     CDS             226577..227182
                     /locus_tag="BAB_RS27470"
                     /old_locus_tag="BAB2_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_002965649.1"
                     /db_xref="GI:489055499"
                     /db_xref="GeneID:3828095"
                     /translation="MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYL
                     AINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVAAFKPAYGSLERARLQEALGFCS
                     DLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
                     ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI"
     gene            227365..227751
                     /locus_tag="BAB_RS27475"
                     /old_locus_tag="BAB2_0231"
                     /db_xref="GeneID:3828096"
     CDS             227365..227751
                     /locus_tag="BAB_RS27475"
                     /old_locus_tag="BAB2_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence protein"
                     /protein_id="WP_002971188.1"
                     /db_xref="GI:489061147"
                     /db_xref="GeneID:3828096"
                     /translation="MQISRIDHFVLTVQDIDVTCDFYSRACGMEVVTFAGGRKALSFG
                     QHKINLHQAGSEFLPKAASPTRGSGDFCLISSIPLDEVIAHLETENIAIEDGPVARTG
                     AMGPIRSIYFRDPDGNLVEISEYIDL"
     gene            227904..228311
                     /locus_tag="BAB_RS27480"
                     /old_locus_tag="BAB2_0232"
                     /db_xref="GeneID:3828097"
     CDS             227904..228311
                     /locus_tag="BAB_RS27480"
                     /old_locus_tag="BAB2_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967202.1"
                     /db_xref="GI:489057079"
                     /db_xref="GeneID:3828097"
                     /translation="MVKRGRLQHWAFVLRILCAVALVSVGLAHKIPVFASSSKGYFDL
                     SSYELPDGTFPVFCLMDNGDRTSKQPQSSRSDCDACRISCSVILPVPESGTVNRPLRA
                     NVPTVRKSYAACHEQRLPSNRSPRAPPFKLSIA"
     gene            228408..230438
                     /locus_tag="BAB_RS27485"
                     /old_locus_tag="BAB2_0233"
                     /db_xref="GeneID:3828098"
     CDS             228408..230438
                     /locus_tag="BAB_RS27485"
                     /old_locus_tag="BAB2_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_002971189.1"
                     /db_xref="GI:489061148"
                     /db_xref="GeneID:3828098"
                     /translation="MRIKAVIRARTFRQSLLLSSALMSLAAMPAYAQEKPKSDEQSGV
                     ILNRIVITSAPQSTPFKVVTDPKAPRQPVPASDGADYLKTIPGFSTIRNGGTNGDLVF
                     RGMFGSRVNIRTDGGVILGACGGRMDNPTSYISPESYDRMSVIKGPQTVQWGPAGSAA
                     TVLFERDPQHFDKLTLKGDSSILFGSNGRFDARVDATVGDKPGYIRMMANKSRANDYK
                     DGDGNRVPSKWDKWNTDLYLGLTPDADTVLEISGGLGDGEARYAGRAMDGSQFERQSF
                     GLKFSKSNVSDYLEKIEAQLYYNYADHIMDNFRLRPPQKMPMESEVDRRSMGGRVSTT
                     WNFDEHRLVAGLDFQTDTHRGKEKVNMQLTDNWLKDAQFANYGVFGEWTWNFADNQRL
                     VAGGRIDRASVEDDRASSLTYGDKRNQAAFSGFIRHEQDWSSLPVNSYIGLGYVNRFP
                     DYWELFSPKGVTGSALNAFEGIESEKTVQVDFGAQYSEGDTDIWASGYFGVINDFILF
                     DYSNPGGSVATNVNARIMGAELGVSRQFANYWKAEASIAYAWGQNTTYDEPLPQIPPL
                     EGRLGLTYERDNWSVGALWRLVAAQTRIAENMGNVVGKDFDKSAGFGVFSVNGTYRFN
                     ESVRLSLGVDNLFNKEYTEHLNRDGDAGFGFSSNYQLREPGRTFWAKTDFKF"
     gene            230606..231787
                     /locus_tag="BAB_RS27490"
                     /old_locus_tag="BAB2_0234"
                     /db_xref="GeneID:3828099"
     CDS             230606..231787
                     /locus_tag="BAB_RS27490"
                     /old_locus_tag="BAB2_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969290.1"
                     /db_xref="GI:489059219"
                     /db_xref="GeneID:3828099"
                     /translation="MQFSMWTYPWDIQDLGLDMVCSDLREKVGGNTISLATSYHAGRF
                     FQPRSPQQKAYFPEDGTIYYTPDEALWEGKEIRPLVAKNCIERGDMLQRLIERRREGG
                     GLRVSCWTVGLHNSRLGELHPDHVTRNAFGNANYYNLCPSSPAARDYVVTLVADITSR
                     YQPDMVELESVNFMGFAHEHHHEKDGVGLTDEDDFFMSLCFCDHCKARAKAAGVDIDN
                     AQAVVKGFIAEACEREVPQKQFADFPQAGISAFAKWPSLYAFLQWRTEPVTSLIGEIR
                     AVADPASRIVLIDLKDGWLGGVDLEEAVRACDGIILCCYDMGAEQIEKTIRDARSRLP
                     ADKYVGLGLSLFYSLVKSKEEFAARVDAGKRAGVDGINFYNYGLIPQKRLEWIGAALA
                     R"
     gene            complement(231881..232675)
                     /locus_tag="BAB_RS27495"
                     /old_locus_tag="BAB2_0235"
                     /db_xref="GeneID:3828100"
     CDS             complement(231881..232675)
                     /locus_tag="BAB_RS27495"
                     /old_locus_tag="BAB2_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_002965654.1"
                     /db_xref="GI:489055504"
                     /db_xref="GeneID:3828100"
                     /translation="MDKLHIEPTAKRSRGLERAFEILDYLRVSRAPANPNEIAARIKA
                     PRSTVYELVNLLLSNGVLEYCDDEGRVYLGRKLYFLGVAYEDHFNFIRECDRALSKVA
                     EQTRETAQFCMLDENKYTVVRMHEGARPFRISSDVGQRVPIPWTASGRLLLSHLNDAE
                     ILAFIPPEDFQLPNGQWLAPEVFLREVHAAREARAFTFDSIVDSFTHCFAVPVENDHG
                     KFCATVCLVAPRDDGIRNHDMYLQSLREAALSLKGKVSAFQRDQSV"
     gene            232977..233516
                     /locus_tag="BAB_RS27500"
                     /db_xref="GeneID:23672513"
     CDS             232977..233516
                     /locus_tag="BAB_RS27500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_002972132.1"
                     /db_xref="GI:489062105"
                     /db_xref="GeneID:23672513"
                     /translation="MMHFITRAGSGLRMLLAGVSGAALLCMAGAGSAEAAANCVKGDR
                     KAPYMVGWANIYAVPTWMKQTEDTIVDEVEQLKKEGLVKDLMITDAQGNAQTQIQQIQ
                     SMIDANMDAIVIDAGSSSALDRVIADACEKGIAVINFDSLVDTENLTAKINTDSAEWG
                     ERAAQWMVDHWVARARSSS"
     gene            233513..234043
                     /locus_tag="BAB_RS27505"
                     /db_xref="GeneID:23672514"
     CDS             233513..234043
                     /locus_tag="BAB_RS27505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter"
                     /protein_id="WP_002967204.1"
                     /db_xref="GI:489057081"
                     /db_xref="GeneID:23672514"
                     /translation="MNGPAGVSVSDDRRKGAQPVLDANKGIEIITETNTEYNVAPAQE
                     AMTSLLFANPEIDGVLSLSGAIAAGAVLAFDRQGRDPVPITGENARQFLELWKEKGLK
                     AWATMQPNWLGAFSVYAAVQALEGKDIPKSIKVPLPVIDASNVDTYLARADKFPADGY
                     VYSDYDRALFDKLLGQ"
     gene            234052..235584
                     /locus_tag="BAB_RS27510"
                     /old_locus_tag="BAB2_0238"
                     /db_xref="GeneID:3827826"
     CDS             234052..235584
                     /locus_tag="BAB_RS27510"
                     /old_locus_tag="BAB2_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006092695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_002965656.1"
                     /db_xref="GI:489055506"
                     /db_xref="GeneID:3827826"
                     /translation="MQVSSRPVVDAPAPLLEARNVFKGFFGNPVLKGVSIALRPGRVH
                     ALLGENGAGKSTLINLLSGALPPDSGNIVLEGAALSRLNPAQARKAGIAVIQQELSLT
                     PELSIAENIGLGAYPRRFGLIDYKALHGEALAVCKRVGLTEPLETPVGTLSLGRRQMV
                     EIAKALFRKPRVLILDEPTSSLSAHEAGVLSSLVLKLRDEGVALLYISHRLNEIRSLC
                     SHVTVLKDGVVTADQSLSNSDPEELVRLMVGRDTGDLFPAWRTSATGEKRIHIRGMSA
                     GMVQNVDMDANAGEIIGIGGLVGQGQEDFLLGLYGALPTAAREAIVCGNNGLFKSVGA
                     ANAAGLAYVPADRKREGLVLPHSIASNLLLPSLDRYTRHGLRNTANEQRVVAKLAERL
                     TIRGDTARPVQALSGGNQQKVALAKWLPLEPTILLLNDPTRGVDIETKREIYLMLRRF
                     ADEGKLVVLLSSDTPELVHLCDRVMVFREGRMVATLKHGDLSEEAIVGAAMGLKSSRK
                     AA"
     gene            235584..236543
                     /locus_tag="BAB_RS27515"
                     /old_locus_tag="BAB2_0239"
                     /db_xref="GeneID:3827831"
     CDS             235584..236543
                     /locus_tag="BAB_RS27515"
                     /old_locus_tag="BAB2_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006074124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965657.1"
                     /db_xref="GI:489055507"
                     /db_xref="GeneID:3827831"
                     /translation="MQQDMAGNLYIAVQRRRNRGLIGLYAVVGIFVLLYAWLFPGILS
                     VSGFSKFTQNWFPLALVTMAQALLMLNGGITLAIGPLVSLGAVIAATTMGSAFGVFGG
                     VAAVILSGFVIGALTGSIVAFMRLPAIIVTLAGSFIITGIALLILPRPGGYIPGWLSD
                     FLAGHSPSAFIILVLVILGWKLFLATPMGLGIYAAGENPVGAYRSGVPVEKVKVISFA
                     LSGVLATCAGLFVAAQTGSGDPVIGTPFTLNSIAAAVLGGVGFLGGKGTMRGAICGSL
                     LLSVMINVMFFLGFPPVAQYIAQGLIIVGAVALPEFAGKWRKS"
     gene            236540..237493
                     /locus_tag="BAB_RS27520"
                     /old_locus_tag="BAB2_0240"
                     /db_xref="GeneID:3827830"
     CDS             236540..237493
                     /locus_tag="BAB_RS27520"
                     /old_locus_tag="BAB2_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002968927.1"
                     /db_xref="GI:489058846"
                     /db_xref="GeneID:3827830"
                     /translation="MNSLPLTGRRLLQSPPLLTLLLVALVWLVASLTLRGFGAYGHLR
                     YLLELAAVIGIVAAGQTLVIIVGGIDLSVGAVMTVTAILLPVISPDWDPTGLLGVVMV
                     LAIAAIIGAVNGIGAAWLRVPPIIMTLAMATFLQGLLVIVAGGSAVSVNNAAAIFLGS
                     ARPFGIPASIILWVAVTAVVLVLLHKMPTGARFLALGANPVATRLSGVNVNRNMVALY
                     ALSAFFAGLAGIVLLGMNRQGYVGIGEPYVLLSIAAVVLGGTSILGGRGTYAGTIPGA
                     ILLVTTTALITMVNASPGLRSILFGSLILGLLMISGREARR"
     gene            237568..237912
                     /locus_tag="BAB_RS27525"
                     /old_locus_tag="BAB2_0241"
                     /db_xref="GeneID:3828101"
     CDS             237568..237912
                     /locus_tag="BAB_RS27525"
                     /old_locus_tag="BAB2_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease"
                     /protein_id="WP_002965659.1"
                     /db_xref="GI:489055509"
                     /db_xref="GeneID:3828101"
                     /translation="MIMRYQKGSRMSQAVSYGGLVHIAGQVANDRKAGIEEQTRDVLG
                     KIDVLLKEAGTDRSKLLAVNVFLPAIVDFDAMNAVYDAWIDAENPPARACVEARLADP
                     DLRVEMTAIAAL"
     gene            complement(238120..238782)
                     /locus_tag="BAB_RS27530"
                     /old_locus_tag="BAB2_0242"
                     /db_xref="GeneID:3828102"
     CDS             complement(238120..238782)
                     /locus_tag="BAB_RS27530"
                     /old_locus_tag="BAB2_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfoxide reductase heme-binding subunit YedZ"
                     /protein_id="WP_002965660.1"
                     /db_xref="GI:489055510"
                     /db_xref="GeneID:3828102"
                     /translation="MAAATGTRKKKTPRPGQWKLWLLYTAGFVPAVWTFYLGATGQLG
                     ADPVKTFEHLLGLWALRFLILTLLVTPIRDLTGITLLRYRRALGLLAFYYALMHFTTY
                     MVLDQGLNLSAIITDIVRRPFITIGMISLALLVPLALTSNNWSIRKLGRRWSSLHKLV
                     YIAIAGSAVHFLMSVKSWPAEPVIYAAIVAALLLWRLARPYLRTRKPALRPRGEAIAL
                     RK"
     gene            complement(238784..239743)
                     /locus_tag="BAB_RS27535"
                     /old_locus_tag="BAB2_0243"
                     /db_xref="GeneID:3828103"
     CDS             complement(238784..239743)
                     /locus_tag="BAB_RS27535"
                     /old_locus_tag="BAB2_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfoxide reductase catalytic subunit YedY"
                     /protein_id="WP_002965661.1"
                     /db_xref="GI:489055511"
                     /db_xref="GeneID:3828103"
                     /translation="MSSFKPSRFSTARLTGDAVTPKSIYLRRREFMIGLGAIAATGAA
                     SSAFADPLEAKTTAYKVDEKLTPQNAVTTYNNFYEFGTDKSDPSANSGSFKPLPWKLT
                     VDGLVKQPKEFDVEELIAKMPLEERIYRMRCVEAWSMVIPWIGFPLSSLLSQVEPLGS
                     AKYIAFTGVVRPDEMPGQTGLFQALNWPYVEGLRLDEAMHPLTILSVGLYGETLPNAN
                     GAPIRLVVPWKYGFKGIKAITRISFVEKQPPTSWNRQAANEYGFYANVNPAVDHPRWS
                     QATERRIGEGGFFGSDRRPTLPFNGYGEEVASLYAGMDLKANY"
     gene            240148..241032
                     /locus_tag="BAB_RS27540"
                     /old_locus_tag="BAB2_0244"
                     /db_xref="GeneID:3828104"
     CDS             240148..241032
                     /locus_tag="BAB_RS27540"
                     /old_locus_tag="BAB2_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_002965662.1"
                     /db_xref="GI:489055512"
                     /db_xref="GeneID:3828104"
                     /translation="MVKKMFMAVLAAAALMISAGLYLAEEQPVVAVKAQNRAANAIAA
                     SMKEDKSAPKLGEGMTMREKKKMDTDVTPEQNFSRSKQFIYRFYKPENASNELIVLLH
                     GSGGNETSLVPLATKIWPRATLLGIRGRVMQDGDTRWYRRITPVKFDQKDVKLEANAF
                     VTFLTRLADNKDLDLAHATFVGYSNGANLLAATMLLHPDLVKRAVLMRSMPVLDDAPV
                     ANLGKAHVLTIAGEHDKLYSPYAPALSAILRASGARVDARTIDADHMLGEKDIATIRQ
                     WVDSLGPDGGPTVSMKAR"
     gene            complement(241181..242155)
                     /locus_tag="BAB_RS27545"
                     /old_locus_tag="BAB2_0245"
                     /db_xref="GeneID:3828105"
     CDS             complement(241181..242155)
                     /locus_tag="BAB_RS27545"
                     /old_locus_tag="BAB2_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965663.1"
                     /db_xref="GI:489055513"
                     /db_xref="GeneID:3828105"
                     /translation="MPTVAPFDLEGHCLYARFIGGIPFFAMADGAVHRLDDGHQTSTV
                     HDGLLSAAMAVDGKSLVTGGEDGRVCRIDAKGVVTELANIPRKWITAVATGPNGTVGF
                     ASGKTAWSRAADGKVQEFTQERSVEGIAFAPKGQRLAIARYNGATLIWTGTAAKPVEL
                     EWKGAHIGITFSPDGRFLITSMQENALHGWRLEDNKHMRMTGYPAKVKDWSWSAKAKW
                     LATSGAPAAIVWPFAGKDGPMGKAPLELGLRGDSMVTSVACHPGEDIAAIGYNDGMIL
                     IVRFADQKEVLLRRPGKGAITSMAWDEDGYRLVFGSQAGDCGVVPLNE"
     gene            complement(242274..243413)
                     /locus_tag="BAB_RS27550"
                     /old_locus_tag="BAB2_0246"
                     /db_xref="GeneID:3828106"
     CDS             complement(242274..243413)
                     /locus_tag="BAB_RS27550"
                     /old_locus_tag="BAB2_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002969291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="WP_002969291.1"
                     /db_xref="GI:489059220"
                     /db_xref="GeneID:3828106"
                     /translation="MAEAEATATTEAGRIPVTVLTGYLGSGKTTLLNRILTENHGKRY
                     AVIVNEFGEIGIDNDLIVESDEEIYEMNNGCICCTVRGDLIRVVEGLMRRPGRFDAIV
                     VETTGLADPVPVAQTFFMDDDVRAKTGLDAVVALVDAKHLPLRLKDSREAEDQIAFAD
                     VVLINKTDLVTPEELAAVEATVRAINPHAIIHRTERASIPLDRVLDRGAFDLKRVLDN
                     DPHFLDHDDPDHVCCPDCDHDHHHQGHHHHGHDHHHHDHHDHDHVCGPDCDHDHDHDH
                     ASPIHDVTVKSVSLRTGEIDPAKFFPWIQNITQTQGPNILRLKGIIAFKDDPDRYVVQ
                     GVHMIIEGDHQRAWKPEEKHESRLVFIGRELDPAALKAGFENCRA"
     gene            complement(243649..244419)
                     /locus_tag="BAB_RS27555"
                     /old_locus_tag="BAB2_0247"
                     /db_xref="GeneID:3828107"
     CDS             complement(243649..244419)
                     /locus_tag="BAB_RS27555"
                     /old_locus_tag="BAB2_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="creatininase"
                     /protein_id="WP_002965665.1"
                     /db_xref="GI:489055515"
                     /db_xref="GeneID:3828107"
                     /translation="MTDLRDQNSDMIVVLPLGAHEQHGPHLPFETDTIIVEGIVARVS
                     DALPADLNVNFLPAQPVGYSIEHMDTKGTQSLAFAEAVNQWIAIGENLHAGGIRKLVM
                     LNAHGGNSPLMTIVATELRTRLDMLAVATSWTRFGLPEGLITPEEKALDIHGGFIETS
                     VMLALRPDLVDMAKARNFPNAQSQFAEEFKYLRAYGPHAFGWKMHDLNPDGVAGNAIA
                     ASAQAGEKLLAHAVSGFIDLLRDVDRFELARFNPKVMA"
     gene            244598..244825
                     /locus_tag="BAB_RS27560"
                     /old_locus_tag="BAB2_0248"
                     /db_xref="GeneID:3828108"
     CDS             244598..244825
                     /locus_tag="BAB_RS27560"
                     /old_locus_tag="BAB2_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_002972130.1"
                     /db_xref="GI:489062103"
                     /db_xref="GeneID:3828108"
                     /translation="MSKDNKAVVLYRLQSVARLTRTVLAARLLEQGLYAGQDAVMLQL
                     AAEDGLTPGILAQRLGVRPPTITKTITRLQG"
     gene            244832..245089
                     /locus_tag="BAB_RS27565"
                     /old_locus_tag="BAB2_0249"
                     /db_xref="GeneID:3828109"
     CDS             244832..245089
                     /locus_tag="BAB_RS27565"
                     /old_locus_tag="BAB2_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006214243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_002969292.1"
                     /db_xref="GI:489059221"
                     /db_xref="GeneID:3828109"
                     /translation="MVKRASETDQRQSHVYLTQAGLQTIKAIEKSIRKTEKDMLKGLD
                     KKDRKSLLKMLSRMEGNLVLRGAARVADEPETEPQEDDEAE"
     gene            245236..246255
                     /locus_tag="BAB_RS27570"
                     /old_locus_tag="BAB2_0250"
                     /db_xref="GeneID:3828110"
     CDS             245236..246255
                     /locus_tag="BAB_RS27570"
                     /old_locus_tag="BAB2_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014517421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002965667.1"
                     /db_xref="GI:489055517"
                     /db_xref="GeneID:3828110"
                     /translation="MAQKIKLSTIADALGVSTATVSLALRDSPLVADQTREKIKEHAR
                     AIGYIYNRRAASLRTSRSGIVGVVVRDIMNPFFAEILKSIETELDRSRQTFILSNHYD
                     QLDKQRTFMDTLLQLGADGVIMSPAIGTPAEDIQLAEDNGLPVVLIARSVEGVHAPVF
                     RGDNAYGIGLATNHLISLGHTRIAMIGGTDQTSTGRDRYRGYVQAMEKAGLEVRPDWR
                     IPGSRTKQGGFEVAPQFLALKDKPTAAVCWNDLTAIGLMNGIARAGLVPGEDISVTGY
                     DDLEEAAIATPALTTVWNGQREVGRRAARALLDQLNGVEVSSTQELIRPELHIRQSTS
                     KPKHA"
     gene            246341..247315
                     /locus_tag="BAB_RS27575"
                     /old_locus_tag="BAB2_0251"
                     /db_xref="GeneID:3828111"
     CDS             246341..247315
                     /locus_tag="BAB_RS27575"
                     /old_locus_tag="BAB2_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012219778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_002965668.1"
                     /db_xref="GI:489055518"
                     /db_xref="GeneID:3828111"
                     /translation="MTKRDTTILVLGNFDDYAVQRLSDEFNVQRMARGDTALLGSDWV
                     KDVKGIASMSKVSADLIDALPNLEIIGNFGVGYDAVDARHAGANNVMVTNTPDVLTEE
                     VADTTIGLLIDTVRELSKAQEFLRRGEWGKQVRYPLSKLSLRGRKVGIFGLGRIGKAV
                     ARRIEAFGLPIAYHNRRKAADVAYDYYPSLKELAGAVDTLILVAPGGAETTRAVNTEV
                     LQALGPEGVLINIGRGSVVDEEALAQALKDGTIAAAGLDVFANEPHVPQALLDAPNTV
                     LLPHIGSASVKTRRAMADLVVDNLIAWFDTGTAITPVPETVGVKAVRQ"
     gene            complement(247401..248174)
                     /locus_tag="BAB_RS27580"
                     /old_locus_tag="BAB2_0252"
                     /db_xref="GeneID:3828112"
     CDS             complement(247401..248174)
                     /locus_tag="BAB_RS27580"
                     /old_locus_tag="BAB2_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_002965669.1"
                     /db_xref="GI:489055519"
                     /db_xref="GeneID:3828112"
                     /translation="MNPNIKKSSRPLVAVPTDVKPFENYVWHAAPEQYLAAAIEVAQV
                     TPLLVPSFGDKMDFDAILDAVDGLLVTGSKSNVHPSLYGVEPSEAFEPYDDARDATSL
                     PLIRAAIEKGVPVLAICRGLQELNVALGGTLATEIQGLAGRMDHRATDPESQAERFAI
                     RHPVKLNPNSCLAEILKEESVRVNSVHRQAIDKLAPRLEVEAVAEDGTVEAVSGKNAR
                     GFVVGVQWHPEYWVQSDAPSRRIFEAFGDAVREHRAVGQ"
     gene            248409..249158
                     /locus_tag="BAB_RS27585"
                     /old_locus_tag="BAB2_0253"
                     /db_xref="GeneID:3827534"
     CDS             248409..249158
                     /locus_tag="BAB_RS27585"
                     /old_locus_tag="BAB2_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="WP_002965670.1"
                     /db_xref="GI:489055520"
                     /db_xref="GeneID:3827534"
                     /translation="MTDDQLFSVRGKVIAVTGGSSGLGLRMVHVLAGHGARVISISRT
                     HAGESLCPSGGEVLEIMADVTRPEEIARAFDEGESRFGPISALFNNAGVAHMARALDT
                     TRDMLEHIFEVNVAGAFFTAQEVARRMIAQGQGGSIINVTSILGERPQKGAAAYSMSK
                     ACVSQMTRALALEWAAHDIRVNAISPGWFPTRINEEQLQGPAAGYLKGRNPMRRLGDP
                     NDLDGVVLLLASDASRYMTGSIITVDGGHQL"
     gene            249524..251323
                     /locus_tag="BAB_RS27590"
                     /db_xref="GeneID:23672515"
     CDS             249524..251323
                     /locus_tag="BAB_RS27590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006122299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_002967205.1"
                     /db_xref="GI:489057082"
                     /db_xref="GeneID:23672515"
                     /translation="MWRSRKPEIPADVRLSFLRALYGNRTTLWFGLLAHVVACVVIYV
                     KTADWHFLGFAGIFTFVAFGRLYDMHKFDQAKLTAISHDDLDKWEAHYLIGASLVCAT
                     LGMLCFFSSYVLRDAFAELASLTVLLASVVSIVGRNYASAKAVILMSVCTLMPVLAGL
                     ILAGTPFHIIIGLLLIPYFLSNIQMANGLREFLFAAVMGKRRLSIVAGRFDAALNNMP
                     QGLLMFDGEQRIAVINNKAKAMMRIAEHTKLHGRKLEVLLRYCVKQGLFPHNDLTNIR
                     LRMEDILMGRKARDIFQLSDRRYIECIGNQTVSSGAVMMFEDVTQRVESEARIQHMAR
                     FDGLTGLPNRNYFETMMRSLRPHQDQNSKVALIVIDINHFKHVNDTLGHHTGDVLLRL
                     FSERLNSLDPQRYVASRFGGDEFVIFVFNLHDSSEVNGMMEHIISAVTGVYDLDGAQV
                     DIDISAGVAIEDIDKCDVGNMHIKADLALYEAKGEENRQWAAFVGAMDTKYRSRQKLK
                     ADLRQAVAQREIHVAYQPIVSAQSLRIVACEALARWNHAELGLVPPAEFIPLAEEIGL
                     ISEITRFMLEQACMDCLSWATRSLCRSICRPSI"
     gene            251266..251820
                     /locus_tag="BAB_RS27595"
                     /db_xref="GeneID:23672516"
     CDS             251266..251820
                     /locus_tag="BAB_RS27595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_002972129.1"
                     /db_xref="GI:489062102"
                     /db_xref="GeneID:23672516"
                     /translation="MPVLGDKIVVSVNLSAIDLKNNDIARDIAYALEKSGLPAHRLEV
                     EVTESAIIADRNKTSLVLQRLKNAGINIALDDFGTGYSSLSYLNTLPLTKVKVDRSFV
                     RDITSDRRSLMLLRGVTQLSHELGRGVTVEGVETEEQLALIRVAAGADLVQGYLFGMP
                     LPTEEISVLTAKSMVRRAGGRTVA"
     gene            252073..253290
                     /locus_tag="BAB_RS27600"
                     /old_locus_tag="BAB2_0257"
                     /db_xref="GeneID:3827538"
     CDS             252073..253290
                     /locus_tag="BAB_RS27600"
                     /old_locus_tag="BAB2_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-aminohexanoate-dimer hydrolase"
                     /protein_id="WP_002969293.1"
                     /db_xref="GI:489059222"
                     /db_xref="GeneID:3827538"
                     /translation="MKRLFRFALYLCVALIIFAGAGTVIFWKKINEYWAVYQYAQVFK
                     PDTINENFRSLYKKYPSVRVPHTGEVSPLPRGEQPLPETYTYKGETRKVADWLERTDT
                     TGFIVLKDGVVVHEQYERGNSETTQSIAMSLSKSFVSFLVGNAVRDGQIKLDQTVDHY
                     APLLKEGGYKEVTVKNVLQMSSGIGFNENYGDLNSDIVRYIVQMLTGSVDDFTAKLKN
                     EVPQGTINHYVSADTQVLAMVLEGATGVPFQKYFEDKLWSRLGAEADAYWLTDEKGDV
                     VAAGGLNAVLRDYARFGLLYMNEGRNYRGEQLVPAQWVHDSVTPDQPYLMPGRKDALG
                     KIPFGYGYQWWIPVEPEGDFCAVGIYGQFIYVNPAKHVVIAKTSAYPNYNIDGQKVKD
                     ESMYVFQAIANAL"
     gene            253562..254308
                     /locus_tag="BAB_RS27605"
                     /old_locus_tag="BAB2_0259"
                     /db_xref="GeneID:3827540"
     CDS             253562..254308
                     /locus_tag="BAB_RS27605"
                     /old_locus_tag="BAB2_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006178668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_002965673.1"
                     /db_xref="GI:489055523"
                     /db_xref="GeneID:3827540"
                     /translation="MTNRAVTGENPPLSNFARQLLQFLDRVEYRRIVHAEDLEEIGRL
                     RYRSYRTRNVMHEAEVPSIVDDIDRDSHAFVYGVHVDGQLVSTLRVHHITPDHRRGTS
                     YALFPDILDPLLNSGMHFVDPTRFAADPDLLSEYPAIPYITLRVAAMASEFFGADQCL
                     AAVKPEHMAFYKRIFGTTVMADAREHEGYGIKVGLGAAPIRNIRDAVAVRYPFFKSQP
                     HERRAMFADMHAGVVPLTILPTAKYTGLGA"
     gene            254512..254736
                     /locus_tag="BAB_RS27610"
                     /old_locus_tag="BAB2_0260"
                     /db_xref="GeneID:3827541"
     CDS             254512..254736
                     /locus_tag="BAB_RS27610"
                     /old_locus_tag="BAB2_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002965674.1"
                     /db_xref="GI:489055524"
                     /db_xref="GeneID:3827541"
                     /translation="MAEHHTTAPAELGAPMDYAEHEKTYAGFAGLVKWATVVLVALMI
                     AMAFGFFAGGFFSATVLFVLVCVVAWFLLS"
     gene            254960..256237
                     /locus_tag="BAB_RS27615"
                     /old_locus_tag="BAB2_0261"
                     /db_xref="GeneID:3828048"
     CDS             254960..256237
                     /locus_tag="BAB_RS27615"
                     /old_locus_tag="BAB2_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_002967206.1"
                     /db_xref="GI:489057083"
                     /db_xref="GeneID:3828048"
                     /translation="MAQTLYIPKESDPNETRVAGSAETVKKFIALGFDVVVEKGAGEK
                     SRIPDAEFAAAGARIGTAVDAKTADVILKVRRPGDAELKAYKSGAALFAMLDPYGHED
                     AVAALARAGISAFTMEFMPRITRAQVMDVLSSQANLAGYQAVIDAAEVYDRAMPMMMT
                     AAGTVPAAKVFVMGAGVAGLQAIATARRLGAVVTATDVRPAAKEQVASLGAKFIAVED
                     DEFKAAETAGGYAKEMSKDYQAKQAALVADHIAKQDIVITTALIPGRPAPRLVSKEMV
                     ASMRPGSVLVDLAVERGGNVEGAVPGEIADVNGVKIVGYLNVPGRIAASASQLYARNL
                     IAFVETLVDKESKVLKIDPEEGLVKATLLTHQGRILHPAFAKAETAPAAVTEKAEKPK
                     AAPKAAAKPAKKAPAKAAKKPSSPKSPVDGGEA"
     gene            256237..256656
                     /locus_tag="BAB_RS27620"
                     /old_locus_tag="BAB2_0262"
                     /db_xref="GeneID:3828049"
     CDS             256237..256656
                     /locus_tag="BAB_RS27620"
                     /old_locus_tag="BAB2_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_002965676.1"
                     /db_xref="GI:489055526"
                     /db_xref="GeneID:3828049"
                     /translation="MADTNLDKALEGLNQAADAVRQAAENAGGFGDAAAAAAHAASGG
                     AIDPFIFRFAIFILSIFVGYYVVWSVTPALHTPLMAVTNAISSVIVVGALLAVGLSLS
                     GWATGFGFIALILASVNIFGGFLVTQRMLAMYKKKEK"
     gene            256669..258069
                     /locus_tag="BAB_RS27625"
                     /old_locus_tag="BAB2_0263"
                     /db_xref="GeneID:3828050"
     CDS             256669..258069
                     /locus_tag="BAB_RS27625"
                     /old_locus_tag="BAB2_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_002965677.1"
                     /db_xref="GI:489055527"
                     /db_xref="GeneID:3828050"
                     /translation="MSVNLAAFLYLVSGVLFILALRGLSHPTTSRQGNMYGMIGMAIS
                     IVTTLLLARPSFGGLVLIIVGIAIGGGIGAVIARRIAMTAMPQLVAAFHSLIGLAAVL
                     VAAAALYSPHSFGIGEVGQIHGQALIEMSLGVAIGAITFTGSIIAFLKLDGRMSGKPI
                     MLPGRHVINAALAAAIVLLIVVLTNTESHFVFWLIVLLSLVFGVLIIVPIGGADMPVV
                     VSMLNSYSGWAAAGIGFTLGNLALIITGALVGSSGAILSYIMCKGMNRSFISVILGGF
                     GGDTSSAAGGEVEQRPVKQGSADDAAFILKNASKVIIVPGYGMAVAQAQHALREMADK
                     LKAEGVEVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINSEFATADVAFVIGA
                     NDVTNPAAKTDPKSPIFGMPILDVDKAGTVLFIKRGMGSGYAGVENELFFRDNTMMLF
                     ADAKKMVESIVKALDH"
     misc_feature    258073..258157
                     /note="23S ribosomal RNA 16S or 23S rRNA prediction is too
                     short"
     gene            complement(258171..259487)
                     /locus_tag="BAB_RS27630"
                     /old_locus_tag="BAB2_0264"
                     /db_xref="GeneID:3827542"
     CDS             complement(258171..259487)
                     /locus_tag="BAB_RS27630"
                     /old_locus_tag="BAB2_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_002965678.1"
                     /db_xref="GI:489055528"
                     /db_xref="GeneID:3827542"
                     /translation="MTTNVALVGLARDLAARAETGKPIRIGLIGAGEMGTDIVTQVAR
                     MQGIEVGALSARRLPNTFKAIRTAYGDEENAREATTESAMTRAIEAGKIAVTDDNDLI
                     LSNPLIDVIIDATGIPEVGAETGIAAIRNGKHLVMMNVEADVTIGPYLKAQADKQGVI
                     YSLGAGDEPSSCMELIEFVSALGYEVVSAGKGKNNPLNFDATPDDYRQEADRRNMNVR
                     LLVEFIDGSKTMVEMAAIANATGLVPDIAGMHGPRASIDQLSHTLIPQAEGGVLSKSG
                     VVDYSIGKGVSPGVFVVAKMDHPRLNERLEDLKIGKGPYFTFHRPYHLTSLEVPLTVA
                     RVVLHGKTDMVPLPKPVAEVCAVAKKDMQPGEHLDAIGQYCYRSWIMTVPEARAAKAI
                     PCGLLQNGTVIAPIKKGELITYANAAPQPGSRIAELRALQDAMLGQ"
     gene            259683..260354
                     /locus_tag="BAB_RS27635"
                     /old_locus_tag="BAB2_0265"
                     /db_xref="GeneID:3827543"
     CDS             259683..260354
                     /locus_tag="BAB_RS27635"
                     /old_locus_tag="BAB2_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_002965679.1"
                     /db_xref="GI:489055529"
                     /db_xref="GeneID:3827543"
                     /translation="MNSAYPFDLFIFDCDGVLVDSEPLSCRAFEQVYADYGMALPEGT
                     VAQGIGMKQADIMQMIEDMTGYRLPEEAGAAFWPATRTLFAQALQPTVGIADFLRDLP
                     QKRCVASSSQPERIAFSLQKTGLDQYFGDAVYSSSMVKRGKPAPDLFLFAADKMGVDP
                     ARCVVIEDSPFGIEGAVAAGMTAFGYTGGGHSYDGHAEKLMAKGARQVFAHWDEMVRE
                     ILAAA"
     gene            260429..260905
                     /locus_tag="BAB_RS27640"
                     /old_locus_tag="BAB2_0266"
                     /db_xref="GeneID:3827544"
     CDS             260429..260905
                     /locus_tag="BAB_RS27640"
                     /old_locus_tag="BAB2_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein NodN"
                     /protein_id="WP_002965680.1"
                     /db_xref="GI:489055530"
                     /db_xref="GeneID:3827544"
                     /translation="MKNAITLDQLRESIGTEIGCSEWREVTQEMINQFADATDDHQFI
                     HVDPERAAKETPFGGTIAHGFLTLSLLSTLAYEALPMLEGATMGINYGFDKLRFVSPV
                     KTGARVRARFKLADADIRPSGRVVNHYDVTLEIENSLKPALTATWLIITMVEPPEA"
     gene            complement(260980..261879)
                     /locus_tag="BAB_RS27645"
                     /db_xref="GeneID:23672517"
     CDS             complement(260980..261879)
                     /locus_tag="BAB_RS27645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006218996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968831.1"
                     /db_xref="GI:489058748"
                     /db_xref="GeneID:23672517"
                     /translation="MNILLTGTLWRYLTTSWRFVMFFLWPFLLSLVILGVAGLIVAAP
                     LIAGFSAIHLIWSVPLAAFIATLLVRKPGDRFFMSYLLDDWSAAYDRIHGRNEKLNQR
                     RKAFAEALKRKIEASDADEIVIVAHSLGTVPAIKALADLQRERPDLLARKPVSLLAIG
                     SCLMMIALHPKAKSLREDVRVVMQESPVLWSEFQVLTDIIHFYGCDPARALKIKTANP
                     PLIHRIRFKNVHSENRYKRSKGNFFLMHLLYMRGAEKKNFYDFGMFLHGPFFFRDLMT
                     THHGKAAPLDEEGRLPEDYPEAA"
     gene            complement(261876..262175)
                     /locus_tag="BAB_RS27650"
                     /db_xref="GeneID:23672518"
     CDS             complement(261876..262175)
                     /locus_tag="BAB_RS27650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005974977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972127.1"
                     /db_xref="GI:489062100"
                     /db_xref="GeneID:23672518"
                     /translation="MLLLKRLVIQFTGYEGLHPKAVRVRHAQALKDFDRLWNARTRLP
                     PMQDEPNDCGTLAATTQGNGWRTETEFCQFGTADIFDDYAARTTPKRMLTGFAPS"
     gene            262528..262755
                     /locus_tag="BAB_RS27655"
                     /old_locus_tag="BAB2_0269"
                     /db_xref="GeneID:3827547"
     CDS             262528..262755
                     /locus_tag="BAB_RS27655"
                     /old_locus_tag="BAB2_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P66515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_002965682.1"
                     /db_xref="GI:489055532"
                     /db_xref="GeneID:3827547"
                     /translation="MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRA
                     REKAEAVRRARKLARKRAQREGLIGGRTGAR"
     gene            263289..264176
                     /locus_tag="BAB_RS27660"
                     /old_locus_tag="BAB2_0271"
                     /db_xref="GeneID:3827549"
     CDS             263289..264176
                     /locus_tag="BAB_RS27660"
                     /old_locus_tag="BAB2_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlcNAc transferase"
                     /protein_id="WP_002965683.1"
                     /db_xref="GI:489055533"
                     /db_xref="GeneID:3827549"
                     /translation="MLQLAMRLKVMQLSETEVSGIEASGGAGRNGLIIAAALLALTVA
                     GCQSTNSTLSTVDRAQGSSENISSLTSVIQSNPRDPEGYNVRGSAYGKAGRYKEAMRD
                     FDQAIALNPNFYQAYANRALVDRYMGDNNKAVQDYSRAIQLNPQYDAAYIGRGNVYRQ
                     AGHLDQALNDFNQAIALRTTDGRAYHNRGLIYQAKGLHKQAIEDFSKAISLNSTAPEP
                     YNGRGISYVALGDYDNAFDDFNTAITLDQNVAESWANQALVYEHNGDKAKAANSYARA
                     VQLDPKYKPAKDGLARTRG"
     gene            264268..264675
                     /locus_tag="BAB_RS27665"
                     /old_locus_tag="BAB2_0272"
                     /db_xref="GeneID:3827550"
     CDS             264268..264675
                     /locus_tag="BAB_RS27665"
                     /old_locus_tag="BAB2_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_002965685.1"
                     /db_xref="GI:489055535"
                     /db_xref="GeneID:3827550"
                     /translation="MSLFDHIGFKARDINRSLSFYESCMPELGLDVIARSGSGFFVSG
                     GERAPVPFLWIYGGDPAGEHGEDRPGDRLHLMFTAGSREEVEAFYKAAIRAGGKDSGS
                     PSYQGPEEMGYYAALVFDPDGNTLEAGFRERKR"
     gene            complement(264688..265353)
                     /locus_tag="BAB_RS27670"
                     /old_locus_tag="BAB2_0273"
                     /db_xref="GeneID:3827551"
     CDS             complement(264688..265353)
                     /locus_tag="BAB_RS27670"
                     /old_locus_tag="BAB2_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_002965686.1"
                     /db_xref="GI:489055536"
                     /db_xref="GeneID:3827551"
                     /translation="MSQAMLDLLWRSFWETIIMTGFSSLISLVVGLPLALIMILTERG
                     GLAQNLTLNTILGAIINGFRSVPFIILLVALIPVTRFIVGTSIGTWASIVPLSIAAIP
                     YYARIAEVSLREVDHGLIEAARSMGANRWTIVREVLIPEALPGIIAGFTVTVITLIGA
                     SAMAGAIGAGGLGDLAIRYGYQRFETQVMIAVVIILIIMVCGIQWVGDRLVNRLDKRN
                     LRA"
     gene            complement(265334..266392)
                     /locus_tag="BAB_RS27675"
                     /old_locus_tag="BAB2_0274"
                     /db_xref="GeneID:3827552"
     CDS             complement(265334..266392)
                     /locus_tag="BAB_RS27675"
                     /old_locus_tag="BAB2_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_002965687.1"
                     /db_xref="GI:489055537"
                     /db_xref="GeneID:3827552"
                     /translation="MTIEKPPATSAPIVEMKDVRRMFGETAAINGVSLSVARGEILGI
                     IGRSGAGKSTLIRCVNGLEKPDTGSIHIEGREITSLDEDALRPVRRRIGMVFQHFNLL
                     SAKTAAQNIALPLKIAGMPKAERIKRVAELLELVGLSDKASHYPAQLSGGQKQRVGIA
                     RALAAEPAVLLSDEATSALDPETTQSILALLKDINAKLGLTILLITHEMDVIRRIADR
                     VIVLDHGLIAEEGPVWKVFANPQSPVTQSMLQVLTPELPAIWRNRLEKKGDQAILRVK
                     LSGMAAKGAFFNDVAAATSLAPQLIHGGMDTIQGEPVGTLFIGLPAEDKTKLKAAIGY
                     LNTHADATEVLGYVSGNA"
     gene            complement(266857..267693)
                     /locus_tag="BAB_RS27680"
                     /old_locus_tag="BAB2_0275"
                     /db_xref="GeneID:3827553"
     CDS             complement(266857..267693)
                     /locus_tag="BAB_RS27680"
                     /old_locus_tag="BAB2_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002967209.1"
                     /db_xref="GI:489057086"
                     /db_xref="GeneID:3827553"
                     /translation="MSSVLSRYALTRRAGLKALLFTAAALTVGFASAPSHAEDKTIKV
                     GIMGGEDEDVWKVVAEEGKKHGLNIERITFNDYNQPNETLERKEIDANAFQHKPYLDE
                     QIKQHGYKISVAGYTAVWPIGIYSRKVKKLEELKDGATVGVPNDPTNEGRALRVLEEQ
                     GLIKLKPDAGILATPIDIVENPKKLEIKELDAGVVGRSIDDLDAAIVNNDWAAKAGLK
                     KEDAIGWESKENNPYNNFIAVRTDDLDQPWVKALVASFQNDAVKTELERAYKGTGIPA
                     WN"
     gene            complement(267927..269525)
                     /locus_tag="BAB_RS27685"
                     /old_locus_tag="BAB2_0277"
                     /db_xref="GeneID:3827764"
     CDS             complement(267927..269525)
                     /locus_tag="BAB_RS27685"
                     /old_locus_tag="BAB2_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase"
                     /protein_id="WP_002965689.1"
                     /db_xref="GI:489055539"
                     /db_xref="GeneID:3827764"
                     /translation="MTDTYDYIVVGAGTAGCALANRLSADQNRSVLLLEAGGKDNYAW
                     IHIPVGYLYCIGNPRTDWCFTTEAEPGLNGRSLNYPRGKVLGGCSSINGMIYMRGQAC
                     DYDLWRQAGCDGWGWDDVLPLFKKSEDYFAGASALHGMGGEWRVENARLHWDILDAFR
                     DAALAAGIPATDDFNRGDNEGVSYFKVNQKHGIRWNTAKAFLRPALDRKNLTVETGAH
                     VRCIEIEGLRATGVTFDQDGNIRTVKARREVILAAGAVGSPQILELSGIGRGDVLQQA
                     GIPLKLERRQLGENLQDHLQLRCAYKVTGIATLNEKASTLVGKAMIGLEYLLRRSGPM
                     AMAPSQLGVFTRSDPSYETANLQYHVQPLSLEKFGDAVHPFPTFTASVCNLRPESRGS
                     IHIKSPDHRAQPAIRPNYLATETDRRIAADAIRLTRHIVSQAPLQKYRPEEFKPGPNY
                     ATQEDLEKAAGDIGTTIFHPVGTCRMGQDAEAIVDPRLRFNGIAGLRVADASIMPAIT
                     SGNTNSPTLMIAEKAAQMIIADNR"
     gene            complement(269589..270572)
                     /locus_tag="BAB_RS27690"
                     /old_locus_tag="BAB2_0278"
                     /db_xref="GeneID:3827765"
     CDS             complement(269589..270572)
                     /locus_tag="BAB_RS27690"
                     /old_locus_tag="BAB2_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965690.1"
                     /db_xref="GI:489055540"
                     /db_xref="GeneID:3827765"
                     /translation="MVDTTLKANAAYSKAPALNSLSAIVLGIALVGLIAAPFMVYPIF
                     LMKMLCFALFASAFNLLLGYTGILSFGHAAFFGGAAYVTAHAVKEWGVSPELGLVLGI
                     LAAAALGLVIGYLAIRRQGIYSTMITLALAQMFFFFCLQASFTHGEDGLQGVPRGFLF
                     GFIDLNQPMNMYYFVLAVFVLGVFAIWRITNSPFGMILKSVRENENRAISLGFSVNHY
                     KLAAFVMSAGLAGLAGGMKALVFQFATLTDVSWQMSGEVILMTLLGGIGTLIGPIVGA
                     AFVVALQNWLATSDFPVTIVTGLIFMACVLLFRKGIIGEFYASRIGKKLFG"
     gene            complement(270574..271461)
                     /locus_tag="BAB_RS27695"
                     /old_locus_tag="BAB2_0279"
                     /db_xref="GeneID:3827766"
     CDS             complement(270574..271461)
                     /locus_tag="BAB_RS27695"
                     /old_locus_tag="BAB2_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965691.1"
                     /db_xref="GI:489055541"
                     /db_xref="GeneID:3827766"
                     /translation="MVMIFGIPLQALLGQLLVGLINGSFYAMLSLGLAIIFGLLRIIN
                     FAHGAQYMLGAFVGYLLLSWLGISYWPALVLAPLIVGLGGAIIERVALSRLYNLDPLY
                     GLLFTFGLALVIEGTFRYYYGAAGQPYAVPPSLAGGRNLGFMFLPNYRAWVVVASLFV
                     CLGTWLLIEKTKLGAYLRAATENPTLVKAFGINVPLLLTFTYALGSALAGLAGIMAAP
                     IYQVSPLMGSNIIIVVFAVVVVGGMGSILGAIITGYVLGIAEGLTKVFYPEASSIVVF
                     VIMAIVLLVRPAGLFGKEA"
     gene            complement(271466..272191)
                     /locus_tag="BAB_RS27700"
                     /old_locus_tag="BAB2_0280"
                     /db_xref="GeneID:3827767"
     CDS             complement(271466..272191)
                     /locus_tag="BAB_RS27700"
                     /old_locus_tag="BAB2_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_002969295.1"
                     /db_xref="GI:489059224"
                     /db_xref="GeneID:3827767"
                     /translation="MNKRQPLLSVRGLYAWYGESHALQGVDLDIWPGETITLLGRNGV
                     GKTTTLRAIMGIIRKRTGTITLDGKDIMRVPLHRIAYEGLGFVPEERGIFASLNVHEN
                     LLLPPVVAKGGGSQGAMSLDEIYELFPNLYERRNSPGTKLSGGEQQMLAIARILRTGV
                     KVLLLDEPTEGLAPVIVQRIGDVLVELKKRGMTVLLVEQNFRFAAKVADRFYLMDHGV
                     VTDNFPTTELPARMAALTQALGV"
     gene            complement(272184..272999)
                     /locus_tag="BAB_RS27705"
                     /old_locus_tag="BAB2_0281"
                     /db_xref="GeneID:3827768"
     CDS             complement(272184..272999)
                     /locus_tag="BAB_RS27705"
                     /old_locus_tag="BAB2_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_002965694.1"
                     /db_xref="GI:489055544"
                     /db_xref="GeneID:3827768"
                     /translation="MNTASGAIPVLHEAGPGTSQTASGIVLSARGLGKSFGGFHAVKN
                     VDLDVEHARVHALIGPNGAGKTTVFNLLTKFLQPTSGEITLLGETITKTDPARVARKG
                     LVRSFQISATFPHLTVLENVKVALQRPNGLATQFWRSLSALDRLDAQAVELLERVGLA
                     DARHALAADLSYGRKRALEIATTLALDPKVLLLDEPLAGMGHEDVHTIAALITDVAKD
                     RAVLMVEHNLKVVADIAHHVTVLQRGEILASGDYATVSKDERVRTAYMGTEHE"
     gene            complement(273012..274217)
                     /locus_tag="BAB_RS27710"
                     /old_locus_tag="BAB2_0282"
                     /db_xref="GeneID:3827769"
     CDS             complement(273012..274217)
                     /locus_tag="BAB_RS27710"
                     /old_locus_tag="BAB2_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965695.1"
                     /db_xref="GI:489055545"
                     /db_xref="GeneID:3827769"
                     /translation="MKCLALATAALLAATAFSSAAEISDGKVKIGILNDQSGVYADFG
                     GKWSYEAAKMAAEDFGGTVLGAPIEIITADHQNKPDVASNIARQWYDTEQVDSIMELT
                     TSSVGLAVQALSKEKKKITINTGAATSELTGKQCTPYGFHWAYDTHALAVGTGGSLVQ
                     QGGDTWYFLTADYAFGYSLEEQTTKFVESKGGKVLGSVRHPLSTTDYSSFLLQAQASG
                     AKVVGLANAGLDTSNAIKQAAEFGIVAGGQRLAALLFTLAEVHGLGLEAAQGLTLTEG
                     FYWDRDDESRAFGKRFFDRTGRMPNMIQAGTYSAVLQYLKAIKEAGTDETEAVAKKLH
                     EMPVEDVFARHGKVGPNGRMIYDMYLMEVKKPEESKAPWDYYKVLATIPGDQAYMTPE
                     ESGCPLVKQ"
     gene            274482..275396
                     /locus_tag="BAB_RS27715"
                     /old_locus_tag="BAB2_0283"
                     /db_xref="GeneID:3827770"
     CDS             274482..275396
                     /locus_tag="BAB_RS27715"
                     /old_locus_tag="BAB2_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006095269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002972125.1"
                     /db_xref="GI:489062098"
                     /db_xref="GeneID:3827770"
                     /translation="MRPFTWDDLQYFLAVARTGQLSTAARQLRTSHVTVLRRIDRLEQ
                     ALSTKLFERNPRGYLLTPMGERLVEPAEVMEREAMKFQTEATGNLAALSGVVRLSTLE
                     GFGNFFLADRLPVLAQSYPSLFVEVVTIQQIMSLSRRETELSITLHMPRNGPYHSEKL
                     MPYRLFIYGHRDYLARHPPIRTREDMTGHPFIGYIDDMVFTPGLDYMREILPGQRCTY
                     QSSSIHAQLIATQTGYGLCVLPYFIASKYPELVPVLPREMHLVREYWMSCHVDVMAAP
                     RIRVISDFMIRAVRESSSMFLGELLLQP"
     gene            complement(275420..275509)
                     /locus_tag="BAB_RS27720"
                     /db_xref="GeneID:23672519"
     CDS             complement(275420..275509)
                     /locus_tag="BAB_RS27720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972124.1"
                     /db_xref="GI:489062097"
                     /db_xref="GeneID:23672519"
                     /translation="MKTLNPFIIGFGFTALVITCIFAMGGAIL"
     gene            complement(275612..276052)
                     /locus_tag="BAB_RS27725"
                     /old_locus_tag="BAB2_0284"
                     /db_xref="GeneID:3827771"
     CDS             complement(275612..276052)
                     /locus_tag="BAB_RS27725"
                     /old_locus_tag="BAB2_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002965697.1"
                     /db_xref="GI:489055548"
                     /db_xref="GeneID:3827771"
                     /translation="MRELDQKDREILAILSKEARIPLKTLAGRIGLSRSATGERVANL
                     EKSGVIRGYRADIGQIDSNIIRAMILVSLKRTPALGLLDELARHAEVRRVSSVSGQLD
                     LIVEVEVPTIDRLNRLRDVLATHETAEDLTTAIVLRRDIERENA"
     gene            276303..279374
                     /locus_tag="BAB_RS27730"
                     /old_locus_tag="BAB2_0285"
                     /db_xref="GeneID:3827772"
     CDS             276303..279374
                     /locus_tag="BAB_RS27730"
                     /old_locus_tag="BAB2_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967210.1"
                     /db_xref="GI:489057087"
                     /db_xref="GeneID:3827772"
                     /translation="MTDLSHPAPEFTTKDAERLAECHFGVSASASPLDSERDCNFRLK
                     VANGSVNGSAGSADWILKIVNASEPRVESEFQTALLQHLVDTNPAAAVPHLKPSLSGD
                     VLASAQGPDGKPHALRMASWLPGTPLAEGKRTKTLLKNLGRALGELDRALQGFIHPGA
                     LRDFDWDLRHAGRARERLHFIDKPEDRAVIEHFLARFERNVAPQLPFSRAQVIHNDAN
                     DWNVLVDDDDGERIAGLIDFGDAVHTVLIAEVAIACAYSILDMDDPIGAAGALAAGFH
                     EKFPLQAQEIDILFDLIAMRLVTSVTLSASRREKTGDNPYLAISEAPAWRLLHRLDAL
                     NPRFATAILRKACGFDAVEGAGAVRTWLDANRGAFAPIVKPHPATLTKALVPYGDAAH
                     VITVDSAGRRPETATAWWDDFCARNHIQLGLGPWGEKRTVYTDEAFRSRFVEGERRVH
                     HLGLDLFMPAGTPVYTPLAATVRSVEIEAVPLGYGGLIALEHEPEGCPPFITLWGHMA
                     HEAVSRLKPGDRLAAGELVGHMGDMHENGGWTPHLHFQISTDTSLSATEILGVGESAY
                     LDVWADIFPDAAPLAGIPAEAFQQSGRTRAEIISVRKEMLLPNLSISYSDPIKFVRGD
                     GVWLIDNRGRAYLDCFNNVCHLGHAHPEVVEAIARQAAILNTNTRYLHDTIVSYAERL
                     TATLPEGLTVASFACSGSEANSLALRMARTHSGQRDALVLDWAYHGTTQELIDLSPYK
                     YKRKGGKGRPDHVFEATIPDSYRAPESWPLAEHGRRFAESIAEQIEKMKAQGRAPAFF
                     IAESIPSVAGQVFLPEGYLREVYAMVRAAGGVCIADEVQVGFGRVGSHWWAFEMQGVV
                     PDIVTMGKPIGNGHPMSAVVTTREVADSFNNGMEYFNTFGGNPVSCVAGLAVLDVIEH
                     NDLRRNALEIGNYLIAGFRSMQDRFDIIGDVRGQGLFLGIELVMDRKTKEPATAIARK
                     INDGARERGILMGTEGPFDNVLKMRPPMIFTRANADHLLSVLEDSFAAALK"
     STS             276929..277450
                     /locus_tag="BAB_RS27730"
                     /old_locus_tag="BAB2_0285"
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     gene            279478..280497
                     /locus_tag="BAB_RS27735"
                     /old_locus_tag="BAB2_0286"
                     /db_xref="GeneID:3827773"
     CDS             279478..280497
                     /locus_tag="BAB_RS27735"
                     /old_locus_tag="BAB2_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_002967211.1"
                     /db_xref="GI:489057088"
                     /db_xref="GeneID:3827773"
                     /translation="MKKTVWGALLAAGFALSAQGGAAADTLSTVKERGKVNCGVSQGV
                     AGFSSPDDQGKWTGFDIDFCRAVSAAVFGDPDKVSFIPLSTKERFTALQSGTVDLLSC
                     QTTWTLSRDAGMGIHFVGTAYYDGQGFMIRKDLGVDSALKLDGASICTEQGTTTEQNV
                     ADYCGAHNIKYEPVVIDSADGILKAFETGRCDVYTTDASALYAQRLKLAEPDAYMVLP
                     EVISKEPLGPAVRQGDDKWFNIVRWTLFALLEAEELGITQKTVAADLDSRKPDIRRFL
                     GSEGDNGQQLGLEPKWAYNIVASVGNYGEMFERTIGEGSLLKINRGINALWNKGGLMY
                     APPVK"
     gene            complement(280528..282084)
                     /locus_tag="BAB_RS27740"
                     /old_locus_tag="BAB2_0287"
                     /db_xref="GeneID:3827774"
     CDS             complement(280528..282084)
                     /locus_tag="BAB_RS27740"
                     /old_locus_tag="BAB2_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936617.1"
                     /note="intracellular enzymes acting on low molecular
                     weight D-amino acid amides, esters and oligopeptides
                     containing D-amino acids; these proteases release the
                     N-terminal D-amino acid from a peptide, and show higher
                     affinity for D-Ala, D-Ser or D-Thr; no preference for the
                     stereochemistry of the second amino acid; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminopeptidase"
                     /protein_id="WP_002965700.1"
                     /db_xref="GI:489055551"
                     /db_xref="GeneID:3827774"
                     /translation="MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFA
                     DLAARKAMTPETRMPICSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRD
                     LCNNQSGLRDYWALTVLCGAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRI
                     LADLIEQHTGRSLADLLAERIFAPAAMKTAELIPDTALFNECTGYEGDTVRGFLPAIN
                     RIHWLGDAGICASLDDMIAWEQFIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKF
                     EETGGKRLTGHGGALRGWRCQRWHCADERISTIVMFNFEGNASDAALKMMNAALGIPP
                     AKPVRAQANPGWFGSWLNPETGLVLSLEDAGGGRMKARFGTGPEIMDISGENEAQSSM
                     TTLRRDGDMIHLARKDENLHLAMHRLKGEARQDIAGRYRSDELEADLLLVSEGGAIYG
                     AFEGFLGKSDMYPLYAAGPDVWLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCW
                     LARGVEYKRL"
     gene            complement(282129..282242)
                     /locus_tag="BAB_RS27745"
                     /db_xref="GeneID:23672520"
     CDS             complement(282129..282242)
                     /locus_tag="BAB_RS27745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006110454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965701.1"
                     /db_xref="GI:489055552"
                     /db_xref="GeneID:23672520"
                     /translation="MTPPIRDNIARNTYLYIASVFKLYNPRTAIALIERLK"
     gene            282500..284185
                     /locus_tag="BAB_RS27750"
                     /old_locus_tag="BAB2_0289"
                     /db_xref="GeneID:3827776"
     CDS             282500..284185
                     /locus_tag="BAB_RS27750"
                     /old_locus_tag="BAB2_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972123.1"
                     /db_xref="GI:489062096"
                     /db_xref="GeneID:3827776"
                     /translation="MTSKPNVRTGGQILVDALRIHGADRVFCVPGESYLAALDAFHDA
                     SDAIDLIVCRQEGGASYMAEAYGKLTGKPGICFVTRGPGATNASIGVHTAFQDSTPML
                     LFIGQVASDQVEREAFQEIDYRRMFGQMAKWVVQIDDAARIPELVSQAFHRAVNGRPG
                     PVVVALPEDMLTSYAAVSDAPAYKQVAMHPGGEQLQAMRALIEKAERPLMIVGGGGWT
                     QDAVRDLRQFAENMSLPVAASFRCQDMFDNTHPLYAGEMGTSISARLVQRVKDSDLLV
                     VVGARLGEMTTQGYELVTIPVPQQKLVHIHPGAEELGRVYHADVPINAGMPAFCAAAA
                     KLAPVADPRWKAWADSANADYRDNIKSPVIPGEVQMGEVMEWLRAHLPADAIITNGAG
                     NYSAWPHRFYQYRTYRSQLAPTNGSMGYGVPAAVAAKLTAPERTAVAFAGDGCFLMNG
                     QELATAAQYGANAIFIVVNNGMYGTIRMHQERTYPARISGTALANPDFAALARAYGLH
                     GEVVEKTADFAPAFKRCEQSGKPALIEIRIDPEALSPKMSLSQMREQGFAKQR"
     gene            complement(284198..284923)
                     /locus_tag="BAB_RS27755"
                     /old_locus_tag="BAB2_0290"
                     /db_xref="GeneID:3827777"
     CDS             complement(284198..284923)
                     /locus_tag="BAB_RS27755"
                     /old_locus_tag="BAB2_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002965703.1"
                     /db_xref="GI:489055554"
                     /db_xref="GeneID:3827777"
                     /translation="MGLLETAITGRKRHNSHAVVVGELGRGMVAGTIPEGSILPGDHE
                     LSLRFGVSRTVLREAMKTLAAKRLIEPKAKVGTRVLGHASWNFFDPDVLSWRFEAGFD
                     EPFVDHLAEMRMALEPAAAAAAAERATSDEIVELYALAAKFDNPDHTPESIAKVDLEF
                     HLAIARMSGNPFMRSVSGLIEAALAVSFQLSSPAASQEGIAECAANHLRIAHAIASRD
                     PQKARLAMESVIKLGVKRIRDVI"
     gene            complement(284948..285241)
                     /locus_tag="BAB_RS27760"
                     /old_locus_tag="BAB2_0291"
                     /db_xref="GeneID:3827778"
     CDS             complement(284948..285241)
                     /locus_tag="BAB_RS27760"
                     /old_locus_tag="BAB2_0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965704.1"
                     /db_xref="GI:489055555"
                     /db_xref="GeneID:3827778"
                     /translation="MLHNDEARRTGSETGAAEQEAEIPVMLFDREISTREPLPAFLHR
                     VGANTGPVQTYIVFGGTLSSWWTKTVISILLFPSITLQQIARACLPKAGAGFG"
     gene            285511..286503
                     /locus_tag="BAB_RS27765"
                     /old_locus_tag="BAB2_0292"
                     /db_xref="GeneID:3827779"
     CDS             285511..286503
                     /locus_tag="BAB_RS27765"
                     /old_locus_tag="BAB2_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter"
                     /protein_id="WP_002965705.1"
                     /db_xref="GI:489055556"
                     /db_xref="GeneID:3827779"
                     /translation="MLRLVQFRDERGEAHVAACDDEGAAHVVGGVATTYELASAAISA
                     GISLEEQVACSGKGEAVDIDAALASGRVGLPVSHADSAHLIVTGTGLTHLGSADGRDK
                     MHKAMQSAEKPTDSMRMFLMGVESGKPKPGETGVQPEWFYKGDGSVLVATGGELVSPA
                     FAEDGGEEPELAGIYLIGPDGTPFRLGFCLANEFSDHVTEKQNYLWLAHSKLRQAALG
                     PELYVGALPDHVEGVSRIRRGGEVIFEKPFLSGEANMSHAIANLEHHHFKYALFRRPG
                     DIHVHFFGTATLSFSDGVKTEAGDQFEICAKPFRYPLVNRLGQAAAEKITVRAL"
     gene            286512..287447
                     /locus_tag="BAB_RS27770"
                     /old_locus_tag="BAB2_0293"
                     /db_xref="GeneID:3827780"
     CDS             286512..287447
                     /locus_tag="BAB_RS27770"
                     /old_locus_tag="BAB2_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose 1-dehydrogenase"
                     /protein_id="WP_002967212.1"
                     /db_xref="GI:489057089"
                     /db_xref="GeneID:3827780"
                     /translation="MTTSPDIALAIVGLGKIARDQHLPAIASVDGVALAAVASRNAGL
                     DGTPSFHDIEQLLASDVMFDAVSLCTPPQGRFNQAHAALKAGKHVMLEKPPGATISEV
                     HALERLAERQGVSLYATWHSREAAAVGPAREFLKDALIRSVSVAWKEDVRHWHPGQQW
                     IWEPGGLGVFDPGINALSIVTHILPEAFFLTRSDLYFPANRAAPIAADLRFHTGSGIP
                     VSFELDWRQTGPQTWDICVETDKGTLLLSHGGSRMTVAGEEKMAEPDREYQRLYRNFV
                     QLVRERRSDVDLAPLTHVADAFLLGKRHLVEAFDD"
     gene            287544..289349
                     /locus_tag="BAB_RS27775"
                     /old_locus_tag="BAB2_0294"
                     /db_xref="GeneID:3827781"
     CDS             287544..289349
                     /locus_tag="BAB_RS27775"
                     /old_locus_tag="BAB2_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690368.1"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_002965707.1"
                     /db_xref="GI:489055558"
                     /db_xref="GeneID:3827781"
                     /translation="MNKPVTPKTPKLRSRAWFDNPDDVDMTALYLERYMNYGLSQEEL
                     QSGRPIIGIAQTGSDLSPCNRHHLELAKRVRDGVREAGGIVIEFPVHPIQETGKRPTA
                     GLDRNLAYLGLVEVLYGYPLDGVVLTIGCDKTTPACLMAAATVNIPAIALSVGPMLNG
                     WFRGERTGSGTIVWKARELLAKGEIDYQGFVKLVASSAPSTGYCNTMGTATTMNSLAE
                     ALGMQLPGSAAIPAPYRDRQEVAYLTGRRIVEMVHEDLKPSDILTKEAFINAIRVNSA
                     IGGSTNAPIHLNALARHIGVELTVDDWQKYGEEIPLLVNLQPAGEYLGEDYYHAGGVP
                     AVVNQLMGQGLIHEDAITVNGKTIGENCKNATIEDGNVIKTYDQPLKKHAGFRVLRGN
                     LFSSAIMKLSVISDEFRNRYLSDAKDPNAFEGKAVVFDGPEDYHHRIDDPALEIDEHT
                     VLFMRGAGPIGYPGAAEVVNMRAPDYLLKKGITSLPCIGDGRQSGTSGSPSILNASPE
                     AAAGGGLAILKTGDRVRIDLGRGTADILISDEELAERRKALEAVGGYKYPESQTPWQE
                     IQRAVIGQMETGAVLENAVKYQDIAHTRGLPRDNH"
     gene            289364..290293
                     /locus_tag="BAB_RS27780"
                     /old_locus_tag="BAB2_0295"
                     /db_xref="GeneID:3827124"
     CDS             289364..290293
                     /locus_tag="BAB_RS27780"
                     /old_locus_tag="BAB2_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxygalactonokinase"
                     /protein_id="WP_002967213.1"
                     /db_xref="GI:489057090"
                     /db_xref="GeneID:3827124"
                     /translation="MGAGKKPFAAVADWGTTRFRLWTLDADGAVLGESRGDDGLLHAK
                     EAGFEPTLERHLARLGAPDDLPVVICGMAGSRAGWVEAPYMNLPAGLDGIVKAAVRVP
                     ARRHVIMLPGVARQDETAPDVMRGEETKLLGLVHRGTRDAIVVMPGTHAKWVKIANGE
                     LADYRTFMTGELFALLKEKSVLAGALEGAGTVDPNHDAFAAGVRASLEAPELVSNRLF
                     SIRAGWLVHDRKPTDQLARLSGLLIGLEIAGGRTLYGGAKDILLPSDGTMGGLYASAL
                     ATAGLNVKRLQADELVRDGLFMAAKHTFQGAVS"
     gene            290290..290922
                     /locus_tag="BAB_RS27785"
                     /old_locus_tag="BAB2_0296"
                     /db_xref="GeneID:3827125"
     CDS             290290..290922
                     /locus_tag="BAB_RS27785"
                     /old_locus_tag="BAB2_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364043.1"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and pyruvate from
                     2-dehydro-3-deoxy-D-galactonate 6-phosphate; functions in
                     galactonate metabolism; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
                     /protein_id="WP_002965709.1"
                     /db_xref="GI:489055560"
                     /db_xref="GeneID:3827125"
                     /translation="MSGHIAWPKLRYPLVAILRGIRPEETEAIVSALIETGFEAIEIP
                     LNSPAPFTSIEKAAKLAPKNVLIGAGTVLSVDDVDRLNDVGGRLLVSPNVEPEVIRRA
                     GSHGMVTMPGVFTPTEAFSAIRAGASALKFFPASVLGAEGIKAVCAVLPKDIPVGAVG
                     GVSQNDFATYAAAGVTCFGLGSSLYKAGFSAADVQERAQQAVAAWDKIAG"
     gene            291071..291418
                     /locus_tag="BAB_RS27790"
                     /db_xref="GeneID:23672521"
     CDS             291071..291418
                     /locus_tag="BAB_RS27790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-binding protein"
                     /protein_id="WP_002972122.1"
                     /db_xref="GI:489062095"
                     /db_xref="GeneID:23672521"
                     /translation="MGMKSLTLAVAMAAFAFTGMAHAEDKGLVAVAMPTKSSARWIAD
                     GDNMVKVLKERGYQTDLQYAEDDVPNQLAQIENMVTKGPRFWSLHRSMARRFRMFWPR
                     HMMRASRSSLMTA"
     gene            291475..292131
                     /locus_tag="BAB_RS27795"
                     /db_xref="GeneID:23672522"
     CDS             291475..292131
                     /locus_tag="BAB_RS27795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_002967214.1"
                     /db_xref="GI:489057091"
                     /db_xref="GeneID:23672522"
                     /translation="MLQAQSIEKALDLKNKPGPFNIELFGGSPDDNNAYFFYNGAMSV
                     LQPYIDSGKLVVGSGQTGMDKVATLRWGGATAQARMDSILSAYYSDKKLDAVLSPYDG
                     ISIGILSSLKGVGYGSGDMPMPVVSGQDAEIPSVKSILAGEQNSTIFKDTRELAKVTV
                     DMVDALMTGKEPEVNDTKTYNNGVKVVPSYLLKPVIVDKSNWKQVLVDSGYYKEDQIK
                     "
     gene            292277..293866
                     /locus_tag="BAB_RS27800"
                     /old_locus_tag="BAB2_0299"
                     /db_xref="GeneID:3827128"
     CDS             292277..293866
                     /locus_tag="BAB_RS27800"
                     /old_locus_tag="BAB2_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose ABC transporter ATP-binding protein"
                     /protein_id="WP_002965711.1"
                     /db_xref="GI:489055562"
                     /db_xref="GeneID:3827128"
                     /translation="MNLANPVSLDERGALPDTFGKPLLEMRGINKSFGVVKALSDVNF
                     TVMPGEIHAFVGENGAGKSTLMKVLSGVYPHGSYEGAIYYDGEERQFRDINDSEALGI
                     VIIHQELALIPLMSIAENIFLVNPPASRGVIDRSAVHKRTRELLKKVGLAETPDTLIT
                     DIGIGKQQLVEIAKALSKRVRLLILDEPTASLNENDSAALLALLREFRAQGITSILIS
                     HKLNEIREVADKITVLRDGKAVATLDCHAGEVEEDDIIRKMVDRDLESRYPKRDPKIG
                     NVIFEVDNWSVYHPLHPDRHSVKNVSFKVRAGEIVGIAGLMGAGRTEFAMSLFGRSWG
                     TNITGEARINGKTVDISTVARAIKAGLAYVTEDRKKLGLVLGQNISRNISLAHLRGVS
                     PKGIIDDIREMKIANSYRDQMRIRCHNVYQETGTLSGGNQQKVVLSKWLFTGPDVLIL
                     DEPTRGIDVGAKYDIYTIINSLAESGKGVVVISSEMPELIGICDRIVVMHEGAFVGEV
                     AGEEATQENIMRAIMRNKGKG"
     gene            293866..295056
                     /locus_tag="BAB_RS27805"
                     /old_locus_tag="BAB2_0300"
                     /db_xref="GeneID:3827129"
     CDS             293866..295056
                     /locus_tag="BAB_RS27805"
                     /old_locus_tag="BAB2_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965712.1"
                     /db_xref="GI:489055563"
                     /db_xref="GeneID:3827129"
                     /translation="MSENVIQSGQQSSVGRYLKNNLRESGMLLSLVAIMIFFQIVTGG
                     VLMKPLNLTNLVLQNSYIVIMALGMLLIIVTGHIDLSVGSVCGFIGALAAVMMVKLGI
                     PFPIAAILCLIVGGLIGAIQGFWVAYFNIPSFIVTLAGMLVFKGMMLAVLGGQSVGPF
                     PVVFQKLSSGFIPEVIGTFDGVYLTSLIIGVLLAVFLIWQSMRSRARHIAHEVETEPF
                     GLFVVKCILYFAAIAYLSLLISSHRGMPNVLIIMAVLIAAYAFLTNRTVIGRQIYAVG
                     GNRHAAKLSGVKTERLTFLTFVNMGVLAALAGLVFAARLNTATPKAGIGFELDVIAAC
                     FIGGASAYGGVGRVTGAVIGALIMGVMNNGMSILGIGIDYQQVIKGIVLLGAVCIDVY
                     NQKR"
     gene            complement(295207..296088)
                     /locus_tag="BAB_RS27810"
                     /old_locus_tag="BAB2_0301"
                     /db_xref="GeneID:3827130"
     CDS             complement(295207..296088)
                     /locus_tag="BAB_RS27810"
                     /old_locus_tag="BAB2_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid aminotransferase"
                     /protein_id="WP_002965713.1"
                     /db_xref="GI:489055564"
                     /db_xref="GeneID:3827130"
                     /translation="MAASAAELENRIVYVNGEYVAARDARISIFDRGFLFGDGIYEVT
                     AVLEGKLVNSEPHMQRLRRSTGEIGIAMPMSEDEIVTIERELIRRNKLTEGLVYLQVT
                     RGNGGDRDFVPAANMKPSVVLFTQEANLLDKPALKTGAHVLSLDDLRWKRRDIKTVCL
                     LPQALTKEIAKNAGCDEAWMIEDGYVTEGASSTAYIVTRDDVIVTRPNSNFTLPGCTR
                     LSLLQLITETGMKLEERLFTIDEAYAAKEAFLTSAGTFVTPITVIDGKTIGDGKPGPI
                     ARRLREVYLDHARRTAI"
     gene            complement(296176..296799)
                     /locus_tag="BAB_RS27815"
                     /old_locus_tag="BAB2_0302"
                     /db_xref="GeneID:3827131"
     CDS             complement(296176..296799)
                     /locus_tag="BAB_RS27815"
                     /old_locus_tag="BAB2_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967215.1"
                     /db_xref="GI:489057092"
                     /db_xref="GeneID:3827131"
                     /translation="MAITILKAENHRRMPWKNGGGLTAEIAVHPQGASVEDFDWRISM
                     ATIASDGPFSVFPGIDRTLSVLAGDGIVLDIEGQATTLTRECAPLAFAADACCDARLI
                     GSAITDLNVMTRRGRFAHMVRRLPVNGTTLTQVHGNPVLLFCAEGRMDLVSSEQTIKF
                     EEHDCAVMTGCDALPLKLTGKGTTYLISIRAFPAENKSKSHCASAPD"
     gene            complement(296806..298479)
                     /locus_tag="BAB_RS27820"
                     /old_locus_tag="BAB2_0303"
                     /db_xref="GeneID:3827132"
     CDS             complement(296806..298479)
                     /locus_tag="BAB_RS27820"
                     /old_locus_tag="BAB2_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q579F0.1"
                     /note="catalyzes the formation of
                     4-imidazolone-5-propanoate from urocanate during histidine
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urocanate hydratase"
                     /protein_id="WP_002965715.1"
                     /db_xref="GI:489055566"
                     /db_xref="GeneID:3827132"
                     /translation="MSNPRHNEREVRSPRGDELNAKSWLTEAPLRMLMNNLDPDVAER
                     PHELVVYGGIGRAARTWDDFDRIVATLKTLNDNETLLVQSGKPVGVFRTHKDAPRVLI
                     ANSNLVPHWANWDHFNELDKKGLAMYGQMTAGSWIYIGAQGIVQGTYETFVEAGRQHY
                     GGNLKGRWILTGGLGGMGGAQPLAAVMAGACCLAVECDETRADFRLRTRYVDEKTHSL
                     DEALAKIDAWTKAGEAKSIALIGNAAEIFPELVKRGVKPDIVTDQTSAHDPVHGYLPL
                     GWTVAEWRAKQENDPKAVEKAARASMKVQVQAMLDFWNAGIPTVDYGNNIRQMALEEG
                     LENAFAFPGFVPAYIRPLFCRGIGPYRWAALSGDPEDIAKTDAKVKELLPDNKHLHNW
                     LDMAKERIAFQGLPARICWVGLGDRHRLGLAFNEMVRNGELKAPIVIGRDHLDSGSVA
                     SPNRETEAMKDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHAGMVICCD
                     GTEDADRRLERVLWNDPATGVMRHADAGYDIALDWARKQGLRLPAILGN"
     gene            complement(298490..299290)
                     /locus_tag="BAB_RS27825"
                     /old_locus_tag="BAB2_0304"
                     /db_xref="GeneID:3827133"
     CDS             complement(298490..299290)
                     /locus_tag="BAB_RS27825"
                     /old_locus_tag="BAB2_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="WP_002967216.1"
                     /db_xref="GI:489057093"
                     /db_xref="GeneID:3827133"
                     /translation="MRAVETRQGNSPVILGLPHTGTDVPDDIWSRLNDNGKILADTDW
                     HIHKLYDGLIDGATFVRATFHRYCIDANRDPAGVSLYPGQNTTTLIPETDFDGLSIWK
                     DGEAPTEADIADRIARFHRPYHDALAAEIERVKAIHGVAILYDCHSIRSHIPFLFEGK
                     LPDFNIGTDMGKTCDPGIEAAAVEVTAKAKGYTSILNGRFKGGWTTRHYGRSQTGVHA
                     IQMELAQSTHLATEAVPFAYDEAKADTLRVHLKTLLQRLETIAAELKS"
     gene            complement(299292..300827)
                     /locus_tag="BAB_RS27830"
                     /old_locus_tag="BAB2_0305"
                     /db_xref="GeneID:3827170"
     CDS             complement(299292..300827)
                     /locus_tag="BAB_RS27830"
                     /old_locus_tag="BAB2_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364049.1"
                     /note="catalyzes the degradation of histidine to urocanate
                     and ammmonia; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="WP_002972121.1"
                     /db_xref="GI:489062094"
                     /db_xref="GeneID:3827170"
                     /translation="MTIILKPGSVPLETLEKIYREGLPVRIDPAFHAGIEKAAARIAE
                     IAAGDAPVYGINTGFGKLASIRIAAGDVATLQRNLILSHCCGVGEPLSENIVRLIMAL
                     KLVSLGRGASGVRLEVITLIEAMLEKGVIPMIPEKGSVGASGDLAPLAHMTAAMIGEG
                     EAFYRGERLSGAKALGKAGLKPVVLAAKEGLALINGTQTSTALALAGLFRAHRAARTA
                     LITGALSTDAAMGSDAPFHEEIHQLRGHKGQIDAGRALRTLLEGSAIRRSHLEGDQRV
                     QDPYCIRCQPQVDGACLDILRQAARTLEIEANAVTDNPLVLSDGRAVSGGNFHAEPVA
                     FAADQIALAVCEIGAISQRRIALLVDPSLSFGLPAFLARKPGLNSGLMIAEVTSAALM
                     SENKQMAHPASVDSTPTSANQEDHVSMACHGARRLLQMTANLNAIIGIEALTGALGVE
                     LRKPLTTSAELAKVIAALRAKVATLEEDRYMADDLKAAAELVADGTLSGVISAGILPD
                     LEA"
     gene            complement(300852..302069)
                     /locus_tag="BAB_RS27835"
                     /old_locus_tag="BAB2_0306"
                     /db_xref="GeneID:3827134"
     CDS             complement(300852..302069)
                     /locus_tag="BAB_RS27835"
                     /old_locus_tag="BAB2_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FVB5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazolonepropionase"
                     /protein_id="WP_002965718.1"
                     /db_xref="GI:489055569"
                     /db_xref="GeneID:3827134"
                     /translation="MTKNSSTVFTHARIATLEEKAANLGLIEEAALVVKDARIVYAGP
                     ENKLPDEYASFEKIDCGNRLITPGLIDCHTHLVHAGNRAHEFELRLQGATYEEVARAG
                     GGIVSSVRNLRAASEDDLVRETLPRLDALIAEGVTTVEVKSGYGLDRDSEIKSLKAAR
                     RLGEERDVAIRTTFLGAHALPPEMNGDKAAYIDRVINDMLPAIAEQGLADAVDGFCEG
                     IAFLPDEIARVFDAAKAHDIPVKLHADQLSNLHGAALAASYGALSADHLEYTDADGAA
                     AMASAGTVAVLLPGAYYFIRETQKPPVEAFRAAGTKMALATDNNPGTSPLTSLLLTMN
                     MGATLFRMTVEECIAGVTREAARALGILDQTGTLEIGKDADLAIWDIERPAELVYRIG
                     FNPLWKRVFKGQI"
     gene            302200..303564
                     /locus_tag="BAB_RS27840"
                     /old_locus_tag="BAB2_0307"
                     /db_xref="GeneID:3827135"
     CDS             302200..303564
                     /locus_tag="BAB_RS27840"
                     /old_locus_tag="BAB2_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formimino-L-glutamate deiminase"
                     /protein_id="WP_002965719.1"
                     /db_xref="GI:489055570"
                     /db_xref="GeneID:3827135"
                     /translation="MSDQSSQHFIHARQALLPDGWAENVRIGIAGGVICSIETGVLAG
                     PDDERQSVVVAGMANLHSHAFQYGMAGLAERRGPSADSFWSWREIMYKFALTMTPEQA
                     EAVALRLYVDMLEAGFTRVGEFHYLHHDCDGTPYANLSEMADRIAAAATTAGMGLTLL
                     PVFYAHSGFGGAAANEGQRRFINDPERFARLIEGCRKTLEGFEGAVLGVAPHSLRAVT
                     PDELDSVTQLLPDAPVHIHVAEQVKEVEDCIAWSGKRPVEWLLDHQDVTARWCLIHAT
                     HMSDEETKHMAKAGAIAGLCPVTEANLGDGTFNATEFAAAGGKFGIGSDSNVLIGIGD
                     ELRQLEYSQRLYHRARNVLAANEGSTGRALFDGAVLGGNIAMGRPEDGLKKGASADFV
                     SLDVERLPHAKGDVVLDGWIFAGRAHVCDVWVRGVKQVEGGRHRLRDEAERAFQKALG
                     ELLA"
     gene            303576..304319
                     /locus_tag="BAB_RS27845"
                     /old_locus_tag="BAB2_0308"
                     /db_xref="GeneID:3827169"
     CDS             303576..304319
                     /locus_tag="BAB_RS27845"
                     /old_locus_tag="BAB2_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012460464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002967218.1"
                     /db_xref="GI:489057095"
                     /db_xref="GeneID:3827169"
                     /translation="MAGEDSIAKDVPALSLHQRILDDIESRILSGEWLPGHRIPFEHE
                     LTEYYGCSRMTVNKALTQLSKAGLIERKRRSGSFVSFPQSQAAILEIHDIREEVAALG
                     LPYRFELMNRWERLSGPADARRLDIARHTPLVELLCRHYAGKRVFALEERIINLEAVP
                     AAAETDFAQNSPGPWLVACVPWSSAKHTIRAIAATQEAAAKLDIAPGSPCLVIERQTW
                     NADQPVTHVRFTYPGDSHALVARFTPSRG"
     gene            complement(304390..305718)
                     /locus_tag="BAB_RS27850"
                     /old_locus_tag="BAB2_0309"
                     /db_xref="GeneID:3827136"
     CDS             complement(304390..305718)
                     /locus_tag="BAB_RS27850"
                     /old_locus_tag="BAB2_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="omega amino acid--pyruvate aminotransferase"
                     /protein_id="WP_002965721.1"
                     /db_xref="GI:489055572"
                     /db_xref="GeneID:3827136"
                     /translation="MLTKTNAPSLDNFWMPFTANRQFKAAPRLLASASGMYYTDVDGN
                     QVLDGTAGLWCCNAGHGRKRITEAVERQISTMDFAPIFQMGHNVAFDFAEKLAAIAPG
                     GAEAKLDRVFFTNSGSESVDTALKIAIAYQRAIGQGTRTMVLGREKGYHGVGFGGISV
                     GGLVNNRCVFPQIPADHLRHTLDIEKNAFSKGLPANGIELADDLERLVQLHGAEKIAA
                     VIVEPMSGSAGVILPPKGYLERIRATADKYGILLIFDEVITGFGRLGTPFAVDYFGVV
                     PDLVTTAKGLTNGAIPMGAVFAARKVYDGLMTGPENAIELFHGYTYSGHPVASAAGLA
                     TLEIYAEEGLLTRGAGLADYWQEALHSLKGAPNVIDIRNLGLVGAVELASRKDAPGAR
                     AYDIFVECFKKGLLIRVTGDVIALSPPLIIEKEQIDTIISVLGDAIKRAA"
     gene            305864..306412
                     /locus_tag="BAB_RS27855"
                     /old_locus_tag="BAB2_0310"
                     /db_xref="GeneID:3827137"
     CDS             305864..306412
                     /locus_tag="BAB_RS27855"
                     /old_locus_tag="BAB2_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_002965722.1"
                     /db_xref="GI:489055573"
                     /db_xref="GeneID:3827137"
                     /translation="MSIDIGGRLRYVRMRQNLSQREFAKRAGVTNSTISLIEANQSNP
                     SVGALKRILDGIPIGMAEFFALEPDAPHRVFYQAEELVEIGKGPISYRQVGDHLFSRA
                     LQILKERYEPGSDTGKVLLMHEGEEGGIVISGRIEVTVGAERRILGPGDAYYFSSKLP
                     HRFRCVGPAPCEIVSACTPPSF"
     gene            complement(306455..307705)
                     /locus_tag="BAB_RS27860"
                     /old_locus_tag="BAB2_0311"
                     /db_xref="GeneID:3827138"
     CDS             complement(306455..307705)
                     /locus_tag="BAB_RS27860"
                     /old_locus_tag="BAB2_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FVC0.1"
                     /note="catalyzes the oxidative deamination of D-amino
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase"
                     /protein_id="WP_002965723.1"
                     /db_xref="GI:489055574"
                     /db_xref="GeneID:3827138"
                     /translation="MQITILGSGVIGVTTAYYLAKLGHEVTVIDREEGPALETSFANA
                     GQVSPGYASPWAAPGIPLKAAKWLFQKHAPLILRLTTDPVQYRWLLQMLANCTDSRYK
                     INKTRMVRVAEYSRDCLIELRKDTGIEYDQRSQGTLQLFREQYQLDGIGKDIEVLRQD
                     GVPFEVLDRDGCVNVEPALAHAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKF
                     RFGVNIKSLLMSGGKISGVETSEGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGY
                     SITAPIVDESRAPVSTVLDESYKIAITRLGDRIRVGGMAEVSGFTDDLPAARRATLDL
                     SVTDLFPGGDLKAATFWSGLRPMTPDSTPIIGGTRYDNLFINAGHGTLGWTMACGSGR
                     LLADLISGNKADIRADDLGIARYN"
     gene            complement(307721..308920)
                     /locus_tag="BAB_RS27865"
                     /old_locus_tag="BAB2_0312"
                     /db_xref="GeneID:3827139"
     CDS             complement(307721..308920)
                     /locus_tag="BAB_RS27865"
                     /old_locus_tag="BAB2_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A9WVT5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_002967219.1"
                     /db_xref="GI:489057096"
                     /db_xref="GeneID:3827139"
                     /translation="MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRT
                     AAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPG
                     TEAACAREGILPVLNSLEQVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLL
                     ENVTLLSRIDIKFAISHLANGDEPGNAVNARQLAKMTALLARLPKLPAALANSGGTFL
                     GKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVD
                     KGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSI
                     TLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCDTIPYEILTALGNRYARVYVYVNG
                     GGTSTTA"
     gene            309161..309628
                     /locus_tag="BAB_RS27870"
                     /old_locus_tag="BAB2_0313"
                     /db_xref="GeneID:3827140"
     CDS             309161..309628
                     /locus_tag="BAB_RS27870"
                     /old_locus_tag="BAB2_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002965725.1"
                     /db_xref="GI:489055576"
                     /db_xref="GeneID:3827140"
                     /translation="MSTLDGIDRNIIRCLRRDGRMTNSQLAAQVGLSQSACLRRVHIL
                     EESGVIRGYTAIVGSSDGDERLVAIVRITLDRQTEEYLNRFEEAVRRHPEVQECYLMT
                     GDADYILRVEAENAAAYEIIHKEILSRLPGVARIHSSFAIRTVLLSKALSPRS"
     gene            complement(309776..310630)
                     /locus_tag="BAB_RS27875"
                     /old_locus_tag="BAB2_0314"
                     /db_xref="GeneID:3827141"
     CDS             complement(309776..310630)
                     /locus_tag="BAB_RS27875"
                     /old_locus_tag="BAB2_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YD01.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965726.1"
                     /db_xref="GI:489055577"
                     /db_xref="GeneID:3827141"
                     /translation="MKRGCAIAVMICGLITSVSAASAADLIVQEPVFEPLPQPALAGW
                     YLRGDIGYNFKSKTGGKWDFWNQFEEPYRGVDDTFNYDDFSLKGGASYGVGVGYRFND
                     MLRTDLTLDYFRASINGRTNCRSYVKSSHGLNPVEDNCHYEDNSKASVWTAMANAYVD
                     LPRVGPLTPYLGAGIGAAYVKYDTWKTSEICPTCTLQSDKDGFDSWRFAMALMAGVSY
                     DLTDQLKLDLGYRYLRVNGGNAYGYDEQDRQVINQYGQGAGADGPQAKDNGFNIHTVR
                     AGLRYEFR"
     gene            complement(310909..312054)
                     /gene="lldD"
                     /locus_tag="BAB_RS27880"
                     /old_locus_tag="BAB2_0315"
                     /db_xref="GeneID:3827175"
     CDS             complement(310909..312054)
                     /gene="lldD"
                     /locus_tag="BAB_RS27880"
                     /old_locus_tag="BAB2_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006170772.1"
                     /note="flavin mononucleotide-dependent dehydrogenase;
                     functions in aerobic respiration and also has a role in
                     anaerobic nitrate respiration; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-lactate dehydrogenase"
                     /protein_id="WP_002965727.1"
                     /db_xref="GI:489055578"
                     /db_xref="GeneID:3827175"
                     /translation="MSNIVEIADLKRLARRRVPKMFFDYADSGAWTESTYRANEDDFK
                     KIKLRQRVLVDMTNRSLETTMIGEKVAMPVALAPTGLTGMQHANGEMLAAQAAEAFGV
                     PFTLSTMSICSIEDVASVTKKPFWFQLYVMRDRDFVKNLIGRAKAAGCSALVLTLDLQ
                     ILGQRHKDIRNGLSAPPKFTPKHIWQMATCPAWCLGMLGTQRRTFRNIAGHAKNVTDL
                     SSLSSWTAEQFDPQLNWSDVEWIKEQWGGKLILKGILDVEDAKMAAKSGADAIIVSNH
                     GGRQLDGAPSSISMLQPIVEAVGDRIEVHVDGGIRSGQDVLKARALGAQGVYIGRPFL
                     YGLGAMGKEGVTLALEIIRKEMDITMALCGKRDINEIDKSIIHSIDF"
     gene            312259..314571
                     /locus_tag="BAB_RS27885"
                     /old_locus_tag="BAB2_0316"
                     /db_xref="GeneID:3827142"
     CDS             312259..314571
                     /locus_tag="BAB_RS27885"
                     /old_locus_tag="BAB2_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006640726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002965728.1"
                     /db_xref="GI:489055579"
                     /db_xref="GeneID:3827142"
                     /translation="MSKGKKTGFIGKRSSAAGGWGALKSCGQQLLASGAPLAGARALL
                     KANQPDGFDCPGCAWGDPEHGSSFEFCENGVKAVAWEATDRRTTPAFFREHTVSKLRE
                     WTDYDLENTGRLTHPMRYNTATDKYEAVEWDEAFQAIGGILKSFDTPDRVEFYTSGRA
                     SNEAAFLYQLFVRAYGTNNFPDCSNMCHEASGVALTQSVGVGKGTVLLEDFEQADAIF
                     VVGQNPGTNHPRMLGDLRRAAERGARIVAFNPVRERGLERFADPQDKLEMLHGGSEPI
                     TSDYFQPRLGGDLAAFRGMAKAVFAADDAALAAGRPSVLDRAFLAAHTAELEAYRAAV
                     DATSWDEIEDQSGLLRQSLERAAEIYMQAGRVICTWAMGITQHRHSVITIREITNFML
                     LRGNIGKPGAGLCPVRGHSNVQGDRTVGINEHPPVAFLDALEREFGFKPPREPGHNVL
                     GAIGAMLDGTAQAFVALGGNFARATPDSPIISRALSSQRLTVHIATKLNHSHLVPGRD
                     SFILPCLGRTEIDLNSKGVAQIVTVEDSMSMVHGSGGINQPASPLLRSEVAIIAGMAN
                     ATLGPKPVDWLALADDYDLIREHIARVLPDFHDYNRRVRVPRGFHLRNAARDLEWNTP
                     TGKATFWTGALPQAIEHQQVRDKPGRYVLQTFRSHDQYNTTIYGMNDRYRGVYGERHV
                     VFMNPLDMADLGVEAGDRADIVGEFDDGVERVAANFRFVPYDIPRGCIAGYYPEMNVL
                     VPLGSAGDESDTPTSKSIIVSFRLNRTKAA"
     gene            314568..314858
                     /locus_tag="BAB_RS27890"
                     /old_locus_tag="BAB2_0317"
                     /db_xref="GeneID:3827143"
     CDS             314568..314858
                     /locus_tag="BAB_RS27890"
                     /old_locus_tag="BAB2_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967220.1"
                     /db_xref="GI:489057097"
                     /db_xref="GeneID:3827143"
                     /translation="MMDEDEAEYMRLVEALKAEAGRLSGLGAGIVAGLALDIASDSRT
                     FARVFGLAHALVLRELTALAQTGDYVRIRQRDARTHYELGQAGHRLVEEVKG"
     gene            315090..316262
                     /locus_tag="BAB_RS27895"
                     /old_locus_tag="BAB2_0319"
                     /db_xref="GeneID:3828191"
     CDS             315090..316262
                     /locus_tag="BAB_RS27895"
                     /old_locus_tag="BAB2_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_002970554.1"
                     /db_xref="GI:489060499"
                     /db_xref="GeneID:3828191"
                     /translation="MAVISFPETIRGEWGRVAMQRAARTGKYLILGAFAGLATCIQIL
                     SAGSPAYADSLNVVPVAVREAKLVDYQPKLTLSGAVAARSLVNVSFRVNGQVVERLVD
                     IGQHVEKGQLLARIDDVEQRANMRVAQASMDAAEAQLVQADANFKRQQALLKQGFTTR
                     SQYDQADQALRTAQSALSSAQSQLGNARDELSYTELHAPVSGVVTARNIETGQVVQAA
                     QTAFSIAEDGSRDAIFDVQETLVNHARIGMGVTVALLADPSIEAEGNIRELSPVVDAQ
                     TGTVRVKVGIAQATAQMALGAIVTGTVHMDARQVIVLPWSAMTSEAGRTAVWRVDRDT
                     HVATLVPIKVLAYEKERVIVESGLNNGELIVTKGAQMLRSGEPVEIMQGPEGAGSQ"
     gene            316259..317278
                     /locus_tag="BAB_RS27900"
                     /db_xref="GeneID:23672523"
     CDS             316259..317278
                     /locus_tag="BAB_RS27900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008536687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_002967221.1"
                     /db_xref="GI:489057098"
                     /db_xref="GeneID:23672523"
                     /translation="MKIHMNPMFRAAGCAVLFGALTVLAACGKEDEKAQEAAPIRPVL
                     YTIVEPKPVAQTGFAGTVEPRYSTDLAFRVLGRVIARPVKVGDLVKKGEMVAMLDPSA
                     LDLAVQSARADLASAEAQYANASASEERQRILLRGNNVSQADYDAARQARDSAEAGLE
                     KAQAGLRKAEDQRGYAVLRPDVREAVVDIPDSMTEYFKPGTPFNVQLQADPSVKGTGS
                     VREVAPQADAQTRTRRVRIALDNPPEGFRLGATIQAARSTPETGFVSLPMPSLLEQDG
                     KTSIWVIDPGTQTVSLHDVRVIERKGASFVAGGVEAGSYVAIAGVHELKAGQKVRLDE
                     KGSGL"
     gene            317275..320349
                     /locus_tag="BAB_RS27905"
                     /old_locus_tag="BAB2_0321"
                     /db_xref="GeneID:3828193"
     CDS             317275..320349
                     /locus_tag="BAB_RS27905"
                     /old_locus_tag="BAB2_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACR family transporter"
                     /protein_id="WP_002965733.1"
                     /db_xref="GI:489055584"
                     /db_xref="GeneID:3828193"
                     /translation="MKKGFNLSDWALNHRSLVWYFMLVFLVAGLVSYLDLGREEDPEF
                     TVKTMVVQANWPGASIDETLNQVTDRLEKKLEELDTLDYTRSVTTAGKSVVFVFLKDT
                     TRAQDVKKSWTEVCHLLTDIQNTLPQGVYGPYFNDQFGDVFGNIYAFTADGLSMRQLR
                     DYAEDVRTKILTIPNAGKVELIGAQDEAIYLEFSTRQVAALGLDQQAILKALQDQNAI
                     TPSGVVQAGPERISVRVSGQFNSEADLRAVNLRVNNRFFRLSDVATITRGYVDPPTSI
                     FRVNGEDAIGLGIGMKPNGNLLEFGAELDKMMDQVTAELPVGVKVFKVADQPQVVKEA
                     VSGFTQALFEAVVIVLAVSFVSLGLRAGFVVSLSIPLVLAITFLSMSLMDISLQRVSL
                     GALIIALGLLVDDAMIAVEMMVARLEHGDPINKAATYVYSHTAFPMLTGTLVTIAGFI
                     PIGLNNSQAGEYTFTLFVVIAVSLLVSWVVAVLFAPLLGVTFLPKKMKPHEEKRSRFF
                     EAFSRVLLLSMRHKWTTIITTIVLFVISVFGMGFIERQFFPQSDRPELVLDWTLPQNS
                     SIADTKAQMERFEETMLKDNPDVEHWSTYVGQGAIRFVLSFDVQPANPYFGQMVVVAR
                     DVEARDRLKAKFEAAFRKDYVGTDVYVKYLELGPPVGRPVQYRISGPDVQKLRGIAQD
                     FAGILSADKRLGVVNYNWNEPGRVIRVDVMQDKARKLGISSKDIATTLNGVVGGITIT
                     QVRDSIYLIDVIARAQAHERDSIDTLQSLQIATGNGTSVPLAAIANFRYELEQPVIYR
                     RSRIPTITVAAGIIDKTMPDTIARDLGPAIKTFADRLPAGYYIQTAGTVEESGKSQGP
                     IAAVVPLMLFVMATVLMVQLQSFQRLFLVVAVAPLGLIGVVAALLPSGKPLGFVAILG
                     VLALIGILIRNSVILIVQVEEDIQEGLHPWDAVMKASQHRMRPIALTAAAASLALIPI
                     AREVFWGPMAYAMMGGIIAGTAITLLFLPALYVAWFRIKEPEHSPDEPHPAS"
     gene            320452..321219
                     /locus_tag="BAB_RS27910"
                     /old_locus_tag="BAB2_0322"
                     /db_xref="GeneID:3828194"
     CDS             320452..321219
                     /locus_tag="BAB_RS27910"
                     /old_locus_tag="BAB2_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002967223.1"
                     /db_xref="GI:489057100"
                     /db_xref="GeneID:3828194"
                     /translation="MNRTTLINAIEGRGLRDPQLAGPLYRSLARILGELIEEGQLAPA
                     VGLPPERDLAEQLGIGRITVRKAYKELLTQGFVESRRGSGTFVAERPVRISQHLWRLT
                     SFSQDMISRGKEPGARVVTNRIDKPSPDEAFRLGIGVDASVVRLDRLRLADGVPMAFE
                     RAVVPRHYLDQDRVDETSLYEALARRGHKPVRALQRLTAVTLDPGTAHLLGVHHGAPA
                     LLIERVSHLEDDRIVEYTRSHYRADAYDFVAELKIGE"
     gene            321222..322253
                     /locus_tag="BAB_RS27915"
                     /old_locus_tag="BAB2_0323"
                     /db_xref="GeneID:3827923"
     CDS             321222..322253
                     /locus_tag="BAB_RS27915"
                     /old_locus_tag="BAB2_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_002965735.1"
                     /db_xref="GI:489055586"
                     /db_xref="GeneID:3827923"
                     /translation="MNSPSSLMLQETEQSPAVVAKLLEKEAGTFAEIARIFRKNDPAV
                     ITTAARGSSDHAATFFKYLIEIATGVPVASIGPSIASVYGSRLKLKNGLHFTVSQSGA
                     SPDIIAAQEAAKKGGATTIAVVNVVESPLARDADIVLALHAGEEKSVAATKSFIASVA
                     ALSGVVAASSGDAGLRGGLERLPEALAATRPEGREVVENLLFNARSLYTGGRGTAFAI
                     SLEAALKAKETANIHAEAFSLAELMHGPMRLIEEGFPIVSFLPRDEAFDTNIAALKRL
                     HSFGASIVTLSDAQTPGFRLPSASTGSPHLDPLVSLINYYRVIEAVTRRKGFDPDKPR
                     NLNKVTVTV"
     gene            322253..323416
                     /locus_tag="BAB_RS27920"
                     /old_locus_tag="BAB2_0324"
                     /db_xref="GeneID:3828195"
     CDS             322253..323416
                     /locus_tag="BAB_RS27920"
                     /old_locus_tag="BAB2_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012460466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="WP_012460466.1"
                     /db_xref="GI:501436849"
                     /db_xref="GeneID:3828195"
                     /translation="MKKSAIAGARIFDGERFHDQSALVFSDGQIEAIVPEASLAEGHE
                     IERLKGGVLAPGFIDAQVNGGGGRMLNDEPTPETMFVIAGGHRKYGTTSLLPTLITDT
                     MPVRDRAIEAAIEAVKADRGVAGLHLEGPHLAPARKGAHLAELMRPVNDADIALYIHT
                     ARQIGTLLVTLAAEQVTPEQVRRLSDGGVIVSIGHSDTTAEEAFRRFDAGARSVTHLY
                     NAMSQIGHRAPGLAGAALDHPDIWCGIVADGHHVDPMALRLALRAKRGDAHLFLVTDA
                     MALVGSDAESFEINGRSVRRVPGGICSKLVLPDGTIAGSDLDMASAVRFAVAELELTL
                     AEALRMASLYPARYLRLNDRGRFRPGMRMDAVHLDDGLFAKSTWLSGEKQIAG"
     gene            323424..324152
                     /locus_tag="BAB_RS27925"
                     /old_locus_tag="BAB2_0325"
                     /db_xref="GeneID:3828196"
     CDS             323424..324152
                     /locus_tag="BAB_RS27925"
                     /old_locus_tag="BAB2_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006153776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965737.1"
                     /db_xref="GI:489055588"
                     /db_xref="GeneID:3828196"
                     /translation="MTEITDRYFNDVIARLSGLRDRLAAQMEKAADLIAAAARADRRV
                     YVFGTGHSHMMAEELHYRAGGLAITVPILCGSIMLQDGAVASSHFERIEGAVRPILDR
                     YGIRDGDVLVVVSNSGVNAAPIEAARYAREKGAAIIALTSVAYSNTIARGRTQLLSLA
                     DVVLDNDAPSGDAVLEIAGSALKVGPVSTALGVTILNAVFADVAARLVGEGDAPIYLS
                     ANMPGSGDINRSLVERYRDHNPHL"
     gene            324296..325180
                     /gene="purU"
                     /locus_tag="BAB_RS27930"
                     /old_locus_tag="BAB2_0326"
                     /db_xref="GeneID:3827822"
     CDS             324296..325180
                     /gene="purU"
                     /locus_tag="BAB_RS27930"
                     /old_locus_tag="BAB2_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091261.1"
                     /note="produces formate from formyl-tetrahydrofolate which
                     is the major source of formate for PurT in de novo purine
                     nucleotide biosynthesis; has a role in one-carbon
                     metabolism; forms a homohexamer; activated by methionine
                     and inhibited by glycine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="WP_002965738.1"
                     /db_xref="GI:489055589"
                     /db_xref="GeneID:3827822"
                     /translation="MLNFVLTVTCKSTRGIVATISGYLAGKGCNIIDSAQFDDLDTGR
                     FFMRVSFISEEGVLLDELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDL
                     LYRWKIGALPIDIVGVVSNHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDT
                     NTELVVLARYMQVLSDEFCQKMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATA
                     HYVTANLDEGPIIEQDVARITHAQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGN
                     RTVVFPASPGSFASERMG"
     gene            complement(325404..326906)
                     /locus_tag="BAB_RS27935"
                     /old_locus_tag="BAB2_0327"
                     /db_xref="GeneID:3828197"
     CDS             complement(325404..326906)
                     /locus_tag="BAB_RS27935"
                     /old_locus_tag="BAB2_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_002967226.1"
                     /db_xref="GI:489057103"
                     /db_xref="GeneID:3828197"
                     /translation="MNTAVRKIDVKKEAADLLSKLGVDASAYTGGDLTGFSPVSGEEI
                     ASIKTHSKEDAEKIIAKADEAFRAWRTVPAPKRGELIRLLGEELRASKEDLGRLVSLE
                     AGKIPSEGLGEVQEMIDICDFAVGLSRQLYGLTIATERAGHRMMETWHPLGVVGVISA
                     FNFPVAVWSWNAALAIVCGNAVVWKPSEKTLLTALACDAIFKRALKRFGDAPEGISQL
                     LLGDREIGEVLVDSPKVPVVSATGSTRMGREVGPRLAKRFARAILELGGNNAGIVCPS
                     ADLDMALRAIAFGAMGTAGQRCTTLRRLFVHESVYDALVPRLQKAYASVSVGSPLETS
                     ALVGPLIDKQAFDNMQKALKEAAAHGGKVQGGERVDTGYENAYYVRPAIVEMPRQEGP
                     VLEETFAPILYVMKYSDFDDVLASHNAVGAGLSSSIFTLNLQEAERFLSAEGSDCGIA
                     NVNIGTSGAEIGGGRESGSDAWKAYMRRATNTINYSKALPLAQGVSFDID"
     gene            complement(326980..328380)
                     /locus_tag="BAB_RS27940"
                     /old_locus_tag="BAB2_0328"
                     /db_xref="GeneID:3828198"
     CDS             complement(326980..328380)
                     /locus_tag="BAB_RS27940"
                     /old_locus_tag="BAB2_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967227.1"
                     /db_xref="GI:489057104"
                     /db_xref="GeneID:3828198"
                     /translation="MKDQKFVSPDAIRSAFSAAMSAMYREEVPAYGTLMDLVADVNAK
                     VLADDSHLHERLAETDALDRISEERHGAIRLGTAAELSMMRRVFAVMGMFPVGYYDLS
                     AAGVPVHSTAFRPVNDAALKHNPFRVFTSLLRLDLITDEKLRAQSQDVLSKRNIFMAG
                     AVALVEKAEAEGGLLEEDAKTFVAEVLETFRWHDRANVSAELYHRLHDAHRLIADVVS
                     FKGPHINHLTPRTLDIDAVQEQMPQRGINPKAVVEGPPTRNCPILLRQTSFKALEEEV
                     SFIGDNGEWTPGSHTARFGEIEQRGVALTPKGRALYDKLLNDTRAIVRPAPDGSNASD
                     YVKALGDTFAAFPDTWAGIREEGLGYFAYSVKDAAKLASFRPGTDIEVLIEAGAVQFD
                     PITYEDFLPVSAAGIFQSNLGDDETQEFVESPNQKRFEDDLGAKVLNEFEHYARIERE
                     SIEALQAGLKGLEAAE"
     gene            328528..329460
                     /locus_tag="BAB_RS27945"
                     /old_locus_tag="BAB2_0329"
                     /db_xref="GeneID:3828199"
     CDS             328528..329460
                     /locus_tag="BAB_RS27945"
                     /old_locus_tag="BAB2_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002965741.1"
                     /db_xref="GI:489055592"
                     /db_xref="GeneID:3828199"
                     /translation="MNLSRRLIPDIATLQAFECAARHGSFTQAAHELNLTQSAVSRQI
                     KDLESQLGVLLFERIRQRILLSDAGRKFLPEVRRLLNQTEDTMLRAMASAQSTSSFSI
                     ATLPTFGTRWLMPRIPDFVEKHPGIALNVASRSGVFDFEEQPFDLAIHYGQPVWAHAT
                     CTFLCSEVIVPVASPSLLKTRRPASPEELENEPLLHLATRPKMWAQWFESCGVEGQSA
                     YRGHRFEQFSMVIGAALAGLGFALLPLYLIEQELRSGELVLLFEKPMRTENEYYLVVP
                     EGKLENPLTQVFCQWIAGQVGNTDYSSLVHSKPE"
     gene            329560..330843
                     /locus_tag="BAB_RS27950"
                     /old_locus_tag="BAB2_0330"
                     /db_xref="GeneID:3828200"
     CDS             329560..330843
                     /locus_tag="BAB_RS27950"
                     /old_locus_tag="BAB2_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_002965742.1"
                     /db_xref="GI:489055593"
                     /db_xref="GeneID:3828200"
                     /translation="MLNDPRSHGLWEKTAPAAPKTTALQGDLAADVVIVGGGFTGLST
                     ALHLAEKGVCAIVLEGIEIGYGGSGRNVGLVNAGMWVMPDDLPGVLGQKYGDRLLDVL
                     GNAPKLVFEIIEKHKIACEVEKQGTLHCAVGQKGLKELEDRHEQWARRGANVKLLDAR
                     ETEARVGTRAYTGSLLDLRAGTVQPLAYVRGLAHAAIAAGATVFTGSPVIGAEEKNGK
                     WVVRTARGSVTANWVVVATNAYTNAPWAEVRAELVHLPYFNMATKPLSDNLKKSILPE
                     RQGVWDTKEVLSSFRFDQQGRLVFGSVGALRNTGAAVHKAWAKKSLKRLFPQIGAVEF
                     EAEWYGKIGMTNDSLPKFHRLARNVVGFSGYNGRGNAPGTVFGKLLSQLVSGEISEAD
                     LPLPVSDLKEQNFRGLREAYYEAGAQVAHVAEMVI"
     gene            complement(330938..333069)
                     /locus_tag="BAB_RS27955"
                     /note="transcription accessory protein; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23672524"
     gene            333449..333757
                     /locus_tag="BAB_RS27960"
                     /old_locus_tag="BAB2_0334"
                     /db_xref="GeneID:3828204"
     CDS             333449..333757
                     /locus_tag="BAB_RS27960"
                     /old_locus_tag="BAB2_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_002965744.1"
                     /db_xref="GI:489055595"
                     /db_xref="GeneID:3828204"
                     /translation="MSDVQPIPLDEILKALANPVRLDILSWLKEPEKHFSGQHMPLEM
                     GVCAGQFERCGLSQSSVSAHLSVLTKAGLIMPHRVGQWTFYKRDEEAIAAAIKALSAL
                     "
     gene            333801..334916
                     /locus_tag="BAB_RS27965"
                     /old_locus_tag="BAB2_0335"
                     /db_xref="GeneID:3828205"
     CDS             333801..334916
                     /locus_tag="BAB_RS27965"
                     /old_locus_tag="BAB2_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008511071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,2-oxophytodienoate reductase"
                     /protein_id="WP_002965745.1"
                     /db_xref="GI:489055596"
                     /db_xref="GeneID:3828205"
                     /translation="MASLFDPITIGDLKLANRIVMAPLTRNRSPHAVPNDLNVIYYEQ
                     RASAGLIITEATPISQQGQGYADVPGLYSAEQLAGWRRVSDAVHNAGGKIVAQMWHVG
                     RISHNSLQPNGEKPVAPSAITAKSKTYLVHPDGAGEFVPTSEPRALEKSELPGIVADY
                     ARAAKDAVETAGFDGVEIHAANGYLIDQFLRGGSNQRTDEYGGSIENRARFLFEVVDA
                     VTKAIGAGKVGIRLSPVTPANDASDPDPQPLFDYVIGKLAACGLAYIHIIEGATGGPR
                     DFQQGPQPFDYARFKQVYRDAGGKAAWMVNNGYDRKMAEEEVEAGRADLVAFGKPFIA
                     NPDLVRRLKENAPLNELDQKHMYGGGAKGYTDYPVLA"
     gene            complement(334954..335391)
                     /locus_tag="BAB_RS27970"
                     /old_locus_tag="BAB2_0336"
                     /db_xref="GeneID:3828206"
     CDS             complement(334954..335391)
                     /locus_tag="BAB_RS27970"
                     /old_locus_tag="BAB2_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010659538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002965746.1"
                     /db_xref="GI:489055597"
                     /db_xref="GeneID:3828206"
                     /translation="MDDLDEKLITLLRHNGRRSISDIAIDLGVSRATVRARMERLERS
                     GDILGYTVILRSDAVDLPVRGIMMIEIEGHVADRVVKALGGFSEISAIHTTNGRFDLV
                     VELGAATLTDFDAVLRRIRLVPGIKASETNLLLATPRSTRARL"
     gene            335522..336442
                     /locus_tag="BAB_RS27975"
                     /old_locus_tag="BAB2_0337"
                     /db_xref="GeneID:3827836"
     CDS             335522..336442
                     /locus_tag="BAB_RS27975"
                     /old_locus_tag="BAB2_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="WP_002965747.1"
                     /db_xref="GI:489055598"
                     /db_xref="GeneID:3827836"
                     /translation="MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTD
                     LGNLAPAAQRPLQHPNHAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGT
                     VPGIARRAAEKGRKQFVLWLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKL
                     AAPIDPHNVCMLGIRSVDPAEREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAED
                     GLLHVSLDVDFLDPSIAPAVGTTVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFL
                     DERGRTAAVMVDLMASLLGRSVMDRPTISY"
     gene            336481..337557
                     /locus_tag="BAB_RS27980"
                     /old_locus_tag="BAB2_0338"
                     /db_xref="GeneID:3828207"
     CDS             336481..337557
                     /locus_tag="BAB_RS27980"
                     /old_locus_tag="BAB2_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133452.1"
                     /note="catalyzes the formation of L-proline from
                     L-ornithine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="WP_002965748.1"
                     /db_xref="GI:489055599"
                     /db_xref="GeneID:3828207"
                     /translation="MTQPNLNIVPFVSVDHMMKLVLRVGVETFLKELAGYVEEDFRRW
                     QNFDKTPRVASHSKEGVIELMPTSDGTLYGFKYVNGHPKNTRDGLQTVTAFGVLADVG
                     SGYPMLLTEMTILTALRTAATSAVAAKHLAPKNARTMAIIGNGAQSEFQALAFKAILG
                     VDKLRLYDLDPQATAKCIRNLQGAGFNIVACKSVEEAVEGADIITTVTADKANATILT
                     DNMVGAGVHINAVGGDCSGKTELHGDILRRSDIFVEYPPQTRIEGEIQQLPEDYPVNE
                     LWEVITGRIAGRKDARQITLFDSVGFATEDFSALRYVRDKLKDTGLYEQLDLLADPDE
                     PRDLYGMLLRHEKLLQSESTKPAA"
     gene            complement(337570..337995)
                     /locus_tag="BAB_RS27985"
                     /old_locus_tag="BAB2_0339"
                     /db_xref="GeneID:3828208"
     CDS             complement(337570..337995)
                     /locus_tag="BAB_RS27985"
                     /old_locus_tag="BAB2_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatC"
                     /protein_id="WP_002967231.1"
                     /db_xref="GI:489057108"
                     /db_xref="GeneID:3828208"
                     /translation="MTILINQPHPSIDRDSIDRLVEIFYGRAREDEIIGPIFNRTVKD
                     WDHHLARISEFWSSVILKTGGYDGRPMPPHLALNLENEHFDLWLELFEQTAQEIFPPE
                     AAIIFVDRARRIADSFEMAIATHSGRIRAPRHSRLPLIS"
     gene            complement(338160..338315)
                     /locus_tag="BAB_RS27990"
                     /db_xref="GeneID:23672525"
     CDS             complement(338160..338315)
                     /locus_tag="BAB_RS27990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972117.1"
                     /db_xref="GI:489062090"
                     /db_xref="GeneID:23672525"
                     /translation="MNQNNPSPKKAVTLSGDQSSGGDSAGSTLTPMLIGGLVLVIIGG
                     IAVMMFV"
     gene            complement(338585..338659)
                     /locus_tag="BAB_RS27995"
                     /old_locus_tag="BAB2_1167"
                     /db_xref="GeneID:3827789"
     tRNA            complement(338585..338659)
                     /locus_tag="BAB_RS27995"
                     /old_locus_tag="BAB2_1167"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(338625..338627),aa:Gly,seq:gcc)
                     /db_xref="GeneID:3827789"
     gene            339011..339532
                     /locus_tag="BAB_RS28000"
                     /old_locus_tag="BAB2_0342"
                     /db_xref="GeneID:3827556"
     CDS             339011..339532
                     /locus_tag="BAB_RS28000"
                     /old_locus_tag="BAB2_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_002972116.1"
                     /db_xref="GI:489062089"
                     /db_xref="GeneID:3827556"
                     /translation="MPLTPKEFHDLLHKLGIGVTTVEHPPLFTVADSQNLRGEIPGGH
                     TKNLFLKDKKDNFFLVTVEEDAVVDLKSIHQLIGAASRVSFGKPEKLMEYLGVIPGSV
                     TVFGAANDTNHRVQVILDAGLMKYDIINGHPLTNEATTSIRREDLIAFLKSTGHEPRI
                     LAVSEGAKLAATV"
     gene            339765..340754
                     /locus_tag="BAB_RS28005"
                     /old_locus_tag="BAB2_0343"
                     /db_xref="GeneID:3827798"
     CDS             339765..340754
                     /locus_tag="BAB_RS28005"
                     /old_locus_tag="BAB2_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_002965753.1"
                     /db_xref="GI:489055604"
                     /db_xref="GeneID:3827798"
                     /translation="MRGIPMTSQDNPYGGAYGGPASQMTANVSFGQPSAPANGGDLIK
                     DTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLTPIIEKAVREARGAVKLVKMNID
                     EHPAIAGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEA
                     IATVKELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLA
                     AEKQNEAPVRALEARLALADQVKLIGDPVELERRLAADPGDYQARFDLAQVRNAQGRR
                     DDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTARRKLSSLLFS"
     gene            340818..341522
                     /locus_tag="BAB_RS28010"
                     /old_locus_tag="BAB2_0344"
                     /db_xref="GeneID:3827557"
     CDS             340818..341522
                     /locus_tag="BAB_RS28010"
                     /old_locus_tag="BAB2_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_002968836.1"
                     /db_xref="GI:489058753"
                     /db_xref="GeneID:3827557"
                     /translation="MQVGNARYRTAADIPDVVPVFPLKGALLLPGGQLPLNIFEPRYL
                     SMVENALAGKRIIGMIQPKIDSETDDTDEPVDALDESLRPELSQVGCLGRITTFAETG
                     DGRLLITLQGICRFRVQEELHCRQPYRQCRIMPFLADLEQAQDAGDIDREALLRAFRD
                     YLEAHNLEADWESIARAGNETLVNAFSIMSPFGPAEKQALLEAPDLKTRAATLIAITE
                     MVLAKVKDDDFGSRLQ"
     gene            341699..341893
                     /locus_tag="BAB_RS28015"
                     /old_locus_tag="BAB2_0345"
                     /db_xref="GeneID:3827558"
     CDS             341699..341893
                     /locus_tag="BAB_RS28015"
                     /old_locus_tag="BAB2_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q579B2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965755.1"
                     /db_xref="GI:489055606"
                     /db_xref="GeneID:3827558"
                     /translation="MDDKVETGNIDVRLLELLVCPLTKGPLEYDAERSELVSRKARLA
                     YPVRGGIPIMLPSEARSLTE"
     gene            342193..343305
                     /locus_tag="BAB_RS28020"
                     /old_locus_tag="BAB2_0346"
                     /db_xref="GeneID:3827559"
     CDS             342193..343305
                     /locus_tag="BAB_RS28020"
                     /old_locus_tag="BAB2_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_002965756.1"
                     /db_xref="GI:489055607"
                     /db_xref="GeneID:3827559"
                     /translation="MASRKLLLLPGDGIGPEAMAEVRKVIAFLNSDLNLGFETEEGLV
                     GGCAYDAHGQAISDADMEKALAADSVLFGAVGGPKWDSVPYEVRPEAGLLRLRKDMQL
                     YANLRPAICYPALAHSSSLKPEVIEGLDILILRELTGGVYFGEPKEIIDLGNGQKRGI
                     DTQVYDTYEIERIADVAFELARTRRNKVTSMEKRNVMKSGVLWNQGVTARHKEKHADV
                     QLEHMLADAGGMQLVRWPKQFDVILTDNLFGDLLSDVAAMLTGSLGMLPSASLGAADS
                     KTGKRKALYEPVHGSAPDIAGKGIANPIAMIASLAMCLRYSFGLVAEADRLEAAIAGV
                     LDDGIRTADIWSEGNTKVGTTEMGDAILAKFKALSA"
     gene            343446..344498
                     /locus_tag="BAB_RS28025"
                     /old_locus_tag="BAB2_0347"
                     /db_xref="GeneID:3827560"
     CDS             343446..344498
                     /locus_tag="BAB_RS28025"
                     /old_locus_tag="BAB2_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-O-methylguanine DNA methyltransferase"
                     /protein_id="WP_002967232.1"
                     /db_xref="GI:489057109"
                     /db_xref="GeneID:3827560"
                     /translation="MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPAR
                     KPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEAEILVKKLLNALETDPERRWSEE
                     DVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHGFQVLAGGGCVIDAQVDAGFESP
                     EAFRSAFVRIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPA
                     ELKKLHAACRGDIGIGRFETHDLVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWREL
                     QNIRAGETRSYSEIARAIEKPLAVRAVARANGANQIAIVIPCHRVIGADGALTGYGGG
                     LWRKQKLIEIEAQYRR"
     gene            complement(344556..346454)
                     /locus_tag="BAB_RS28030"
                     /old_locus_tag="BAB2_0348"
                     /db_xref="GeneID:3827561"
     CDS             complement(344556..346454)
                     /locus_tag="BAB_RS28030"
                     /old_locus_tag="BAB2_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002965758.1"
                     /db_xref="GI:489055609"
                     /db_xref="GeneID:3827561"
                     /translation="MAVSSSAAAGAQKMTGEERKVIFASSLGTVFEWYDFYLYGTLAS
                     FIGAAFFNEYPEATRNIFVLLAFAAGFLVRPFGALVFGRIGDLVGRKYTFLVTIVIMG
                     GSTFLVGLLPGSASLGIFAPIILIALRMLQGLALGGEYGGAATYVAEHAPNNRRGFFT
                     SWIQTTATLGLFLSLLVILGAQTLLSKDAFAAWGWRIPFLVSVLLLGISVWIRMQMSE
                     SPAFKRMKEEGKTSKAPLSEAFGQWKNAKIALIALFGLTAGQAVVWYCGQFYALFFLQ
                     NVLKVENQSANIMVAIALLIGTGFFVIFGWLSDKIGRKPIIMAGLILAAVTYFPLFKA
                     LTNAANPALAQAEQTVKATVTAAPGDCNFQFNATGTSKFTTSCDVATSFLAKSSVPYE
                     TVQTAAPGTPATITIGDTTIQSYDAVQAGADAAAKQAALAHGVNLALQQAGFPLVRDT
                     AKVPDSKLDAFVAANPELQLNADAIRAGDAKTMVSAADLVKQKLLTQSEAESLGVSSE
                     QAVYSIPNAGAFKMVADPAQVNWVLTIAILTILVIYVTMVYGPIAAILVEMFPTRIRY
                     NGMSLPYHIGNGWFGGLLPAGVFALSAAKGDIYYGLWYPIIIASVTFVIGMLFVKETK
                     GVDLNKVD"
     gene            346977..348011
                     /locus_tag="BAB_RS28035"
                     /old_locus_tag="BAB2_0349"
                     /db_xref="GeneID:3827562"
     CDS             346977..348011
                     /locus_tag="BAB_RS28035"
                     /old_locus_tag="BAB2_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006110468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="WP_002965759.1"
                     /db_xref="GI:489055610"
                     /db_xref="GeneID:3827562"
                     /translation="MGFKVAVAGATGNVGREMLNILEERGFPADEVVPLASRRSQGTE
                     VSYGDKTLKVRALDTYDFSDTDICLMSAGGSVSQEWSPKIGRQGCVVIDNSSAWRYDA
                     DVPLIVPEVNPDAIAGFTKKNIIANPNCSTAQLVVALKPLHDAAKIKRVVVSTYQSVS
                     GAGKEGMDELFEQSRAVFVADPISTKKFTKRIAFNVIPHIDVFMEDGYTKEEWKMVAE
                     TKKMLDPKIKLTATAVRVPVFIGHSEAVNIEFENPITPEEAREILREAPGCQVIDKHE
                     NGGYITPYESAGEDATFISRIREDITVENGLAMWVVSDNLRKGAALNAIQIAELLVAR
                     GLIKPKALAA"
     gene            complement(348075..348530)
                     /locus_tag="BAB_RS28040"
                     /old_locus_tag="BAB2_0350"
                     /db_xref="GeneID:3827563"
     CDS             complement(348075..348530)
                     /locus_tag="BAB_RS28040"
                     /old_locus_tag="BAB2_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_002965760.1"
                     /db_xref="GI:489055611"
                     /db_xref="GeneID:3827563"
                     /translation="MMHKKPDTNLDLADMLCFAVYSTANALSRAYQPILAPLDLTYPQ
                     FLVMLVLWERDDCTVSEIGARLNLDSGTLTPLLKRLEAAGRITRRRDPRDERQVRITL
                     TDEGRKLREQAESVPEQIMCATGQPVSELQDLRNRLMKIRNHLTADGKK"
     gene            348736..349158
                     /locus_tag="BAB_RS28045"
                     /old_locus_tag="BAB2_0351"
                     /db_xref="GeneID:3828035"
     CDS             348736..349158
                     /locus_tag="BAB_RS28045"
                     /old_locus_tag="BAB2_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010658490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="WP_002965761.1"
                     /db_xref="GI:489055612"
                     /db_xref="GeneID:3828035"
                     /translation="MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGT
                     NPEQLFASGYAACFLGALKFAAAKEKISIPAESTVTATVGIGPREDGTGFGLDVALSI
                     ALPGIDKAKAEELVQAAHIVCPYSHATRGNLDVRLSVA"
     gene            complement(349209..349631)
                     /locus_tag="BAB_RS28050"
                     /old_locus_tag="BAB2_0352"
                     /db_xref="GeneID:3827564"
     CDS             complement(349209..349631)
                     /locus_tag="BAB_RS28050"
                     /old_locus_tag="BAB2_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent protease"
                     /protein_id="WP_002968543.1"
                     /db_xref="GI:489058447"
                     /db_xref="GeneID:3827564"
                     /translation="MAREDQSGDWAGRFSPSLDEIESIAIDALAHLPQEFRALCGDII
                     IQIGDFPEDQIIEDMGLETPFDLLGLFEGRGIGERFSLQTGEGPNRITLYRRAILDYW
                     AEHDETLGDIISHVLIHEIGHHFGLSDDDMENIESQAE"
     gene            complement(349717..350322)
                     /locus_tag="BAB_RS28055"
                     /old_locus_tag="BAB2_0353"
                     /db_xref="GeneID:3827173"
     CDS             complement(349717..350322)
                     /locus_tag="BAB_RS28055"
                     /old_locus_tag="BAB2_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011950014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_002965763.1"
                     /db_xref="GI:489055614"
                     /db_xref="GeneID:3827173"
                     /translation="MDKFTKLTGVAAPLPIVNIDTDMIIPKDYLKTIKRTGLGKGLFA
                     EMRFNEDGSENPDFVLNKPGYRKAQILVAGDNFGCGSSREHAPWALLDYGIRCVISTS
                     FADIFYNNCFKNGILPIKVAQEDLDKLMDDASRGANATLTIDLETKQIHGPDGGTISF
                     DLDDFKRHCLLNGLDDIGLTMEKAKSIDTFEAKNAEERPWA"
     gene            350627..351622
                     /locus_tag="BAB_RS28060"
                     /old_locus_tag="BAB2_0355"
                     /db_xref="GeneID:3827566"
     CDS             350627..351622
                     /locus_tag="BAB_RS28060"
                     /old_locus_tag="BAB2_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_002968944.1"
                     /db_xref="GI:489058863"
                     /db_xref="GeneID:3827566"
                     /translation="MALNKMSVVLPPVSFQTISGLGPQLFSVLALWGCSVHKSGMKTI
                     VRPRRSVLFVPAANTRALEKSLTLSADCVIYDLEDSVAPEAKAAACEALAAHLSAHPK
                     VAFERIVRVNAADTPWGRDDVAAVAKMAVNAVLLPKVERPQDVIEAANHLDRQDADPA
                     MGVWAMIETPRGILNVDEIAVLGHRSAVRLACFVVGPNDIARETGLRSQPGRPYLAPW
                     LMQIVLAARAGGIAVLDGVYNDFRDSAGFEAECAQGAAMGFDGKTLIHPGQIEAANRA
                     FSPTEEEVAHARAVREIFARPENAGKGVVSLDGQMVERLHLEMAERILAKAGINL"
     gene            351640..351846
                     /locus_tag="BAB_RS28065"
                     /old_locus_tag="BAB2_0356"
                     /db_xref="GeneID:3827567"
     CDS             351640..351846
                     /locus_tag="BAB_RS28065"
                     /old_locus_tag="BAB2_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965766.1"
                     /db_xref="GI:489055617"
                     /db_xref="GeneID:3827567"
                     /translation="MKLYRFITGPDDSAFCHRVTAALNKGWQLYGSPTYAFNAATGVM
                     HCGQPVVKEVDGVDYTPDIKLGEY"
     gene            351846..352199
                     /locus_tag="BAB_RS28070"
                     /old_locus_tag="BAB2_0357"
                     /db_xref="GeneID:3827568"
     CDS             351846..352199
                     /locus_tag="BAB_RS28070"
                     /old_locus_tag="BAB2_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_002965767.1"
                     /db_xref="GI:489055618"
                     /db_xref="GeneID:3827568"
                     /translation="MAVRRIVANISASDPAAARRFYGDLLGLDVAMDFGWIVTYAGDA
                     EARVQVSVMSEGGAGTPVPDLSIEVDDVDAVLERAIALGFSIEYGPADEEWGVRRFYT
                     RDSYGRLVNILTHKH"
     gene            complement(352228..354276)
                     /locus_tag="BAB_RS28075"
                     /old_locus_tag="BAB2_0358"
                     /db_xref="GeneID:3828146"
     CDS             complement(352228..354276)
                     /locus_tag="BAB_RS28075"
                     /old_locus_tag="BAB2_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="WP_002967234.1"
                     /db_xref="GI:489057111"
                     /db_xref="GeneID:3828146"
                     /translation="MSDKPPYNHALSEWNGPLGLPDFTAFKDEDFAPAFDVALAQDLA
                     EVEAIAGQAGEPTIDNTLKALQLTGKALERVSSIFWLRAGAHTNNTIQALEREIAPKM
                     SRHYSRIMMDPALFARIDALDENRDMLDLDSETRRVLEKTWKGFVRSGAKLDAAGKTE
                     LADINEKLAGLGARFGQNVLKDESGWALFITDEADLAGLPDFLKNAMQSAAAERGKPD
                     AWAVTLSRSIVEPFLSFSQNRSLREQAFNAWAKRGENGGETDNREIVREMVDLRERKA
                     HLLGYANFAAYKLDDTMAKTPKAVMDLLEPVWNKARAKAAEEEAELERLIAADGGNHK
                     VAPWDWRFYAEKLRAERFAFDEAELKPYLQLDKIIEAAFDVAGRLFGIRFEEKKGIAT
                     WHPDVRVFQVFNADGSERGLFLGDYFARTSKRSGAWMSSLQSSHKLGNGQKPIIYNVM
                     NFAKPKAGEPALLSLDDARTLFHEFGHALHGLLSDVTWPAVSGTAVSRDFVELPSQLY
                     EHWLTVPAVLEKYAVHYRTGEAMPKALLDKVLAARTFNAGFNTVEFTSSALVDMAFHT
                     GKEKIADPLAFEKQTLAKLSMPDAIIMRHRTPHFTHVFSGDGYSAGYYSYMWSEVLDA
                     DAFSAFEETGDAFNPELAAKLKQHIYAAGGSRDPEELYKAFRGKMPTPDAMIEKRGLN
                     "
     gene            354602..355999
                     /locus_tag="BAB_RS28080"
                     /old_locus_tag="BAB2_0360"
                     /db_xref="GeneID:3827182"
     CDS             354602..355999
                     /locus_tag="BAB_RS28080"
                     /old_locus_tag="BAB2_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017822053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_002965770.1"
                     /db_xref="GI:489055621"
                     /db_xref="GeneID:3827182"
                     /translation="MTGLKPDNNFFAEVLNVADLPAAAIASRITDMRTGDAVEIVNEL
                     DADDAVAVIAQLSHDDAIRLLDQPELHRAAEIVAALQPGLASLLLDGMSADRATDVFQ
                     ELEDVDRARLFPILAPETKAALKKLMGYPPNTAGSLMTIEFIAVPSNWTVGQTLDHIR
                     KVERTRETVYAIYVVDPLSRVLLGVVSLRRLIIRQPDEPILSIARDDEPITISPLASR
                     EEVARLFRKHDLLAVPVVDEGRHIIGIVTVDDVLDAMTEEASEDAYRFGGMEALDKPY
                     MRIGFGEMLKKRAGWLGILFLGEMLTASAMQHFEAELEKALVLTLFIPLIMSSGGNSG
                     SQATSLIIRALALQEIKLKDWWRVALREIPSGLALGGFLGFIGIIRITTWQTLGIYDY
                     GEHWILVAFTVGMALVSIVTFGSLTGSMLPFVLQRLGFDPASASAPFVATLVDVTGLV
                     IYFSVALVILSGTLL"
     gene            356242..358068
                     /locus_tag="BAB_RS28085"
                     /old_locus_tag="BAB2_0361"
                     /db_xref="GeneID:3827570"
     CDS             356242..358068
                     /locus_tag="BAB_RS28085"
                     /old_locus_tag="BAB2_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein TypA"
                     /protein_id="WP_002965771.1"
                     /db_xref="GI:489055622"
                     /db_xref="GeneID:3827570"
                     /translation="MELRNIAIIAHVDHGKTTLVDELLKQSGSFRENQRVAERMMDSN
                     DIEKERGITILAKATSVVWKNTRINIVDTPGHADFGGEVERILSMVDGAIVLVDAAEG
                     PMPQTKFVVGKALKVGLKPIVAINKIDRPDGRHEEVVNEVFDLFANLDATDEQLDFPI
                     LYGSGRNGWMALSPEGPKDQGLAPLFDLVLKHVPAPKVAEGPFRMIGTILEADPFLGR
                     IITGRIHSGSIKPNQAVKVLGQDGSVLENGRISKILAFRGIERQAIDEAHAGDIVAIA
                     GLSKGTVADTFCDPSVSEPLAAQPIDPPTVTMSFIVNDSPYAGTEGDKVTSRVIRDRL
                     LKEAEGNVALKIEESTEKDSFFVSGRGELQLAVLIENMRREGFELGVSRPRVVMKDGE
                     NGEKLEPVEEVVIDVDEEYSGTVVQKMSERKAEMVELRPSGGNRVRLVFYAPTRGLIG
                     YQSELLTDTRGTAIMNRLFHDYQPYKGEIAGRNNGVLISNDQGEAVAYALFNLEDRGP
                     MIIEAGVKVYQGMLIGIHSRDNDLEVNVLKGKKLTNIRAAGKDEAVKLTPPIKMTLER
                     ALSWIQDDELVEVTPKSIRLRKLYLDPNERKRFEKSKSSSAA"
     gene            358220..358807
                     /locus_tag="BAB_RS28090"
                     /old_locus_tag="BAB2_0362"
                     /db_xref="GeneID:3827571"
     CDS             358220..358807
                     /locus_tag="BAB_RS28090"
                     /old_locus_tag="BAB2_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965772.1"
                     /db_xref="GI:489055623"
                     /db_xref="GeneID:3827571"
                     /translation="MFTISRVETFSQEIKKSRFLAIAAPVASEEAAKDFLHEYSDLSA
                     THNCWAWRMGQNYRFSDDGEPSGTAGKQILQAIDGQQLDNIVVVVTRWFGGILLGSGG
                     LMRAYGGTAASCLRQAEKTEVIALVGFALACDFSDHALLKARLTAVKNVAILQENFTA
                     TGVEMTGAMPIAAKDDLSRLVSDLTRGKTIITFDE"
     gene            359038..359244
                     /locus_tag="BAB_RS28095"
                     /old_locus_tag="BAB2_0363"
                     /db_xref="GeneID:3827572"
     CDS             359038..359244
                     /locus_tag="BAB_RS28095"
                     /old_locus_tag="BAB2_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016769709.1"
                     /db_xref="GI:515140984"
                     /db_xref="GeneID:3827572"
                     /translation="MVPDFVPELLAPKLVAKKPRFMAFRLARRLPLMNFAPPVFDKLQ
                     RVQCIRVLSLDTAHLAGDFQEQGQ"
     gene            359241..360263
                     /locus_tag="BAB_RS28100"
                     /old_locus_tag="BAB2_0364"
                     /db_xref="GeneID:3827573"
     CDS             359241..360263
                     /locus_tag="BAB_RS28100"
                     /old_locus_tag="BAB2_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006274321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase class 1"
                     /protein_id="WP_002965774.1"
                     /db_xref="GI:489055625"
                     /db_xref="GeneID:3827573"
                     /translation="MTLVGNFSPLVLVGDSDRVEAETVGAYLDGWAGHDKVRLATANA
                     IKAILSGAGRLVGRIARGYLPGDPGKLVGVNSDQDQQKSIDVGSHNLFVELLIAAGVA
                     SILSEEADLPVAGKADGLVAVAIDPLDGSGNVGLGAPLGTIFSIFPADVEEPFLQPGN
                     RQIAAGYVSYGNSVDLGFSVGEGVIFATLDPVSGQFHITRRNVKLPERTSDLAFNASV
                     QRHLSAGMQAYVNDAFLGKDGPRGRNFNMRWLGAAVGDMHRIMQRGGLFFYVNDSRPG
                     YEKGRLRLVYEANPIAFLAREAGGKATDGSRPILDIVPQTYHERSALVFGVAEEVDIL
                     GEYFVK"
     gene            360294..361358
                     /locus_tag="BAB_RS28105"
                     /old_locus_tag="BAB2_0365"
                     /db_xref="GeneID:3828210"
     CDS             360294..361358
                     /locus_tag="BAB_RS28105"
                     /old_locus_tag="BAB2_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799936.1"
                     /note="class II aldolase; catalyzes the reversible aldol
                     condensation of dihydroxyacetonephosphate and
                     glyceraldehyde 3-phosphate in the Calvin cycle, glycolysis
                     and gluconeogenesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_002965775.1"
                     /db_xref="GI:489055626"
                     /db_xref="GeneID:3828210"
                     /translation="MARITLRQLLDHAAEKGYGVPAFNINNMEQALAIMEAANAVDAP
                     VILQASRGARSYANDIMLRHMMDAVAEIYPHIPVCVHLDHGNEAATCMSAIQAGFTSV
                     MMDGSLKADGKTPADWDYNVSVTRQVSEMSHLGGISVEGELGVLGSLETGMGDVEDGH
                     GAEGKLSHDQLLTDPDEAVKFVRETKVDALAIAMGTSHGAYKFSRKPDGSVLAMHVIE
                     EIHRKLPNTHLVMHGSSSVPEELQEIINKYGGQMKPTWGVPVEEIQRGIKHGVRKINI
                     DTDNRMAMTGQIRRILQEEPSEFDPRKYLKPAMAAMTKLCKERFEQFGTAGHAASIRP
                     IPLSEMAKRYRDGSLDPKFS"
     gene            complement(361425..361880)
                     /locus_tag="BAB_RS28110"
                     /old_locus_tag="BAB2_0366"
                     /db_xref="GeneID:3827515"
     CDS             complement(361425..361880)
                     /locus_tag="BAB_RS28110"
                     /old_locus_tag="BAB2_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002969302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="WP_002969302.1"
                     /db_xref="GI:489059231"
                     /db_xref="GeneID:3827515"
                     /translation="MKVAVAGDSAGEGLAKVLADHLKDRFEVSEISRTDAGADAFYAN
                     LSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQ
                     IITMGARVIGAEVAKTIADAFLAQTFDENGRSAGNVNAINEVDAKYNKF"
     gene            complement(361892..362662)
                     /locus_tag="BAB_RS28115"
                     /old_locus_tag="BAB2_0367"
                     /db_xref="GeneID:3827783"
     CDS             complement(361892..362662)
                     /locus_tag="BAB_RS28115"
                     /old_locus_tag="BAB2_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FVH2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Triosephosphate isomerase 2"
                     /protein_id="WP_002965777.1"
                     /db_xref="GI:489055628"
                     /db_xref="GeneID:3827783"
                     /translation="MTKFWIGTSWKMNKTLAEARLFAEALKAADAGRSPDIQRFVIPP
                     FTAVREVKEILSGTSVKVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREH
                     FGETNETVGLKVEAAVRHGLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQK
                     QAEILFAYEPVWAIGENGIPASADYADARQAEIIAVAQSVLARRVPCLYGGSVNPGNC
                     EELIACPHIDGLFIGRSAWNVEGYLDILARCATKVQAN"
     gene            complement(362675..363439)
                     /locus_tag="BAB_RS28120"
                     /old_locus_tag="BAB2_0368"
                     /db_xref="GeneID:3827516"
     CDS             complement(362675..363439)
                     /locus_tag="BAB_RS28120"
                     /old_locus_tag="BAB2_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR faimly transcriptional regulator"
                     /protein_id="WP_002965778.1"
                     /db_xref="GI:489055630"
                     /db_xref="GeneID:3827516"
                     /translation="MKRDDRRQAIINLLIENQAVDLDDLAGRFAVSKMTIHRDLDSLE
                     QSGVLRKVRGGATIDAGTQFESDFRFRERQDGEAKLKMARAALELVEPGMTVMVNDGS
                     MAALLGGMLREKRPLTVITNNAVIIDELKGENGINLIALGGTYSAKFNAFFGILTEEA
                     LARLSADIAFVSSPAVNGQLVYHMDENVVRTKRAMTNAAARSCLLVNHQRFGRPALHV
                     MADLTDFDAIITDASPGTAVLNGLKQAGIKLTIAAD"
     gene            complement(363527..364477)
                     /locus_tag="BAB_RS28125"
                     /old_locus_tag="BAB2_0369"
                     /db_xref="GeneID:3828209"
     CDS             complement(363527..364477)
                     /locus_tag="BAB_RS28125"
                     /old_locus_tag="BAB2_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002965779.1"
                     /db_xref="GI:489055631"
                     /db_xref="GeneID:3828209"
                     /translation="MADADDSLALRAAWLHFVAGMTQSAVAKRLGLPSVKAHRLIAKA
                     VADGAVKVTIDGDITECIDLENRLADLYGLDYCEVAPDIGEEGLPLMALGHAGANFMR
                     REIEHGDHEVIGIGHGRTLSAAVGYMPRVMANDLRFVSLLGGLTRNFAANPHDVMHRI
                     AEKTGMPAYVMPVPFFANTAEDREVLLAQRGVTTVFDMGCRAELKIVGIGTVDAQAQL
                     VTSGMIELGEVEEIANLGGVGEMLGHFFNANGQWLETALTGRTIAASVENADMSRIVA
                     LAGGLSKVDAIRAVLKSGRLYGLITDERTAKALIGQPNGK"
     gene            complement(364505..365437)
                     /locus_tag="BAB_RS28130"
                     /old_locus_tag="BAB2_0370"
                     /db_xref="GeneID:3827517"
     CDS             complement(364505..365437)
                     /locus_tag="BAB_RS28130"
                     /old_locus_tag="BAB2_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_002965780.1"
                     /db_xref="GI:489055632"
                     /db_xref="GeneID:3827517"
                     /translation="MALTLSLNTNPLVNRFAEPDDLIETVARDLRLRDLQLTHEFINP
                     SWQASTIRRLTRDMDRALQRTGVRVTSGMTGPYGRLNHFGHPDRDVRRYYVDWFKTFA
                     DIIGDLGGKSVGTQFAIFTYKDFDDPARREELIKIAIDCWAEVAEHAAGAGLDYVFWE
                     PMSIGREFGETIAECMKLQDRLTAANMAIPMWMMADIDHGDVTSANPDDYDPYAWART
                     VPKVSPIIHIKQSLMDKGGHRPFTAAFNAKGRIQPEPLLKAFAEGGAVDNEICLELSF
                     KEREPNDREVIPQIAESVAFWAPHIDTGAKDLKI"
     gene            complement(365445..366953)
                     /locus_tag="BAB_RS28135"
                     /old_locus_tag="BAB2_0371"
                     /db_xref="GeneID:3827518"
     CDS             complement(365445..366953)
                     /locus_tag="BAB_RS28135"
                     /old_locus_tag="BAB2_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014299717.1"
                     /note="in Escherichia coli this homodimeric enzyme is
                     expressed under aerobic conditions; anaerobic expression
                     is repressed by the arcAB system; converts
                     sn-glycerol-3-phosphate and ubiquinone-8 to dihydroxy
                     acetone phosphate and ubiquinol-8; associates with the
                     cytoplasmic membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_002965781.1"
                     /db_xref="GI:489055633"
                     /db_xref="GeneID:3827518"
                     /translation="MAEPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAQGT
                     SSRSGKLVHGGLRYLEYYEFRLVREALIEREVLLNAAPHIIWPMRFVLPHSPQDRPAW
                     LVRLGLFLYDHLGGRKKLPGTRTLDLKRDPEGTPILDQYTKGFEYSDCWVDDARLVAL
                     NAVGAAEKGATILTRTPVVSARRENGGWIVETRNSDTGETRTFRARCIVNCAGPWVTD
                     VIHNVAASTSSRNVRLVKGSHIIVPKFWSGANAYLVQNHDKRVIFINPYEGDKALIGT
                     TDIAYEGRAEDVAADEKEIDYLITAVNRYFKEKLRREDVLHSFSGVRPLFDDGKGNPS
                     AVTRDYVFDLDETGGAPLLNVFGGKITTFRELAERGMHRLKHIFPQMGGDWTHDAPLP
                     GGEIANADYETFANTLRDTYPWMPRTLVHHYGRLYGARTKDVVAGAQNLEGLGRHFGG
                     DFHEAEVRYLVAREWAKTAEDILYRRTKHYLHLTEAERAAFVEWFDNANLVA"
     gene            complement(366966..368519)
                     /locus_tag="BAB_RS28140"
                     /old_locus_tag="BAB2_0372"
                     /db_xref="GeneID:3828150"
     CDS             complement(366966..368519)
                     /locus_tag="BAB_RS28140"
                     /old_locus_tag="BAB2_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-xylulose kinase"
                     /protein_id="WP_002972113.1"
                     /db_xref="GI:489062086"
                     /db_xref="GeneID:3828150"
                     /translation="MREKGDIIIGIDAGTSVLKAVAFDFSGRQIESAAVRNTYVTGDH
                     GAVTQSLAQTWQDCARALRDLGAKLPGLAQRTAAIAVTGQGDGTWLVGKDNRPVGDAW
                     IWLDARAASTVTRLAAGPMNRARFEATGTGLNTCQQGAQMAHMDTIAPELLDNAEAAL
                     HCKDWLYLNLTGVRATDPSEASFTFGNFRTRQYDDVVIEALGLQKRRNLLPEIIDGSQ
                     SQHPLSAEAAAATGLLAGTPVSLGYVDMAMTALGAGVCGGTAGAGCSTIGSTGVHMRA
                     KPVADIHLNKEGTGYVIALPIPGIVTQVQTNMGATINIDWILQVAADLMSTPEKPVSL
                     GDLIPRLDDWFNASRPGAILYHPYISEAGERGPFVNANARAGFIGLSSRDRFPELVRS
                     VVEGLGMATRDCYAAMGEMPAELRITGGAARSKALRGTLSAAVNAPVRVSAREEAGAA
                     GAAMMAAVAIGAYPAMDDCIAEWVEPLLGASEAPDAARAHQYEELFVAYREARLALAP
                     VWDKLASGK"
     gene            369262..369918
                     /locus_tag="BAB_RS28145"
                     /old_locus_tag="BAB2_0374"
                     /db_xref="GeneID:3827520"
     CDS             369262..369918
                     /locus_tag="BAB_RS28145"
                     /old_locus_tag="BAB2_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006217445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965785.1"
                     /db_xref="GI:489055637"
                     /db_xref="GeneID:3827520"
                     /translation="MSAQTSQVSAKPTTRPSRAALWSVIAAVVVIGAIGFDTKVVKIG
                     SDADVRQQVFSPAAYGASEFPKVKASIEQRAVDAVEVGNALAADKAAAGKKYGVGSVN
                     PVIPVKFTGTVEERKANYNVVKVDGMPEGMVIRVQTGPAVNGTELRDATGEIQFGQFK
                     NQIEYQNAGAALNNEMKKQVLQGVDVENLNGKTVSVVGVFKVVNPKNWLVTPVELEVK
                     "
     gene            369915..371459
                     /locus_tag="BAB_RS28150"
                     /old_locus_tag="BAB2_0375"
                     /db_xref="GeneID:3827825"
     CDS             369915..371459
                     /locus_tag="BAB_RS28150"
                     /old_locus_tag="BAB2_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006178700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_002965787.1"
                     /db_xref="GI:489055639"
                     /db_xref="GeneID:3827825"
                     /translation="MSLAAKIEGKNGDVVLAAQNVAKSYGRIHALKGVNFEIRRGQVT
                     TLFGENGAGKSTLMKVLSGVIQPTLGTIILDGKPVTFNSSTEARDHGISIIHQELSLA
                     PNMNVRDNIFMGREIRTATGVDFAEEERLTRELMKELEEDIDPLTPVEELRLGQQQVV
                     EIARALSVNSRILIMDEPTSALSASEVEVLFKVIRDLTARGVAIVYISHHLEEALQIT
                     NHAVVLRDGTMTACAPREEIDLEWIVRNMVGENFDLGSPPTGYEWGDVALSVEDLTVP
                     DPSGSGFSLVDRMSLNVRAGEIVCIYGLMGAGRTELLESVAGRLKSSGGRILLKGQDI
                     SGLTIAERIEKGLVLVPEDRQRDGLVQTMTVGKNLSLASIAEMTRGIFTSRKREKQIV
                     DQSIRNVHIKTDGGEAAIGSLSGGNQQKVVIGKMLATEPDVILLDEPSRGIDIGAKAE
                     VFKLLAEKAKQGLAVVYTTSEVGECLSIAHRIIVMHRGRISAEFGSDVSKEKIMAASG
                     EAMVGH"
     gene            371483..372523
                     /locus_tag="BAB_RS28155"
                     /old_locus_tag="BAB2_0376"
                     /db_xref="GeneID:3827521"
     CDS             371483..372523
                     /locus_tag="BAB_RS28155"
                     /old_locus_tag="BAB2_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004685989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002965788.1"
                     /db_xref="GI:489055640"
                     /db_xref="GeneID:3827521"
                     /translation="MSVTSTNKETAAPTGAKRKTSLVHLLLEGRAFFALIAIIAVFSF
                     LSPYYFTVDNFLIMSSHVAIFGLLAIGMLLVILNGGIDLSVGSTLGLAGVVAGFLMQG
                     VTLQEFGIILYFPVWAVVLITCALGAFVGAVNGVLIAYLRVPAFVATLGVLYCARGVA
                     LLMTNGLTYNNLGGRPELGNTGFDWLGFNKLFGVPIGVLVLAILAIICAIVLNRTAFG
                     RWLYASGGNERAAELSGVPVKRVKVSVYVISGICAAIAGLVLSSQLTSAGPTAGTTYE
                     LTAIAAVVIGGAALTGGRGTIQGTLLGAFVIGFLSDGLVIIGVSSYWQTVFTGAVIVL
                     AVLLNSIQYSRR"
     gene            372690..373637
                     /locus_tag="BAB_RS28160"
                     /old_locus_tag="BAB2_0377"
                     /db_xref="GeneID:3827827"
     CDS             372690..373637
                     /locus_tag="BAB_RS28160"
                     /old_locus_tag="BAB2_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_002965789.1"
                     /db_xref="GI:489055641"
                     /db_xref="GeneID:3827827"
                     /translation="MFKKGMRVLFAAAAALPLIASTAWAEGLMTIIVNDPSNPYWFTE
                     GEVAKKTAEGLGYKAVVGGHKGDTNTESNLIDTAITNKSVAIILDPANADGSVGAVKR
                     AIAANIPVFLINAEINQEGLAKAQLVSNNAQGAALGATQWVESVGDKGKYVELFGAPS
                     DNNAATRSNGYETVLSQYPDLVRVGKDVANWDRTQGHDKMQALLQANPDIIGVISGND
                     EMALGAIAALKKAGKLDQVKVGGFDGSPDAIAAIKAGELQYTVLQPVAVFSEAAVKQA
                     DNFIKTGKTGVDHEKQLFDCILITKDNVDKYTSPFVLEQ"
     gene            373782..374666
                     /locus_tag="BAB_RS28165"
                     /old_locus_tag="BAB2_0378"
                     /db_xref="GeneID:3827522"
     CDS             373782..374666
                     /locus_tag="BAB_RS28165"
                     /old_locus_tag="BAB2_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011950011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_002969305.1"
                     /db_xref="GI:489059234"
                     /db_xref="GeneID:3827522"
                     /translation="MAVSNKASIENLMTNGLTTGQVPNDSRHARQLVRRQQIAETVMA
                     EGSMRIEDLTERFGISLMTAHRDVDELVSRGLFRKSRGIVSAAPTSLIEASDLYRVTR
                     QSEEKKLIAEAAMQFVEPGQAIFFDDSTTVLQMVPHLPGKGPLTVITNSLILMNEVRD
                     MKDVTLLGLGGQLYNWCNAFVGGMTIHEIRRLRADVAFISIAAITDDLLFHQSPEMVE
                     TKRAMLDCAARRILLADHTKFERRALHNFGALSDFDVVIVDEKTPFAHIERMQAQGIN
                     VVVARASEKVDVIPARRR"
     gene            375289..375870
                     /locus_tag="BAB_RS28170"
                     /db_xref="GeneID:23672526"
     CDS             375289..375870
                     /locus_tag="BAB_RS28170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /protein_id="WP_002972112.1"
                     /db_xref="GI:489062085"
                     /db_xref="GeneID:23672526"
                     /translation="MDTRGKSGRDVPLAVDLDGTLVSTDLLWESIFILLKKNIFFAFL
                     LPVWLLSGKAHLKHEIARRVTINASVLPYRQDFLDYLRAEHASGRKLVLATASAETYA
                     QAVASELGIFSAVHASTCTTNLSAHRKADALSEHYGARGFDYAGNDCDDIAVFNAARQ
                     AKLSWRRILRRPGSRRVMAVACSSAILSPGRPT"
     gene            375873..376730
                     /locus_tag="BAB_RS28175"
                     /db_xref="GeneID:23672527"
     CDS             375873..376730
                     /locus_tag="BAB_RS28175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis protein UbiA"
                     /protein_id="WP_002972111.1"
                     /db_xref="GI:489062084"
                     /db_xref="GeneID:23672527"
                     /translation="MLRVHQWLKNLLVFVPAFLAHDILEPQVLSATFLAFIAFSASAS
                     AIYILNDIIDLPLDRQHVRKRFRPFASGQLSIPFGLAVSAGLLLVAVLICFFLPLPFA
                     LAIGIYLITTTAYSLVIKRMLLVDVICLAALYSLRLLGGMAAARIPLSFWLMAFAMFF
                     FLSLALVKRYVELQNSTVTEKDRIAGRGYRPEDIDIVGQSGVASAFTAVLVLALYINS
                     EAVRTLYTYPWLIWPLVPIVLYINVRVWILAHRGEMDDDPVMFIAFDWRSQVMIALGA
                     VLLFVAGMR"
     gene            376730..378064
                     /locus_tag="BAB_RS28180"
                     /old_locus_tag="BAB2_0382"
                     /db_xref="GeneID:3827526"
     CDS             376730..378064
                     /locus_tag="BAB_RS28180"
                     /old_locus_tag="BAB2_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-linked oxidase"
                     /protein_id="WP_002967237.1"
                     /db_xref="GI:489057115"
                     /db_xref="GeneID:3827526"
                     /translation="MTRNFDSFGRIERHERASRSFEKVRAGFAASAAEETSLLAFGNG
                     CSYGDSCHNDAGLLVPMRSVAAIESFDPATGILQAQTGVLLSEIIGFVAPHGYFLPVT
                     PGTRFVTLGGAIANDVHGKNHHLRGTFGCHVESLELLRSDGVQYHCSLHENEGLFAAT
                     IGGMGLTGVIVSARLRLMPVGSLDVEERIVPFDNLDAYFDMAEAADRQNEYAVAWVDQ
                     LSRGKTAGRGVLITGNHAGNGNRSVEDERVRLGVPFDLPFSVLNRVSLRLFNMAYFNA
                     KRRKQKPHLASFGSFFYPLDGVGQWNRLYGPAGLYQHQSVIPFDAARHIIPAMLAASR
                     EAGQASFLTVLKRFGDTASPGLLSFPKPGYTLTMDFPNRGGKTRALLQTLDNMTIGAG
                     GRVNPYKDQRMGAATFKAGFPQWPELEQWRDKRFCSDFWRRTALAPELQQGR"
     gene            378096..378515
                     /locus_tag="BAB_RS28185"
                     /old_locus_tag="BAB2_0383"
                     /db_xref="GeneID:3827527"
     CDS             378096..378515
                     /locus_tag="BAB_RS28185"
                     /old_locus_tag="BAB2_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_002967238.1"
                     /db_xref="GI:489057116"
                     /db_xref="GeneID:3827527"
                     /translation="MKYIPFILFTVMTNAAAQLMLKYGMITLGPISFSADTLIQRIFQ
                     IVFNPWVFAGLFTFVISMASHLYVLSKVDLSFAYPFLSLAYVAVALCAWLLFKEELGA
                     YKIAGIAFICIGTILIAQSGKVREADKAVTVQEQAQL"
     gene            378564..379574
                     /locus_tag="BAB_RS28190"
                     /old_locus_tag="BAB2_0384"
                     /db_xref="GeneID:3827528"
     CDS             378564..379574
                     /locus_tag="BAB_RS28190"
                     /old_locus_tag="BAB2_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_002968536.1"
                     /db_xref="GI:489058439"
                     /db_xref="GeneID:3827528"
                     /translation="MRHIIFGGDGFVGRYLAPQLLADGHEVIVADIVKSDLAHYGDAT
                     FVHTDVTDPESIRKLGIRADDMVYNLSAKMLSPIQVRAKRHDFFFPVNYYGTENIIKA
                     MDAAGAKKLVHFTTDMVYGHTYVWPQKEDHPCKPLGEYGLSKLKTEELAAQWRTRGMN
                     ISLFRPRLIIGPGRLGILEKLFKLIDNNLPVPMIGSGKNPYQFISVFDCASAARAAFK
                     AGVPNEVYNLGSLNPPPVRKLLGDLIKHAGSKSMLLPTPAWAVKRTLDFLDWLNMPLM
                     DPEQYLIADEMCVLDVSKGERELGWIPQYRDEDMLIAAYSEYRKKKAGGAENRLSPSK
                     AA"
     gene            379585..381039
                     /locus_tag="BAB_RS28195"
                     /old_locus_tag="BAB2_0385"
                     /db_xref="GeneID:3827529"
     CDS             379585..381039
                     /locus_tag="BAB_RS28195"
                     /old_locus_tag="BAB2_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class III"
                     /protein_id="WP_002967240.1"
                     /db_xref="GI:489057118"
                     /db_xref="GeneID:3827529"
                     /translation="MKSTIHSEGAAVSASVANHTPKPPLLSVDDAKALDLPRMTELFT
                     AHLNPGQLHFMKLLGFHKVKVERAEGMYYYDQNGRRILDFFGGFGSLAFGHNHPRIIA
                     ARRKFQEELRHEIAIAFMSQYAAALAYDLAACSPGDLDMVFLGSSGSEAMEAAIKVAE
                     RAAGPKKPKIVYAENSFHGKTKGVLSITDGGLYRGEFKLVDNTVRVPFGDITAIENAS
                     RSDPEIGTIVLETVQGGGGIIQADAEFWQKLRQLCDRYGVIWVADEVQCGFGRTGKFY
                     AFEHYGVIPDVTALAKSLGGGKAAMAAMIARRDIYMKAYGTPKTAMIHAMATFGGIGE
                     ACITAIEAVNILYDEQLIDNSAEVGDYLLERLKELQVRYPGLLKDVRGKGMMVGLEFH
                     DFSQAMPMVLRPMLAMLDDKLKGSLPGFIGSHLLRDHGVLVAFTEYNRNVIRLEPPLI
                     CQRAHVDEFIKALDEVLSRGIVKIVKDFIKAQIK"
     gene            complement(381204..382025)
                     /locus_tag="BAB_RS28200"
                     /db_xref="GeneID:23672528"
     CDS             complement(381204..382025)
                     /locus_tag="BAB_RS28200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002975877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002975877.1"
                     /db_xref="GI:489065874"
                     /db_xref="GeneID:23672528"
                     /translation="MTRPNRSIRFFDSNWIWLGVTLLGGIILETQNTGSQEFIFLWPV
                     LLMIFQRIKLLDEKAKLAFLALAAIAVIPTFTQVMHKTLRAMAVAPTYIEPPTSNLKN
                     MARVLARRDIMERASLLKDHYAKQNAAYMDLAEKGQLPSFRLYAELDFQVFWLLSADT
                     MLKALTQFETQNGIRLQSLMTLDFADPFPWLLGRDATRLIQIGADPFRTVPKMTPDVK
                     AAVEATDGVLRPNCPATTAHYKLQEIYADALQNREVVKLNDCWDLLLRPGLKKAE"
     gene            complement(382022..382783)
                     /locus_tag="BAB_RS28205"
                     /db_xref="GeneID:23672529"
     CDS             complement(382022..382783)
                     /locus_tag="BAB_RS28205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972109.1"
                     /db_xref="GI:489062082"
                     /db_xref="GeneID:23672529"
                     /translation="MPLAVPIGPMYWDTYIYLDATQRIKMGQIPGADFSTPVGPLGYY
                     LFTAGLALFPKAQLLLLAQWSMLAAAAPLMAVVLGAIGPQRRALAFALLVPFLIFGIF
                     PANVQAFHTYPGLDGFGIYNRQTSLLIYVLVSGLMFIREGRKLAVFCAIAKLCLFLTK
                     ITGFLVGGLIGLAALLAGRISVRSTILAAVLFLAVLAILELNGHMMTAYLADIARLVA
                     LNEEALLPRFLTVMSGKLDVILPSGLLVLAFSGST"
     gene            complement(382999..383445)
                     /locus_tag="BAB_RS28210"
                     /old_locus_tag="BAB2_0388"
                     /db_xref="GeneID:3827532"
     CDS             complement(382999..383445)
                     /locus_tag="BAB_RS28210"
                     /old_locus_tag="BAB2_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965793.1"
                     /db_xref="GI:489055645"
                     /db_xref="GeneID:3827532"
                     /translation="MRARSATVGDLETVFCDLSKRMVAEYIAAGKDAKLAYDDLMMNM
                     KEGRAHALVQGDDVVAIISWRESDDATNTLFAAKDEFFSAKTVRFCKKHIRKIQALSG
                     NMPIHSRIWLDRPEIIRWFQIIGYHENGNENGAKLYKLPPTSDARA"
     gene            complement(383855..384247)
                     /locus_tag="BAB_RS28215"
                     /old_locus_tag="BAB2_0390"
                     /db_xref="GeneID:3827574"
     CDS             complement(383855..384247)
                     /locus_tag="BAB_RS28215"
                     /old_locus_tag="BAB2_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006642819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002970580.1"
                     /db_xref="GI:489060526"
                     /db_xref="GeneID:3827574"
                     /translation="MTTKLHAVVDAIGLPLRIKPTPGHYGDCPQASSLLSGLKGVGHV
                     IADAAYDADHLRAFIASDLKATAQIKANPTRSSAPTIDWRLYKERHQIECFFNKLKRY
                     RRIALRCEKTLTAFMGFVHLACAMIWLR"
     gene            complement(384244..384612)
                     /locus_tag="BAB_RS28220"
                     /old_locus_tag="BAB2_0391"
                     /db_xref="GeneID:3827575"
     CDS             complement(384244..384612)
                     /locus_tag="BAB_RS28220"
                     /old_locus_tag="BAB2_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002965542.1"
                     /db_xref="GI:489055387"
                     /db_xref="GeneID:3827575"
                     /translation="MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMAA
                     NAAHWRDLPATFGKWTAVHARFRRWSHAGVWERLFHALADTPDFEYVLIDSTISKVHA
                     DAAGAKGGLKLPASVARAVD"
     gene            complement(385125..387020)
                     /locus_tag="BAB_RS28225"
                     /old_locus_tag="BAB2_0392"
                     /db_xref="GeneID:3827576"
     CDS             complement(385125..387020)
                     /locus_tag="BAB_RS28225"
                     /old_locus_tag="BAB2_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019172903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965796.1"
                     /db_xref="GI:489055648"
                     /db_xref="GeneID:3827576"
                     /translation="MTGHEGQPEEAAEAEAQEHELPFWLQATPDDIAGLEFEAPIIGC
                     NSADCVELSTLYRKEATELQEAQGNQAAAKVFAMLSAGTDLHFKPNDRNAPFGAMMIM
                     GDRRSAIPEDFRGIPVSVLAYAAENAANQVLRARLCDLCWLLERKRHQLGRAAIASYV
                     AIAEGLGSGSLKDRLDRDDPLLGLTARDVLRRALSMGRPLGWDIDEVIAARTLLSAIR
                     ARAVRSSNPVPVHWFFEMDLDFGISDPSIIAAEIEAYLTGGVPEPGSHMIVELWRLAA
                     RGHHYAKDEDGKNRCRTGAAEALVAESEKHTSAMLASHWLSEAIAEYHGVPGQRKRRT
                     QLRHKLIDVQSGIADEMSSFSHPMDLSAIADQVKEQLEGERDLIDLLLIFADLEQSPS
                     PKKLMEDAVKSINDHPLSSLFGASFHDHEGKVIHKSEGGGFGDGDNGDAIRLQISQHE
                     SMRRGIHVSGQVQVARQYITRNYYVGEDTLQALIRHSPFVPNDLVNTFSRGFARFFEG
                     DCVSALYILTPMLENSLRHILKLNGYDVTTFDDAKQVQEDRTISALFEQMRPELEEAF
                     GDAITTDIDNVFLSKPGPSLRHAVAHGLLNDSSPYGTDAIYACWLIFRLCCIPLFEQR
                     ERLRLPS"
     gene            complement(387007..387936)
                     /locus_tag="BAB_RS28230"
                     /old_locus_tag="BAB2_0393"
                     /db_xref="GeneID:3827577"
     CDS             complement(387007..387936)
                     /locus_tag="BAB_RS28230"
                     /old_locus_tag="BAB2_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_002965798.1"
                     /db_xref="GI:489055650"
                     /db_xref="GeneID:3827577"
                     /translation="MSDIKLFRTDSASVTELRGSAVALEKLLQTLIERNMEAFLGVRF
                     LASEFPTSNGGRMDSLGIDENGSPVIIEYKRASNENVINQGLFYLDWLMDHRRDFEWL
                     VLERFGAEQAKAVDWGTPRLICIAGDFTKYDAHAVNQMNRNIALVRYRRFGGELLLFE
                     LLTSASERSAREIPASIDTQDEPAAARPRSRQKTVMQYLADADQDLVDLYEATKAYLL
                     ALGGDVELKPLDNYVAFRRLKNFACVEVKPQIRHLKVFVKVDPDTTELEPGFTRDVRN
                     IGHFGIGDLEIIITDVATLDTAKPLMDRSYDGA"
     gene            complement(387944..388684)
                     /locus_tag="BAB_RS28235"
                     /old_locus_tag="BAB2_0394"
                     /db_xref="GeneID:3827578"
     CDS             complement(387944..388684)
                     /locus_tag="BAB_RS28235"
                     /old_locus_tag="BAB2_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965799.1"
                     /db_xref="GI:489055651"
                     /db_xref="GeneID:3827578"
                     /translation="MTDTAQHSIVFGGETFAFQIERTARRKTVAISVGFDGVRVLAPS
                     DLDDDRVLGIVRKKGAWLLRKQAAYRELEGQPVAKEFVSGETFHYLGRQYRLKLIPDE
                     TAVVTRIAARGSTLIAPVLPNGHASVQRAAVRNGLRHWYRAHAIQHFPIRARVIAKTL
                     GIPTPIVKVVDQSKRWGSCDARGRIRLNWRLAMAPMPLVDYVIAHEACHILEHNHSRR
                     FWRSLEAIMPDYEDRLRRLDRMGHQFIW"
     gene            complement(388681..391650)
                     /locus_tag="BAB_RS28240"
                     /old_locus_tag="BAB2_0395"
                     /db_xref="GeneID:3827167"
     CDS             complement(388681..391650)
                     /locus_tag="BAB_RS28240"
                     /old_locus_tag="BAB2_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006214267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_002967242.1"
                     /db_xref="GI:489057120"
                     /db_xref="GeneID:3827167"
                     /translation="MNETSEQLEREWVEEPATDLLRVLFDYKPLSPEDVRRLRDGLAT
                     EPVLTLRLAECLTRLNPWLDDDGVRRAVAAVTRVTAVDVMEANESAYTALTYGVTAPH
                     TEGGRRQDRNMRFFDFDDPSANTFEFARQVAIKGARQDIIPDIVVYVNGLPLAAIECK
                     SPSLADPMGEAIRQFRRYENRDEFAGLGAPRLFETAQISIALARDVAKYGTTLTPARQ
                     WAEWKDPYPLTLDALAAQLGRTPTGQDILLAGLLAPANLLDLIRNFVVFETIGGRRIK
                     KLARYQQFVAVGKAIERIRTAPNPQRRGGVIHHTQGSGKSLTMVFLATKLRRLPEAEN
                     PTIVIVTDRTDLDDQITGQFQRSGFANPIQAESGDSLRKALSGGAGTTVLTTVHKFHS
                     AVPKRSSVISKARNVFVMVDEAHRTQYGALAARMRAGLPNACMIAFTGTPIDKKDRST
                     REAFGDYLHRYLIDQAVKDGATVPIYYEMRDARIRIDGRDFEREVRAAFPELSEDEIA
                     KLRRGTGLQEKLAGAPVRVEAIAQDILSHYRSTIEPNGFKAQIVTVSRDVAVTYVEAL
                     ERLGAPECALIMSASNNDSARLQARHLSKRDRDSKISRFKKRDDPLKILVVCDMLLTG
                     FDAPIEQVLYLDAPLREHTLLQAIARVNRTADGKTYGLVVDYWGDNRRIADALDMFSD
                     EDGIASALRPLSEKIQLLESRHRAAIRLFEGISHQNDTACVELLRQDDIRAKFELDFL
                     RFAEAMDMVLPNPKALEDPYPSDLKWLSRIRVLARRAYHEEPFDPKDYGAKVGEIITS
                     HLFVTGVEQLLVKFDILDPAFRPHLESLRSSDTKAAEIEHAIRQEIHVHRDENPTAYA
                     SLWEQLERIVNDRREARVSAASALTQLEAMVGQAADIRSGATSRSDGLNGTAAAILPF
                     IDNDLPDAERSRSAAGITKALEEYAEVVDWQHKEDVQRQMRRSIKEQLRSLGLDAHKI
                     EATTAKIMDVARARYAG"
     gene            complement(391647..392870)
                     /locus_tag="BAB_RS28245"
                     /old_locus_tag="BAB2_0396"
                     /db_xref="GeneID:3827168"
     CDS             complement(391647..392870)
                     /locus_tag="BAB_RS28245"
                     /old_locus_tag="BAB2_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification protein subunit
                     S"
                     /protein_id="WP_002965801.1"
                     /db_xref="GI:489055654"
                     /db_xref="GeneID:3827168"
                     /translation="MSVEVPKGWREVRIGQIAREISNRNHASADIPVLSMTKHRGFVR
                     SNEYFSKSVHSENTRQYKVVKRGQFAYATIHLDEGSIDYLRNEDAGLISPMYTVFETN
                     SEEIDNEIALRQFKRFALSGRFDPYSNGGVNRRKSILFSDLSAFKFGLPPLTEQRAIA
                     EVLGAAEAAIAKTEALIKAIEQTKKALLKQYFVERQQSLLWSCVAKMGRWLSGGTPAT
                     AAEENWKGSIPWVCPKDIKGPSISSTVDHISEDAAKALGMVGPGTLLLVVRGMILARS
                     VPSTICTVRCAFNQDVKAFVPNEGVAPAFLKLWLDINEHKLLGEIETATHGTKRFPLE
                     RLNEFPVPVVTRDEQIRLVTLAESSQERLRSERDNLSALRSVRDALAQELLSGRIRLP
                     ESIIARHRDKAGQAA"
     gene            complement(392860..394386)
                     /locus_tag="BAB_RS28250"
                     /old_locus_tag="BAB2_0397"
                     /db_xref="GeneID:3827166"
     CDS             complement(392860..394386)
                     /locus_tag="BAB_RS28250"
                     /old_locus_tag="BAB2_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008536676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification protein subunit
                     M"
                     /protein_id="WP_002965802.1"
                     /db_xref="GI:489055655"
                     /db_xref="GeneID:3827166"
                     /translation="MAKLTRTELENHLWKSADILRGSIDSSDYKIYIFGFLFLKRLSD
                     RFEEEAKESIRQGLPENVAYSDPDEHEFFLVERARWSSIKKLTTGIGDHLNKACAAIE
                     DANPSIEGVLANIDFNSESRLGDAKNREGVLSRLIDHFSRIDLSNASLSEPDMLGRAY
                     EYLIDKFADDAGKKGGEFYTPHHVVRLIVELLAPKPGMRISDPTCGSGGMLVQVAEHV
                     AKLEGKRLGEALNITLHGQEKNLGTWAIAKMNLLLHGLRDARIEKGDTIRNPRLLDQD
                     GNLFLYDRVIANPPFSLDSWGAEDVSGDTEKKGHNRFIYGIPPKNMGDLAFVQHMVAT
                     LNTKGVCGVVMPHGVLFRGSGDGRIRESMLKADLFEAIIGLPENLFAGTGIPATVLIL
                     NKAKATERKGRVLFIHGAKEFEERPKKNILGEGNITRIVNAFNAWKDEDRFCRIVDMK
                     EIEENDFNLNISRYIDTLEPEKPIDVQAELAKLWDAETARDEAAARMNALLKEMGYVG
                     "
     gene            complement(394394..395026)
                     /locus_tag="BAB_RS28255"
                     /old_locus_tag="BAB2_0398"
                     /db_xref="GeneID:3827579"
     CDS             complement(394394..395026)
                     /locus_tag="BAB_RS28255"
                     /old_locus_tag="BAB2_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965803.1"
                     /db_xref="GI:489055656"
                     /db_xref="GeneID:3827579"
                     /translation="MMKQRKATVLSHTGARLLDVAEIFAGVGVSREETVIRPGERLPV
                     IGVRDLQDGVVAPREALDTVGFSSLSKAMTYAVQAGDVLVTGRGTLLKFGLVGDETAG
                     AVASANIIVVRPAPDATGGALFAILSSDVFRPKIEVLRRGATTLLSLSPKDLANLEIN
                     LPSLNEQERIAALVKEAQVAYRTALEAAKIRRSLARRLIDARLFGDDQNH"
     gene            395187..395327
                     /locus_tag="BAB_RS28260"
                     /old_locus_tag="BAB2_0399"
                     /db_xref="GeneID:3827580"
     CDS             395187..395327
                     /locus_tag="BAB_RS28260"
                     /old_locus_tag="BAB2_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965804.1"
                     /db_xref="GI:489055657"
                     /db_xref="GeneID:3827580"
                     /translation="MASRARPSDLAIIERDAALIRGMIEWGDRHHDIAAFFGPIRVGS
                     LK"
     gene            395551..395838
                     /locus_tag="BAB_RS28265"
                     /db_xref="GeneID:23672530"
     CDS             395551..395838
                     /locus_tag="BAB_RS28265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965805.1"
                     /db_xref="GI:489055658"
                     /db_xref="GeneID:23672530"
                     /translation="MADYRIDCINKSDRSSPHERISHAGGPKPDGSGRWKDTVPNIVR
                     FIEQGTHRFYTNESGSVAWVGVRTSANGNKFIQTYANGAWKDNLLALKECG"
     gene            396345..396575
                     /locus_tag="BAB_RS28270"
                     /old_locus_tag="BAB2_0400"
                     /db_xref="GeneID:3827581"
     CDS             396345..396575
                     /locus_tag="BAB_RS28270"
                     /old_locus_tag="BAB2_0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965807.1"
                     /db_xref="GI:489055660"
                     /db_xref="GeneID:3827581"
                     /translation="MSASEFQRITGAMTALGWGYGTHRLYDLGRTGRSARMGFARGNA
                     DEQRTNGSPSAPKGGIPILQAVSEHTDESGPF"
     gene            397265..397594
                     /locus_tag="BAB_RS28275"
                     /db_xref="GeneID:23672531"
     CDS             397265..397594
                     /locus_tag="BAB_RS28275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006642033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969307.1"
                     /db_xref="GI:489059236"
                     /db_xref="GeneID:23672531"
                     /translation="MKSDIVVLQMTMVDLLLAILHWLLSTFFGGQAFAFVGLVLWTIW
                     TGALKPRLIPVDDIVRVAGDIIASYPDPELEAFARHKRAWNRSEGAKQTYWYRVRKAV
                     RRRLQGR"
     gene            complement(397601..398323)
                     /locus_tag="BAB_RS28280"
                     /old_locus_tag="BAB2_0403"
                     /db_xref="GeneID:3827584"
     CDS             complement(397601..398323)
                     /locus_tag="BAB_RS28280"
                     /old_locus_tag="BAB2_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006076554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969308.1"
                     /db_xref="GI:489059237"
                     /db_xref="GeneID:3827584"
                     /translation="MKMRRLPEIDLARIAPLATDQKRRALERFKLGHPTLTYKPVRAL
                     FADIFNVQLDMFTASCPADWSILKRLIRAKATSDNEFNANLLVAKGLHDFAQAKALRS
                     RSHPFFPLSLSVGEKVEYWLPIVTALEGVPLVIFVDPRRSNGLTAEARRFVFSMMHEH
                     IRLANLDFATARLGIVQFGDATDSQRPVKLSTDEDVELFDFDQLDQMVRETYDIWREI
                     NEARESEVRRKAAGGGHGPLFD"
     gene            complement(398301..398858)
                     /locus_tag="BAB_RS28285"
                     /db_xref="GeneID:23672532"
     CDS             complement(398301..398858)
                     /locus_tag="BAB_RS28285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965811.1"
                     /db_xref="GI:489055664"
                     /db_xref="GeneID:23672532"
                     /translation="MEVSGGPYDPRAIANLMLDEADRSGIQVTNLALQKLLYFAHSIF
                     LIETKHPLVSGYFEAWQYGPVHPAAYSAFKTAGSYPIDFRATGQNVMTGEQAALELPE
                     DLTVRRHLARIMSSYGQLSPGRLVDISHAKGAPWDFIVDKGRTSVALGLRIPDAVIID
                     RFKYHKVSVGVAPVMGEPDEDAPLT"
     gene            complement(398877..398952)
                     /locus_tag="BAB_RS28290"
                     /old_locus_tag="BAB2_1168"
                     /db_xref="GeneID:3827796"
     tRNA            complement(398877..398952)
                     /locus_tag="BAB_RS28290"
                     /old_locus_tag="BAB2_1168"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(398917..398919),aa:Thr,seq:cgt)
                     /db_xref="GeneID:3827796"
     gene            complement(399378..400346)
                     /locus_tag="BAB_RS28295"
                     /old_locus_tag="BAB2_0405"
                     /db_xref="GeneID:3827586"
     CDS             complement(399378..400346)
                     /locus_tag="BAB_RS28295"
                     /old_locus_tag="BAB2_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006170987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_002967245.1"
                     /db_xref="GI:489057123"
                     /db_xref="GeneID:3827586"
                     /translation="MALPDILKDRLRIPVVGAPLFIISHPALVLAQCKAGVVGSFPAL
                     NARPEAQLDEWLAEITGDLAAYNAVNPGRPAAPFAVNQIVHRSNKRLEHDLGLCVKYK
                     VPIVISSLGAVPEVNAAIHSYGGIVLHDVINNRHANSAIRKGADGLIAVAAGAGGHAG
                     SLSPFALIQEIRSWFDGPLLLSGAIANGRSILAAQAMGADLAYMGSPFIATTEARAVD
                     AYKQMIVDSDSSDIVYSNYFTGIAGNYLKPSIAKAGLDPDNLPQADPSKMDFEKAQQE
                     GAKAWKDIWGCGQGIAAIKEIAPTASLVDRLEREYRDARAKLCAGA"
     gene            400493..400654
                     /locus_tag="BAB_RS28300"
                     /old_locus_tag="BAB2_0406"
                     /db_xref="GeneID:3827587"
     CDS             400493..400654
                     /locus_tag="BAB_RS28300"
                     /old_locus_tag="BAB2_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965813.1"
                     /db_xref="GI:489055666"
                     /db_xref="GeneID:3827587"
                     /translation="MIGAELKPKETIWLSTFGLLSNQKAVSFVNLEAADGEKPCALLI
                     FGAPVSYNG"
     gene            400852..401874
                     /locus_tag="BAB_RS28305"
                     /old_locus_tag="BAB2_0407"
                     /db_xref="GeneID:3827588"
     CDS             400852..401874
                     /locus_tag="BAB_RS28305"
                     /old_locus_tag="BAB2_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006256456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965814.1"
                     /db_xref="GI:489055667"
                     /db_xref="GeneID:3827588"
                     /translation="MESIERAIRNAFAKADAHNPATRQRIYESAWGAHERAMATNTAL
                     SAAQKEQRREKLKDAISRIEEEFAKRHQDGEAQREPSLDSPHQNDPVLGSSMAESTPV
                     LDSGDIRPMSRKKRPAADLGYEGGTSRKDHKKKRHSPFYSYGIPALVLLVAVMIGYSL
                     YNSLSDLGRGPSTGPLMSGTSLAPLKEGEEPGGAKWINIFLPDEATRISVQGSATAEI
                     LQDGKNKFARIRSSGVGDTVTFDVGEGILDQLVGKKATFDIIARSDDGKLTQMSVNCN
                     LAGLGDCGRRRYDVNESLNDFLFDMDFSASRKPGGAGTITVDSDLSNSGKPVDIYAIR
                     VTTADK"
     gene            402126..404681
                     /locus_tag="BAB_RS28310"
                     /old_locus_tag="BAB2_0409"
                     /db_xref="GeneID:3827590"
     CDS             402126..404681
                     /locus_tag="BAB_RS28310"
                     /old_locus_tag="BAB2_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_002965815.1"
                     /db_xref="GI:489055668"
                     /db_xref="GeneID:3827590"
                     /translation="MTLTRKPIAASATFLLPDRFVKWFAAKGWSPRAHQLELLARAEQ
                     GQSTLLIAPTGAGKTLAGFLPALVDLEKRRSKAISGKVGTGFPSGIAPKSKSGVHTLY
                     ISPLKALAVDIHRNLTVPVEEMGLDISIETRTGDTPAHKRQRQKLAPPDILLTTPEQL
                     ALLIASRVAEQFFKDLRYVVLDELHSLVISKRGHLLALGLARLRRLQPQLQTIGLSAT
                     VAEPDELRRWLVEQDGTGSMAGLVTVDGGAKPEITILDSKERVPWAGHSSRYAIPDIY
                     AAIRQHRTTLLFVNTRSQAEMLFQELWRVNEETLPIALHHGSLDAGQRRKVEQAMAAN
                     TLRAVVATSTLDLGIDWGDVDLVIHVGAPKGASRLAQRIGRANHRMDEPSRAILVPAN
                     RFEVMECRAALDANYLGAQDTPPLIDGALDVLAQHVLGMACAEPFNADQLYREVQSAA
                     PYANLPRDTFDRILDFVATGGYALKTYERFAKIRKTVDGTWRVSNPRIAQQYRLNIGT
                     IVEAPELNVRLTRGGKGANARGGRVLGRIEEYFLETLTAGDTFLFAGKVLRFEGIREN
                     ECIASNAAGQDAKIPVYAGGKFPLSTYLAAQVRAMLADRARWQFLPQQVREWLEVQQW
                     KSVLPGTDELLIETFPRGNRFYMVAYPFEGRLAHQTLGMLLTRRLERMGAHPLGFVTT
                     DYSLGLWGLKDMASMIRMGRLNLSRLFDEDMLGDDLEAWLDESYLLKRTFRNCAVISG
                     LIERRHPGQEKTGRQVTVSTDLIYDVLRSHEPDHILLQATRADAATGLLDIKRLGDML
                     ARVKGHILHKPLDQISPLALPVMLEIGRERVAGEGDEMLLEEAADDLVREAMQ"
     gene            404678..405394
                     /locus_tag="BAB_RS28315"
                     /old_locus_tag="BAB2_0410"
                     /db_xref="GeneID:3827591"
     CDS             404678..405394
                     /locus_tag="BAB_RS28315"
                     /old_locus_tag="BAB2_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="WP_002965816.1"
                     /db_xref="GI:489055669"
                     /db_xref="GeneID:3827591"
                     /translation="MKTAAWGNGEAYSLAHAEVRGVAAVCDPSGALFLPYLHMLVVSD
                     LHLEKGSSFARRGQLIPPYDTAATLDMLAQAIARYQPRTIISLGDSFHDAKASERLPS
                     LYAIRLKSLMEHRDWLWITGNHDPERPVDLPGDCVEELAVGPLTFRHEPSRKAGQGEI
                     AGHLHPAARIVRRGRSVRRPCFVSDGERLIMPAFGAYTGALNILDRAFRGLFTDETLR
                     AYMLGQGKVYPIARGALYGG"
     gene            complement(405492..406316)
                     /locus_tag="BAB_RS28320"
                     /old_locus_tag="BAB2_0411"
                     /db_xref="GeneID:3827592"
     CDS             complement(405492..406316)
                     /locus_tag="BAB_RS28320"
                     /old_locus_tag="BAB2_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969309.1"
                     /db_xref="GI:489059238"
                     /db_xref="GeneID:3827592"
                     /translation="MGRLTLFSALLMLLMTGSAAAQVDSSGNGNTVPQLQNPAEESIE
                     IGLSTETIAITSNFGGTGLTIFGALDNADPMIQRQGRYDIIVVLQGPARDIVVRKKER
                     YLGVWVNAASETFLGVPLSYSLASTRNLQDIADEKTYRQLSVGVHNFYLVPDDPDSPS
                     DNIVKFGNELREIKIRQGLYSQRIGGVEFISRTLFRATLNLPANVPVGRHKARALLFR
                     NGVFLREANASLEIVKAGLEQSVYNAAHQNSLLYGLFAVFLAIFTGWFGRILFRKD"
     gene            complement(406318..407238)
                     /locus_tag="BAB_RS28325"
                     /old_locus_tag="BAB2_0412"
                     /db_xref="GeneID:3827593"
     CDS             complement(406318..407238)
                     /locus_tag="BAB_RS28325"
                     /old_locus_tag="BAB2_0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_002965818.1"
                     /db_xref="GI:489055671"
                     /db_xref="GeneID:3827593"
                     /translation="MGIYLPIAELSVNMLVLLGMGAAVGFLSGLFGVGGGFLITPLLI
                     FYNIPPAIAVATGANQVIASSVSGALAHFKRRTLDIKLGLFLVAGGILGSLIGIFVFS
                     WLRDLGQLDLIVSILYVFFLGTIGGLMLVESVQALRRAKKGQGGAVRRSGQHTWIHRL
                     PFKMRFRASTIYVSVIPVLGIGFFIGLLSSVMGVGGGFIMVPALIYLLHVPTNVVVGT
                     SLFQITFVTAFTTVMQATTNQSIDIVLAFLLMVGGVIGAQYGARAGRKLRGEQLRLLL
                     ALLVLAVGMRLAFGLFVRPDNLFSISIADI"
     gene            complement(407505..410246)
                     /locus_tag="BAB_RS28330"
                     /old_locus_tag="BAB2_0413"
                     /db_xref="GeneID:3828055"
     CDS             complement(407505..410246)
                     /locus_tag="BAB_RS28330"
                     /old_locus_tag="BAB2_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006203793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972106.1"
                     /db_xref="GI:489062078"
                     /db_xref="GeneID:3828055"
                     /translation="MQDLSQTLSALEEHLSELEPQKVDRAAPADARAQTSIAGLAEIA
                     DHLRRMRNPYISPDEEAAERAFQPPHRDEAFGEPPHYRRRLSDRIGTAAPEYARPQAA
                     PAEHDALHHIDGRLNEISRALIATNKLQRPSREEAERMDRIEKRLAALTAQLDSAFTR
                     EDSDALFRRLGELSQRIDALQANASLPEQIVDQLACQVQLLATQIGKVVENLSRSDYR
                     RVEARLEAISERLDAAERRAHEHHPAVMDQIDRRFAELTERLDAHYASRYGASSADSE
                     AIHNLEQQIASIAQHLAQPSRELAEIRPRLDSIERSLHSNREIVLDAAREATESVVAR
                     MLQHGPKSETAIAQQLAADMKALETLARNADDRNTKTFEAVHDTLTQVVERLAGIEKE
                     MSPKPAASAPIKAPVFSSPAAPAPVKFPQVEKAAAHTSRPHEPFFKSDFASLKPARRE
                     NPVHTQPPAVKPDVKSGPRAGDETVLDLNSIMKRVREERRQQEDGSEAPKTAATSKVD
                     FITAARRAAQLAATQSEQIEKDAAAPTEKKKASIADILHRQRKPILFAIGAVMIAIAG
                     LQVGTAFLNRDSDIDPAVNVAAEKPAAIDMASTGGIQTIPTTINRAATLATPQMPPLQ
                     AESTVDDKMPALPPEPQASAQFSPPETEQTAAPEPKKIEIPSIPEEAGPAALREAAAK
                     GDIRALFEIGNRYMEGRGVAENVKKAAKWYQLAADQGNASAMHNLAVLFATGTNGTPD
                     NAAAVRWFTEAAELGVKDSQYNLGILAAKGLGMPVNLEESYKWFALAANAGDKDAAEK
                     RDQIAKALKPEMLTRAKGAVKLWKAKPLDDAANSIDVPDAWTEAKPLSTSSVDMKKAV
                     RNIQLILQKNGYDTGTADGIMGAKTRTAISAFQKANGQEPTGEVNQKLVQLLLEKNK"
     gene            410616..411071
                     /locus_tag="BAB_RS28335"
                     /old_locus_tag="BAB2_0414"
                     /db_xref="GeneID:3828056"
     CDS             410616..411071
                     /locus_tag="BAB_RS28335"
                     /old_locus_tag="BAB2_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_002965820.1"
                     /db_xref="GI:489055673"
                     /db_xref="GeneID:3828056"
                     /translation="MRGQTNAPRMTIADFLVGDGMKAKHEGETNGPFFRIGDLAQEFG
                     LTLRALRFYEDKGLLRPRRAGVTRLCNLNDYARLRLVIFGRRIGFTLGEISELIGLWE
                     QGLADPGQLSALRQSFIAKLTELEKKKVEIDDTIDELRTVLGRLSSLPG"
     gene            complement(411126..411485)
                     /locus_tag="BAB_RS28340"
                     /old_locus_tag="BAB2_0415"
                     /db_xref="GeneID:3828057"
     CDS             complement(411126..411485)
                     /locus_tag="BAB_RS28340"
                     /old_locus_tag="BAB2_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965821.1"
                     /db_xref="GI:489055674"
                     /db_xref="GeneID:3828057"
                     /translation="MELPRESTLLRIFVGEEDQTEDGKLLYEAIVNKAREMQMAGATV
                     LRGPLGFGHSSILHTAKILRLSQDLPTVIEIVDAPEKIEHFIPQVMKMTQSCLITTEK
                     VQVIHYGSNGSTKEKGD"
     gene            complement(411501..411914)
                     /locus_tag="BAB_RS28345"
                     /old_locus_tag="BAB2_0416"
                     /db_xref="GeneID:3828058"
     CDS             complement(411501..411914)
                     /locus_tag="BAB_RS28345"
                     /old_locus_tag="BAB2_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YCQ9.1"
                     /note="may be involved in chromosome condensation;
                     overexpression in Escherichia coli protects against
                     decondensation by camphor; overexpressing the protein
                     results in an increase in supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="WP_002968948.1"
                     /db_xref="GI:489058867"
                     /db_xref="GeneID:3828058"
                     /translation="MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLW
                     GTSFVNIVGSFIIMFFATLTGPEGRWLVSPAWRQFVMGGLCGGLTTFSSMSLDTFLLV
                     LHGNAAFALAYLCGLVFLSLSAAMLGLIAAQRINR"
     gene            complement(411911..412312)
                     /locus_tag="BAB_RS28350"
                     /old_locus_tag="BAB2_0417"
                     /db_xref="GeneID:3828059"
     CDS             complement(411911..412312)
                     /locus_tag="BAB_RS28350"
                     /old_locus_tag="BAB2_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q578U0.1"
                     /note="may be involved in chromosome condensation;
                     overexpression in Escherichia coli protects against
                     decondensation by camphor; overexpressing the protein
                     results in an increase in supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="camphor resistance protein CrcB"
                     /protein_id="WP_002965823.1"
                     /db_xref="GI:489055676"
                     /db_xref="GeneID:3828059"
                     /translation="MSVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNV
                     SGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLLGGYTTVSSFCLQSVNLMLDGEQRQ
                     ALFNIVASALLCVLAVAAGYGGIMWIMEWPG"
     gene            412769..413050
                     /locus_tag="BAB_RS28355"
                     /db_xref="GeneID:23672533"
     CDS             412769..413050
                     /locus_tag="BAB_RS28355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_002972105.1"
                     /db_xref="GI:489062077"
                     /db_xref="GeneID:23672533"
                     /translation="MLRNTVGTAVAIASTAVNSPEAGNVAVLAVKDGAIVKAGDLIAQ
                     LDDKAIRANIVKDTASLAKSQATLNDAEIQLKRTQDLVRKGGRHVAEWR"
     gene            413070..413756
                     /locus_tag="BAB_RS28360"
                     /db_xref="GeneID:23672534"
     CDS             413070..413756
                     /locus_tag="BAB_RS28360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006236332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_002972104.1"
                     /db_xref="GI:489062076"
                     /db_xref="GeneID:23672534"
                     /translation="MAQAQLQVDQAQLAADQVTLSYTKIVAPFTGQLGVVQVSPGAYL
                     SAGSSVATLTRMSPIYAEFTLPETDLARIRAALKDGTLKTDVTVTSGEGKDVTESGRV
                     DFIDNAVDPASGTVRLRATLDNRSGNFWPGQSLRISVELGKIDDLVLVPDVAVEPQEN
                     GSISYVVKPDNSVEIRPVSVALRADGMAGVRAGLQPGERVVIEGQDALSNGNRVKLVE
                     TKPDAKVSSD"
     gene            413779..416859
                     /locus_tag="BAB_RS28365"
                     /note="acriflavine resistance protein B; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23672535"
     gene            complement(417043..418248)
                     /locus_tag="BAB_RS28370"
                     /old_locus_tag="BAB2_0422"
                     /db_xref="GeneID:3827697"
     CDS             complement(417043..418248)
                     /locus_tag="BAB_RS28370"
                     /old_locus_tag="BAB2_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967247.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate from mannonate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate dehydratase"
                     /protein_id="WP_002965826.1"
                     /db_xref="GI:489055679"
                     /db_xref="GeneID:3827697"
                     /translation="MRQAWRWFGPEAGVPLDAVRQAGATDIVSALHEVPIGQEWTSAQ
                     IVERKNLIESTPTGRHPLTWSVVESIPVSDDIKRSGKAARHDIGAWIASMEALARNDI
                     KVICYNFMPVVDWCRTDLDYITSTGAMAMRFDQDRFAAFDLHILQRKGAEKDYSEEDR
                     IAARAIFEAMDETEIEQLIVNIASALPGSTTEPLTIPAFRKKLETYASIDAAHLRRNL
                     VEFLEAVTPVADSLGVKLTLHPDDPPRSLFGLPRIASTEADYAAIFAAVPAQSNGMCF
                     CTGSLGVRADNDLPAIARRFASRIHFSHLRATTREGDGRTFHEAAHLEGDVDMVGILR
                     ILLEKDRKRDAGQTIIFRSDHGHRMMDDLEKKVTPGYPVIGRMRGLAELRGIITALDA
                     CALEYDPNV"
     gene            complement(418309..419082)
                     /locus_tag="BAB_RS28375"
                     /old_locus_tag="BAB2_0423"
                     /db_xref="GeneID:3828064"
     CDS             complement(418309..419082)
                     /locus_tag="BAB_RS28375"
                     /old_locus_tag="BAB2_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_002965827.1"
                     /db_xref="GI:489055680"
                     /db_xref="GeneID:3828064"
                     /translation="MRGRSAQPALEKQKNVADTESGAATGVKARTLPSRVAGVQRVTT
                     AKLIYHELQQQIIRMELLPGTPLNEKALTEKYGVSRTPVREALIRLAEDRLVDVFPQS
                     GTFVARIPVDAIPEAVVIRQALEGETAERAAANSTAAAIEKLDELIHLQTFYARKDKP
                     GPFHETDDAFHETIAEIAGYPGIWQHLKPVKMQIDRARRMTMPILGRMEQVLREHHAI
                     RDAISARDVHAAREAMKHHLSAVLPDIDELRKSRPDYFA"
     gene            419411..420535
                     /locus_tag="BAB_RS28380"
                     /db_xref="GeneID:23672536"
     CDS             419411..420535
                     /locus_tag="BAB_RS28380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucuronate isomerase"
                     /protein_id="WP_002967248.1"
                     /db_xref="GI:489057126"
                     /db_xref="GeneID:23672536"
                     /translation="MALNPDRLFSAEPGTREIARRLFASVEKLPIISPHGHTEPIWYA
                     RNEAFPDPASLFVKPDHYITRMLYSQGHSLESLGIASRDGRPSETDARKIWRLFATNW
                     YLFRATPSRLWFEHAMETVFGITERLSQENADRIFDAIADQLTQPHMRPRALYDRFNI
                     EAISTTDAATDPLIYHDEVIASGWHGRIIPAYRPDAAVDAGRPDFASEVEKLVGVAGT
                     PLTWQGYLDAHRNRREYFKRRGATSSDHGHPTAQTADLSAGDASRLFDRVIKGNASTS
                     DAEMFRAQMLTEMARMSIDDGLVMQIHPGSFRNHNPTVFERFGLDKGADIPRQTGFVD
                     QLKPLLDAFGNDPRLTVILFTLDETALVANWRRSPATIQP"
     gene            420532..420810
                     /locus_tag="BAB_RS28385"
                     /db_xref="GeneID:23672537"
     CDS             420532..420810
                     /locus_tag="BAB_RS28385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006076559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uronate isomerase"
                     /protein_id="WP_002972101.1"
                     /db_xref="GI:489062073"
                     /db_xref="GeneID:23672537"
                     /translation="MKLGPAWWFFDSPEGILRYRKLTTETAGFYNTVGFNDDTRAYLS
                     IPARHDMARRVDCAYLAGLVADHRLEEDEAYEVAHDLAYRLAKQTYKL"
     gene            420816..422315
                     /locus_tag="BAB_RS28390"
                     /old_locus_tag="BAB2_0426"
                     /db_xref="GeneID:3828067"
     CDS             420816..422315
                     /locus_tag="BAB_RS28390"
                     /old_locus_tag="BAB2_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_002965829.1"
                     /db_xref="GI:489055682"
                     /db_xref="GeneID:3828067"
                     /translation="MPVRTSEPRLSNRTMSGLPSSVKVPAYDRSRITTGIAHLGIGAF
                     HRAHQTAYTDAVLTSGSNEWGIVGVSLRRPDTRDALQIQDELYTLAIRDGDSEKLQVI
                     GSIQNILVAPEDPQAVLDIMSHPDTRIVSLTITEKGYCRDAAVSGLDRSHPDIIYDLA
                     HPATPRSALGFITEALRRRRAQGTAPFTVLSCDNLPANGETCKNVIVQFAGCTDTDLA
                     HYIEETVAFPSTMVDRIVPATTDEDRISISRTLKVLDQWPITTEPFSQWVIEDRFPTG
                     RPAWEIAGATFVQDVAAFELMKLRLLNGSHSTLAYLGFLAGHRTVSQTMAAPGFKQLI
                     KALMEIEIAPTLPKLEGFDLSSYQAALIHRFENHALHHLTSQIAMDGSQKLPQRLLNT
                     IQERLDGGGSIDRLALGVAAWMRYVTGKDEAGTPIDVRDPLSGQLLDQTQGKFAPDEI
                     MDALLSFRQIFTARLAANELFREKLRLALGSLYAVGSAETVRRYAEIAM"
     gene            422475..423656
                     /locus_tag="BAB_RS28395"
                     /old_locus_tag="BAB2_0427"
                     /db_xref="GeneID:3828068"
     CDS             422475..423656
                     /locus_tag="BAB_RS28395"
                     /old_locus_tag="BAB2_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002967249.1"
                     /db_xref="GI:489057127"
                     /db_xref="GeneID:3828068"
                     /translation="MRLTRRQALGGMAALAAFPASRVWAQTKPAMPASPVTLNIVDVA
                     GNLALTQPAFEAYAKANPDKVSKITFTKAPAPELPGKLKAQQAANRLDIDVVLTGTDA
                     LSAGHELGLWVKLLPEYSTSLPDLKTLYQEPAWRMQEAQGKQHGLAIVYYPSGPLLEY
                     MPDKVKTVPRNLDELLVWAKENPNKFLYARPANSGPGRTFLMGLPYMLGDADPKDPMK
                     SWDKTWAYLKELHKYIEYYPTGTGALMKELGEGTRYMTVTTTGWDINPRVLGVVPKEA
                     AVSKLDGFHWVADAQFMAVPKGIGDDKLAVILDLMNYMLTPEAQAVTYDQGYFYPGPV
                     VKDVPITMAPQSSQDAIAEFGRAEYADWIANNPIELPLEPAAMVAAFRRWDEDVASQP
                     K"
     gene            423719..424786
                     /locus_tag="BAB_RS28400"
                     /old_locus_tag="BAB2_0428"
                     /db_xref="GeneID:3828069"
     CDS             423719..424786
                     /locus_tag="BAB_RS28400"
                     /old_locus_tag="BAB2_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_002965831.1"
                     /db_xref="GI:489055684"
                     /db_xref="GeneID:3828069"
                     /translation="MQAASLPFNEIRLERMSRAFGSHNALKSITLSISKGEFIALLGP
                     SGCGKSTALNCIAGLLATTGGGIYIDEKRIDTLKPEDRGFGMVFQNYALFPHMSVREN
                     VGFGLKMRGTPKSEIRKRVDEAIGMVRLNGQEEKLPGQLSGGQQQRVAIARAIVIEPP
                     LVLMDEPLSNLDAKLRLEMRAEIRRIHNQLGSTTIYVTHDQDEALSLADRIVVLRDGE
                     IRQVGVPSDLYERPDHLDVAEFMGYRNRLPGKVTAIDGERATISIGGSLIAGIARVPL
                     AIGQDVVLAARPDDVATGPASPAALQAKVETIEYRGRDFVGTANMSDGHNLVFHASAH
                     AELGSAVSLTVDPNRALIFPA"
     gene            424795..425694
                     /locus_tag="BAB_RS28405"
                     /old_locus_tag="BAB2_0429"
                     /db_xref="GeneID:3828070"
     CDS             424795..425694
                     /locus_tag="BAB_RS28405"
                     /old_locus_tag="BAB2_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965832.1"
                     /db_xref="GI:489055685"
                     /db_xref="GeneID:3828070"
                     /translation="MTASPAQETMSFRQKMAMKGIDGTTLLALPAVIFLLAVFVYPFL
                     YGLSLSFNPQEGEGIWANYIRFFSDPFLYNTIGTTLCLAIPVTFLSLIIAVPIAFRVR
                     LLRRQRLLTTVLVIPVTLGTVLVAEGLLNYLGPQGWFSRTLMLFGLVDAPLKLTNNYW
                     GVFASLIITGFPFTFLLTLSYVSGIDPALEQAAATHGAKSWQRFRYVLLPLLIPGLAI
                     TFCLSFVLAFAVFPSAILLGAPAGPTRVISIAAYQAAFEQYDYSMAAAIAMIMAAVQL
                     AIVVLVLGIRSLFYRGATSGGKG"
     gene            425695..426537
                     /locus_tag="BAB_RS28410"
                     /old_locus_tag="BAB2_0430"
                     /db_xref="GeneID:3828071"
     CDS             425695..426537
                     /locus_tag="BAB_RS28410"
                     /old_locus_tag="BAB2_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006121514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965833.1"
                     /db_xref="GI:489055686"
                     /db_xref="GeneID:3828071"
                     /translation="MIRDTSTGAKLWIAAVCAVVIFFVINLTAMIATVVLSSFSTRWL
                     GTWLPAGLTTKWYYTAWSEFQLHDVLIVTFQIVFTVVILSGLLGVTAAYAMARRNFPG
                     RNIVMLLFLLPLLVPPITFGIPLATVLYQAGIGGTFWGVVLANLVPTVPFVILVMIPF
                     IEQVDPKVEAAARVFGANTFQLFRYVLLPMLLPGILAALLLVPVRTVAMFELTFLTAG
                     PTSQTLVVALYYSVFASGVRSVQSIDAMAVIYMITTLIWLLLALRFVNPTQIVARAKS
                     QNTN"
     gene            426615..428159
                     /locus_tag="BAB_RS28415"
                     /old_locus_tag="BAB2_0431"
                     /db_xref="GeneID:3828072"
     CDS             426615..428159
                     /locus_tag="BAB_RS28415"
                     /old_locus_tag="BAB2_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-galactarate dehydratase"
                     /protein_id="WP_002965834.1"
                     /db_xref="GI:489055687"
                     /db_xref="GeneID:3828072"
                     /translation="MKNVVAAAVAPVIILHPSDDVAVARVPVRAGDPIGIDEITAREL
                     IGRGHKVALRAIPAGREVLKYGQVIGVATRDIAPGEHVHLQNLAMLPSEHAHQFSIDI
                     EEHGMVPDAERRHFMGYDRGAGGVGTRNFIGVISSVNCSATVSRYIADYFNRMGGLDG
                     FDNVDGVVALTHGSGCALNTRSEGYRLLTRTIQGYAKHPNFGGVLLIGLGCETNQIAP
                     ILEHYRIEEGSRLRAMTIQQHGGTRKTIDAAIGEIKDMLPMVNAAKRSPQPLSNLKVA
                     LECGGSDGYSGISANPALGYASDLIVRNGGTTVLSETPEIYGAEHLLTRRAVTPAVAE
                     KLLQRIDWWRDYTARNGDELNNNPSYGNKLGGLTTILEKSLGAVAKGGSMPLKAVYEF
                     AETITEQGFVFMDTPGYDPVAVTGQVAGGCNVICFTTGRGSVSGFKPSPCIKIATNSE
                     MYEHMKEDMDINCGGIVTGNETIEEAGARIFDHILAVASGQKTLSEIYDYGDNEFVPW
                     QVGAVT"
     gene            complement(428170..428568)
                     /locus_tag="BAB_RS28420"
                     /old_locus_tag="BAB2_0432"
                     /db_xref="GeneID:3828073"
     CDS             complement(428170..428568)
                     /locus_tag="BAB_RS28420"
                     /old_locus_tag="BAB2_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9AL83.1"
                     /note="Inhibits transcription at high concentrations of
                     nickel; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-responsive regulator"
                     /protein_id="WP_002965835.1"
                     /db_xref="GI:489055688"
                     /db_xref="GeneID:3828073"
                     /translation="MQRITITIDDDLMAALDRMIEIKGYQNRSEALRDLARTGLQQAS
                     LEEGQMEACVGVLSYTYDHSARDLSKKLTNTHHDHHNISVASMHVHLDHDRCLEVSIL
                     KGKTDDVRHFADHVKAERHVTHGTLAVLPL"
     gene            428835..430416
                     /locus_tag="BAB_RS28425"
                     /note="nickel ABC transporter substrate-binding protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23672538"
     gene            430418..431362
                     /locus_tag="BAB_RS28430"
                     /old_locus_tag="BAB2_0435"
                     /db_xref="GeneID:3827927"
     CDS             430418..431362
                     /locus_tag="BAB_RS28430"
                     /old_locus_tag="BAB2_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934568.1"
                     /note="with NikACDE is involved in nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_002965839.1"
                     /db_xref="GI:489055692"
                     /db_xref="GeneID:3827927"
                     /translation="MFAFIIRRVILLVPMLFGASLVIFLMLRLGPSDPAMDYLRLSKV
                     PPTPQALESARQMLGLDRAITTQYFDWLGKALHGDFGISFATQRPVLPDLLYFLPATL
                     QLAGVALVLTLGLSIPLGMWAARHREGWQDQVVRFVAFLGVSMPNFWLGFLLVLVFSI
                     QLGWLPPMGRGGFAHMIMPAIAISFMSLSINARLLRASMLEVSGQRHVRYARLRGLSE
                     RSVERSHVLRNAWLPIITATGMHIGELIGGTLVIESIFGWPGVGRYAVSAILNRDYPV
                     IQCFTLVMVTIFVICNLIVDVVYAWADPRIRLSAEGAE"
     gene            431359..432231
                     /gene="nikC"
                     /locus_tag="BAB_RS28435"
                     /old_locus_tag="BAB2_0436"
                     /db_xref="GeneID:3827928"
     CDS             431359..432231
                     /gene="nikC"
                     /locus_tag="BAB_RS28435"
                     /old_locus_tag="BAB2_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006112427.1"
                     /note="with NikABDE is involved in nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter permease"
                     /protein_id="WP_002969310.1"
                     /db_xref="GI:489059239"
                     /db_xref="GeneID:3827928"
                     /translation="MSDSASMVCASKTGFLSVPRQWPVRLACIIVLLLLVAAVAGPWI
                     TPYNPDDVDLVRRLQSPSLAHWLGTDHLGRDMLSRLIAGVRVSLGSVVITLALTLAMG
                     IVIGGAAGFLGGRADQVIMRITDVFLTFPTLVLALFMVGMLGTGLVNVILAIALSHWA
                     WYARIVRGIVMSLRHREFLLAARMSGAGPVRTFWEHLLPATFSQLVVLATLDVGHIML
                     HVSGLSFLGLGVTPPTAEWGVMINDARQFVWTAPMLILWPGLALFLSVMAFNILGDAL
                     RDSLDPHLKAEHSH"
     gene            432228..433016
                     /gene="nikD"
                     /locus_tag="BAB_RS28440"
                     /old_locus_tag="BAB2_0437"
                     /db_xref="GeneID:3827146"
     CDS             432228..433016
                     /gene="nikD"
                     /locus_tag="BAB_RS28440"
                     /old_locus_tag="BAB2_0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8FVM9.1"
                     /note="with NikABCE is involved in nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel import ATP-binding protein NikD"
                     /protein_id="WP_002965841.1"
                     /db_xref="GI:489055694"
                     /db_xref="GeneID:3827146"
                     /translation="MTRKTLAIEGLTATTVIDGQQRVLVDNLSLGVQRGRILALVGAS
                     GSGKSMTCSAALGVLPPGVTASRGRVTIDGVPYAANALRGRHVATIMQNPRSAFNPVR
                     TMRDHAIETLQALGKLSSNPQDQIVHCMRAAGLEDVKTILSLHPFEMSGGMLQRMMIA
                     LALLSEAPFLFADEPTTDLDLVVQLRVLELLEKLVEERDLGILLVTHDMGVVARLAHD
                     VAVLDHGRLIEQAPVMDIFQTPGHEVTRMLVSAHLSLYGMELNA"
     gene            433013..433813
                     /gene="nikE"
                     /locus_tag="BAB_RS28445"
                     /old_locus_tag="BAB2_0438"
                     /db_xref="GeneID:3827147"
     CDS             433013..433813
                     /gene="nikE"
                     /locus_tag="BAB_RS28445"
                     /old_locus_tag="BAB2_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510833.1"
                     /note="with NikABCD is involved with nickel transport into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel import ATP-binding protein NikE"
                     /protein_id="WP_002965842.1"
                     /db_xref="GI:489055695"
                     /db_xref="GeneID:3827147"
                     /translation="MSLISADNIVKIYQSHSLVGASARKTMLHDISISIGQGETVALL
                     GRSGCGKSTLARLLVGLERPTSGEVRFRGVPLTKLDRSGMKAFRREVQLIFQDSPGAV
                     NARSSVRAIIGEPLRHLTSLDETRREERIQELLRLVELPPEIADRLPAQVSGGQLQRI
                     CIARALAVNPKLIILDEAVSNLDIHLQASALALLTKLQQEGGIAYLFVTHDLRLVQKF
                     AARCLVMDEGQIVEEIKTADLDSMRHPASRLLREAVLPPLPVRAVETN"
     gene            complement(433946..435106)
                     /locus_tag="BAB_RS28450"
                     /old_locus_tag="BAB2_0439"
                     /db_xref="GeneID:3827148"
     CDS             complement(433946..435106)
                     /locus_tag="BAB_RS28450"
                     /old_locus_tag="BAB2_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_002972099.1"
                     /db_xref="GI:489062071"
                     /db_xref="GeneID:3827148"
                     /translation="MHVAVDDYTDIREAVSKLCQRFPGEYWRKIDREMAYPNEFVNAL
                     TEAGWLSILIPEEYGGAGLPLSAAAAVLEEIQKSGCNGGACHAQMYTMGTLLRHGSDE
                     QKACYLPKIASGELRLQAFGVTEPTSGTDTGALKTTARREGDEFIINGQKIWTSRAEY
                     SDLMLLLARTSPLTDGMKKTDGLSVLIVDMAKAKNNGLTIRPIRTMMNHATTEVFFDN
                     LRVPISNLIGEEGKGFRYILSGMNAERILIAAECIGDAKWFTQKSVNYAKERSIFGRP
                     IGQNQGIQFPIAKAYANMRAAELMVQSALALYEAGQNPGAEANMAKMLAADASFEAAN
                     ACVQTHGGFGFAEEYDVERKFRETRLYQVAPISTNLILSYIAEHVLGMPRSY"
     gene            complement(435429..436148)
                     /locus_tag="BAB_RS28455"
                     /db_xref="GeneID:23672539"
     CDS             complement(435429..436148)
                     /locus_tag="BAB_RS28455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006084383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002972098.1"
                     /db_xref="GI:489062070"
                     /db_xref="GeneID:23672539"
                     /translation="MAEMEEIRMLAQDENAPLRGHVSIGMPPTASDILSEPLVSTFQE
                     THPDATLRIVNAYSGYLVDWLHRGDIDAAILYNPKNARSFHIQPLLEEALFLIGPANF
                     DKVRGRQITFSELEKERLLLPSIGNGLRSLLEKYAQEAGITLNVKFEADSYSTLKSIV
                     QNNHGVTVLPLAPIREELNAGKLCAVPIVDPVPVRRLIISYPTHRPVSRLARFSGQVI
                     ASTVKKLVEEGVCSGRILTEI"
     gene            complement(436174..436341)
                     /locus_tag="BAB_RS28460"
                     /db_xref="GeneID:23672540"
     CDS             complement(436174..436341)
                     /locus_tag="BAB_RS28460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020699915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_020699915.1"
                     /db_xref="GI:522192448"
                     /db_xref="GeneID:23672540"
                     /translation="MDISQLRTLIYVAELGSLSKAADRLRIAQPALSRQIRLLEQELG
                     TRLFDRHREGA"
     gene            436596..436874
                     /locus_tag="BAB_RS28465"
                     /old_locus_tag="BAB2_0441"
                     /db_xref="GeneID:3827150"
     CDS             436596..436874
                     /locus_tag="BAB_RS28465"
                     /old_locus_tag="BAB2_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965845.1"
                     /db_xref="GI:489055698"
                     /db_xref="GeneID:3827150"
                     /translation="MPFFELVAPLIMANSTVLKLRQGAMSMDDFPSRTNQMQRNAMPR
                     RKEQTKATFTTATSKSVARTCEFLTFTETSKYASFGRNWIDHYTGGGK"
     gene            436871..437074
                     /locus_tag="BAB_RS28470"
                     /db_xref="GeneID:23672541"
     CDS             436871..437074
                     /locus_tag="BAB_RS28470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965846.1"
                     /db_xref="GI:489055699"
                     /db_xref="GeneID:23672541"
                     /translation="MIGQKAAKMADFRVKRAFFCNKHVAMAIPPLCDQSCMNVVGSIF
                     RQGRKMRKVIDLEDLDAKLSRAG"
     gene            437049..438842
                     /locus_tag="BAB_RS28475"
                     /old_locus_tag="BAB2_0442"
                     /db_xref="GeneID:3827151"
     CDS             437049..438842
                     /locus_tag="BAB_RS28475"
                     /old_locus_tag="BAB2_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016149348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_002965847.1"
                     /db_xref="GI:489055700"
                     /db_xref="GeneID:3827151"
                     /translation="MPSYRAPVEDTNFVLNDVLNYQRYNNLPGFAEAAPDVVEAILSE
                     GAKLAEGTLFPVNQTADREGCTRHADGSVTTPKGYKEAYNLYREGGWLGLAVPEQYGG
                     QGLPYLLHTAVGEYMSSANMALTMYPGLTQGAIAAILTHGTDEQKDTYLPKMVEGTWT
                     GTMNLTEPHCGTDLGLLRTSAAPQADGTYKISGQKIFISAGEHDMSENIIHLVLARIE
                     GAPEGVKGISLFIVPKSILDENGNPGTRNGVSCGSIEEKMGIHGNATCVMNYDEATGY
                     LIGEANKGLRAMFTMMNEARLGVALQGLSIAETAYQNAVIYARERIQGRALSGAVAPE
                     KKADPIIVHPDIRRNLMNIRAFNEAGRALILWIALHSDIAHRSGDEAERQAADDLVGL
                     LTPVLKGVLTDKGFEHAVMAQQVFGGHGYIEEQGMSQYVRDARIAMIYEGANGIQALD
                     LVGRKLALNGGRAITAFFKEVGEFCETNRENEKLSFFTKYLKKGVNDLQAATMWLMQN
                     AMAKPDNAGAASNDYMHLFGLVALGYMWARMAKVAEEKLAAGEGNKAFFEAKLVTARY
                     YFERIMPESVTHLARIQSGADSMMALNAGTF"
     gene            438907..440115
                     /locus_tag="BAB_RS28480"
                     /old_locus_tag="BAB2_0443"
                     /db_xref="GeneID:3827152"
     CDS             438907..440115
                     /locus_tag="BAB_RS28480"
                     /old_locus_tag="BAB2_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643351.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="WP_002965848.1"
                     /db_xref="GI:489055701"
                     /db_xref="GeneID:3827152"
                     /translation="MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNG
                     IDTAKVDDIIFGCVDPVGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAA
                     AKVAFGSDDLVIAGGVESMSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYG
                     FSRDDVDAYAVESQKRAANSWEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALG
                     QLSPSFVMPGEMGGFNAVGIQAHPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKA
                     FDIKPRARIRAFANIGSEPALMLTGPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVL
                     RYMQAFDIPHDKINVNGGAIAMGHPLGATGAMILGTVLDELERRNLNTALVTLCIGAG
                     MGTATIIERV"
     gene            440131..442347
                     /locus_tag="BAB_RS28485"
                     /old_locus_tag="BAB2_0444"
                     /db_xref="GeneID:3827153"
     CDS             440131..442347
                     /locus_tag="BAB_RS28485"
                     /old_locus_tag="BAB2_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_002965849.1"
                     /db_xref="GI:489055702"
                     /db_xref="GeneID:3827153"
                     /translation="MAYVNFKVETDADGIALITWDMPEKSMNVFTVDAMQELNAIIDA
                     VIADDKIKGVVITSGKETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMS
                     GLFRKLETCGKPWVSAINGTCMGGAFEMSLACHARAASDAPGVKMALPEVKVGLFPGA
                     GGTQRVPRLANQQDALQMMTTGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLK
                     PVQPWDEKGFKLPGGAIYSAAGANLWPAATAILRRETSGNYPAALAILKSVYEGLLVP
                     FDTGLKIEQRYFTEILQTTEAGMMIRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGA
                     GFMGAGIAYVTAKAGIPVVLIDRDQESADKGKAHTADLITKEMQKGRATEADKEKLLS
                     LITATPDYAQLEGADLVIEAVFEDREVKRVATEKAEEVLKSSAVFASNTSTLPITGLA
                     KVSKRPKNFIGIHFFSPVDKMMLVEVILGKKTSDKALAVALDYVRAIKKTPIVVNDTR
                     GFYVNRCVLRYMSEAYNMLVEGVPAAMIENAARMAGMPVGPLALNDETAIDLSQKILK
                     ATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNGKGFYDYPAKPAKKHLWPGLKDLYP
                     QQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDPREADVGSILAFGFAPYTGGTLS
                     YIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENGETFHQRFNPYKGETKKAA"
     gene            442585..443241
                     /locus_tag="BAB_RS28490"
                     /old_locus_tag="BAB2_0445"
                     /db_xref="GeneID:3827154"
     CDS             442585..443241
                     /locus_tag="BAB_RS28490"
                     /old_locus_tag="BAB2_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_002967251.1"
                     /db_xref="GI:489057129"
                     /db_xref="GeneID:3827154"
                     /translation="MFSHESVWAAIDALAERHSLSASGLARRAGLDPTTFNKSKRYAA
                     DGRARWPSTESLAKVMEATGATFDEFTRLIAGVDSLPRHLGEYTQDPHPIPLLGMAEA
                     GAGGYFDDAGFPAGQGWDIVEFPARTGEGVYALEVSGESMLPLYRDGDTLIVAPNAAV
                     RRGDRVVVRTRDGEVMAKILHRQTPRTIELHSLNPEHPNRIFESKDIEWIARILWASQ
                     "
     gene            443242..444201
                     /locus_tag="BAB_RS28495"
                     /old_locus_tag="BAB2_0446"
                     /db_xref="GeneID:3827155"
     CDS             443242..444201
                     /locus_tag="BAB_RS28495"
                     /old_locus_tag="BAB2_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967252.1"
                     /db_xref="GI:489057130"
                     /db_xref="GeneID:3827155"
                     /translation="MMQRREKSHAHFVFGSLACLTGAVLIAAFVAPFYGALDRRVVVI
                     DSGSAEKSDKGAKNGIVVEQFDYNEPETAPELDTAQQAVPQPSQSAPAEGQPPAWKEN
                     GKANDHVNDTGMEREAPRPPLSDLGLASTPKPPEPQPPATSVDAGEQMQLLQRPVAVA
                     AGRLESQGRTIELQGIEIVPVEQTCETASGESWPCGMQARTAFRQWLRSRAVMCRLPE
                     NDSGAAVSTKCMLGNEDAAAWLVANGWAKAVPGGTYDEAGRKAVEAHLGIFGDKPDTS
                     LLNPESDSGNMLDNPSPLAPEQEPQPSSPSLQQGDFPPAPAAQ"
     gene            complement(444289..445944)
                     /gene="lysK"
                     /locus_tag="BAB_RS28500"
                     /old_locus_tag="BAB2_0447"
                     /db_xref="GeneID:3827156"
     CDS             complement(444289..445944)
                     /gene="lysK"
                     /locus_tag="BAB_RS28500"
                     /old_locus_tag="BAB2_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012093309.1"
                     /note="class I; LysRS1; catalyzes a two-step reaction,
                     first charging a lysine molecule by linking its carboxyl
                     group to the alpha-phosphate of ATP, followed by transfer
                     of the aminoacyl-adenylate to its tRNA; in Methanosarcina
                     barkeri this enzyme charges both tRNA molecules for lysine
                     that exist in this organism (but the tRNALysUUU very
                     poorly) and in the presence of LysRS2 can charge tRNAPyl
                     with lysine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_002965852.1"
                     /db_xref="GI:489055705"
                     /db_xref="GeneID:3827156"
                     /translation="MTSHRLPEITLTPELTAAAAEAKAWPFEEARKILKRYAKTGLPE
                     TVIFETGYGPSGLPHIGTFGEVARTSMVRHAFRILTQDKVKTRLICFSDDLDGMRKVP
                     DNVPDRAALEPYLQMPLSSVPNPFGGDYKSFAEHNNAMLCRFLDTFGFDYEFASATEY
                     YRSGRFDTVLLKAVERYDDIMKVMLPTLGEERQATYSPFLPISPKSGRVLYVPMKKVD
                     AKAGTITFDDEDGEETTLSVTGGKVKLQWKPDFGMRWAALGVDFEMFGKDHQTNAGIY
                     DRICEILGGRAPEHFVYELFLDQLGQKISKSKGNGISIDEWLAYAPTESLALYNFQKP
                     KTAKKLYFDVIPKTVDEYFTYLSAYARQEWKDRLNNPVWHIHYGNPPKADLPVTFALM
                     LNLVSASNAESPAVLWGFISRHVPGVTPENNPELDALVGYAIRYFNDFVKPTKKFRAP
                     DDVERAALEALDAKLGELPAGTDGNVIQNAILDVARAIERYQDHTKKSPEGGPGVSVS
                     FFQMLYEVLIGQERGPRFGSFVALYGIDETRALIKKALAGELA"
     gene            446139..446549
                     /locus_tag="BAB_RS28505"
                     /old_locus_tag="BAB2_0448"
                     /db_xref="GeneID:3827157"
     CDS             446139..446549
                     /locus_tag="BAB_RS28505"
                     /old_locus_tag="BAB2_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971209.1"
                     /db_xref="GI:489061168"
                     /db_xref="GeneID:3827157"
                     /translation="MKQITPQEALVYIMITTSAADTSMTDAELSSIGNVVSRLPVFQG
                     FDRDRLPKLASDCYALLAYEDGLERILDLAHEALPERLYDTAYALAVEVAAADLHVEQ
                     EELEFLQMLRDRWTLDELTVAAIERSARVRFRKL"
     gene            complement(446611..447264)
                     /locus_tag="BAB_RS28510"
                     /old_locus_tag="BAB2_0449"
                     /db_xref="GeneID:3827158"
     CDS             complement(446611..447264)
                     /locus_tag="BAB_RS28510"
                     /old_locus_tag="BAB2_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_002967253.1"
                     /db_xref="GI:489057131"
                     /db_xref="GeneID:3827158"
                     /translation="MKNDHSPDQRTLSELFEHNRQWAAEKQEKDPEYFSRLSSSQRPE
                     FLWIGCSDSRVPANVVTGLQPGEVFVHRNGANLVHRADLNLLSVLEFAVGVLEIKHII
                     VCGHYGCGGVRAAMDGYGHGIIDNWLQPIRDIAQANQAELDTIENTQDRLDRLCELSV
                     SSQVESLSRTPVLQSAWKDGKDIIVHGWMYNLKDGLLRDIGCDCTRNALQFACQPAE"
     gene            complement(447419..447763)
                     /locus_tag="BAB_RS28515"
                     /old_locus_tag="BAB2_0450"
                     /db_xref="GeneID:3827159"
     CDS             complement(447419..447763)
                     /locus_tag="BAB_RS28515"
                     /old_locus_tag="BAB2_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965855.1"
                     /db_xref="GI:489055708"
                     /db_xref="GeneID:3827159"
                     /translation="MSSLLPPLHDGHAPIYLHHAFHEAVDACEDWPLDSAEPVVQVNG
                     KITRISVVFRRLWNCTDTVPRDTLEALKEIVPSTLVRSERWRDNSTFAEAARVMRSVL
                     EMRKARALPAYY"
     gene            448118..449731
                     /locus_tag="BAB_RS28520"
                     /old_locus_tag="BAB2_0451"
                     /db_xref="GeneID:3827160"
     CDS             448118..449731
                     /locus_tag="BAB_RS28520"
                     /old_locus_tag="BAB2_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002965856.1"
                     /db_xref="GI:489055709"
                     /db_xref="GeneID:3827160"
                     /translation="MSGFVASRRAFLVGSTSLAALAFWPKATWAAQEVQKGGRLVVAA
                     DSEPRNLNPAIIASNGVFFVASKVIEPLAEAAYEGQGGLAPRLATSWEGSADGLTATF
                     RLREGVNWHDGKPFTSADVAFSAMEVWKPLQNLGRVVFKSLEKVETPDEHTAIFHFSE
                     PTPFQLIRNALPALTAVLPKHVFAGTDIAANPANEKLAGTGPFKYAEHKTGEYYRLVK
                     NADYWGEGEPYLDEVIYRVLPDRAAAADALEAGEIDLAAFSAVPLADLDRISKVPGLA
                     VISKGYEGLTYQLVVEINHRRKELADLKVRQAIAHAIDRDFVVKTIFQGFAVPSTGPV
                     PRYDSQFYTDDVPTYPFDVKKANALLDEAGYRRGKDGMRFALKLLPAPYFNETKQFGD
                     YLRQALAAIGIDAHIVNNDAAAHQKAVYTDHDFDLAIAPTVYRGDPAISTTILVESGI
                     PAGVPFSNQGGYANAELDALIAKAASTTDEKERTALYQKFQQMVEADLPLINVAEWGF
                     ITVASERVKNVSNNPRWAVSNWADTWLEP"
     gene            449749..450747
                     /locus_tag="BAB_RS28525"
                     /old_locus_tag="BAB2_0452"
                     /db_xref="GeneID:3827161"
     CDS             449749..450747
                     /locus_tag="BAB_RS28525"
                     /old_locus_tag="BAB2_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965857.1"
                     /db_xref="GI:489055710"
                     /db_xref="GeneID:3827161"
                     /translation="MYLADVKQILALLRKRLVGSMVVLLIVVIGCFFMLESAPGDAVD
                     AYGVTFGGDAGQIAEMRARWGLDQSVWHRLGAYLAALAQGNLGWSVSFNRPIFDVISE
                     RLPNTLLLMGAATALSFAVGSFLGVVAGARPGSFRDRFLSVASLVLYAVPGFWLALVL
                     VILFSIKLRWLPSSGIETIASGKHGLARASDIARHLILPVVSLAVIYLALYLRVMRAA
                     MADIWRMDFVRALRARGISRPRIVLFHVARNALLPLVTVLGVQAASMLGGSVVIESVF
                     AVPGLGRLAQEAVASRDTPLLLGVIITSALMVILVNFVIDLVYLWLDPRIAAGGRA"
     gene            450744..451574
                     /locus_tag="BAB_RS28530"
                     /old_locus_tag="BAB2_0453"
                     /db_xref="GeneID:3827162"
     CDS             450744..451574
                     /locus_tag="BAB_RS28530"
                     /old_locus_tag="BAB2_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_002965858.1"
                     /db_xref="GI:489055711"
                     /db_xref="GeneID:3827162"
                     /translation="MSGLKRYFATGEGMAGAAILVLLILAALCAPLFFPGDPLSIVST
                     PLMQPFENGDFLFGTDRLGRDVLAELFYGARTSLLVGLAAAFAAIVLGSIVGTLAGFA
                     GGFIDEALMRVAEAFQTVPGFLLALALVSIAGPSLPVLIAAIALSSWTQATRLTRAQV
                     LSIRESDYVAAARVIGMHPLEIAFRQILPNALPPVLALVPVIVASAILTEAALSFLGL
                     GDPNRVTWGGMIAEGRTVLRSAPWLSILPGAALALTVVGVYLAGEGLTEAMSRREAQP
                     "
     gene            451571..452326
                     /locus_tag="BAB_RS28535"
                     /old_locus_tag="BAB2_0454"
                     /db_xref="GeneID:3827163"
     CDS             451571..452326
                     /locus_tag="BAB_RS28535"
                     /old_locus_tag="BAB2_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_002971212.1"
                     /db_xref="GI:489061171"
                     /db_xref="GeneID:3827163"
                     /translation="MSKLVRLEKLSVRYGREMALQNIDLDIASGEILAVIGESGSGKS
                     TLALALASLLPAGAHVTGGMEWAAGRLQPGRDIGFIFQDPASSFDPLMTVGAQLVETI
                     RAHENSGRGQARAKAIALLERVHIPAPDESFHRYPHQFSGGQKQRIAVALAIAANSRL
                     LIADEPTSALDTIVQKEITALLQRLVREDGMTLVFITHDIALASGLADRIAVFRHGRL
                     IETGSAAFIVAKPQTDYTKALIAAVPDLEAVHG"
     gene            452319..453071
                     /locus_tag="BAB_RS28540"
                     /old_locus_tag="BAB2_0455"
                     /db_xref="GeneID:3827899"
     CDS             452319..453071
                     /locus_tag="BAB_RS28540"
                     /old_locus_tag="BAB2_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_002965860.1"
                     /db_xref="GI:489055713"
                     /db_xref="GeneID:3827899"
                     /translation="MAEPLLQARNLVFRYGGNLALNDVSFDMASGETLALVGPSGSGK
                     SMLARALLRLHPLASGAIRFEGENWLALSGSALRRRRAHMQLVFQDPLSAFNPRASLR
                     DLLYEPLRIHGIKRDIGELLQKVGLDSALAQRGVHEVSGGQRQRVAIARALATSPSLI
                     VLDEAVSALDVTVRGAILKLLREVQKAENTAYLFITHDLGVAAQMADRIAVMEHGRIV
                     ECRPTQELIATPHAPITRALIEAVPRLERFRF"
     gene            complement(453161..453976)
                     /locus_tag="BAB_RS28545"
                     /old_locus_tag="BAB2_0456"
                     /db_xref="GeneID:3828054"
     CDS             complement(453161..453976)
                     /locus_tag="BAB_RS28545"
                     /old_locus_tag="BAB2_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_002967254.1"
                     /db_xref="GI:489057132"
                     /db_xref="GeneID:3828054"
                     /translation="MQDKVVLVGCGNMGFAMLRGWLDSGILKAGDFHVVEPAEALRER
                     AALAHVHVYADAADLPADLQPRMVLVAVKPQMMANVLPTYKRFAPASTFVSVAAGIPV
                     ALFESHLGKDVAVIRCMPNTPAAIGKGMLVTFKNANVSDANEAFVTSLLKTSGKVASV
                     DEEGLMDAVTAVSGSGPAYIFHFIEALTDAGVNLGLPRETAALLAMQTVMGAGALADA
                     STDSPSKLREQVTSPNGTTAAALDVLMGGDRLKELVAEAVKAAHKRSVELGKS"
     gene            454297..455196
                     /locus_tag="BAB_RS28550"
                     /old_locus_tag="BAB2_0457"
                     /db_xref="GeneID:3828226"
     CDS             454297..455196
                     /locus_tag="BAB_RS28550"
                     /old_locus_tag="BAB2_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein FolD"
                     /protein_id="WP_002967255.1"
                     /db_xref="GI:489057133"
                     /db_xref="GeneID:3828226"
                     /translation="MAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIVGEDP
                     ASQVYVASKSRKAKECGFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPLPG
                     HIDSGRVIQTIAPEKDVDGFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLS
                     GLNAVVIGRSNIVGKPMFNLLLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMV
                     KGDWVKPGATVIDVGINRIPAPERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMT
                     IAMLMANTLTAACRSAGMKKPVF"
     gene            complement(455288..457111)
                     /locus_tag="BAB_RS28555"
                     /old_locus_tag="BAB2_0458"
                     /db_xref="GeneID:3827900"
     CDS             complement(455288..457111)
                     /locus_tag="BAB_RS28555"
                     /old_locus_tag="BAB2_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphogluconate dehydratase"
                     /protein_id="WP_002968843.1"
                     /db_xref="GI:489058760"
                     /db_xref="GeneID:3827900"
                     /translation="MSTETAHKRIQEITERIRERSKPTREAYLDRVREAASNKPKRSF
                     LGCANLAHGFAACGPHDKAALTADVVPNLGIITAYNDMLSAHQPFETFPQLIKQAARE
                     AGGVAQVAGGVPAMCDGVTQGFAGMELSLFSREVIAMATAVGLSHDMFDAAVYLGVCD
                     KIVPGLIVGALTFGHLPPVFIPAGPMTSGLPNDEKAKTRQLYAEGKAGRAELLESESK
                     SYHGPGTCTFYGTANSNQMLMEIMGLHLPGASFINPGTPLRDALTREAAKRALAITAL
                     GNEYTPVGEMIDERSIVNGVVGLNATGGSTNHTIHLIAMAAAAGIKLTWHDISQISDV
                     VPLLARVYPNGLADVNHFHAAGGMGFLIRELLDGGLLHEDVRTVWGEGLRPYAIEPKL
                     GPDGNVVREAAPEKSGDDKVLAKIAAPFQPTGGIKVLSGNIGNAIIKVSAVKPERHVI
                     EAPAKVFNDQAELQAAFKAGDLTGDFIAVVRYQGPKANGMPELHKLMTVLGILQDRGQ
                     RVALVTDGRLSGASGKVPSAIHVTPEALDGGMVGKIRTGDIIRLDAINGTLEVLLNQA
                     VLDSRIEERPDLSGNEYGTGRELFRAFRQIAGRADEGASVF"
     gene            complement(457147..457845)
                     /locus_tag="BAB_RS28560"
                     /old_locus_tag="BAB2_0459"
                     /db_xref="GeneID:3828045"
     CDS             complement(457147..457845)
                     /locus_tag="BAB_RS28560"
                     /old_locus_tag="BAB2_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="WP_002968509.1"
                     /db_xref="GI:489058412"
                     /db_xref="GeneID:3828045"
                     /translation="MSIERHDFISATELAQSLSEAIANKLATAIAERGQAVLAVSGGT
                     TPLKLFEVLSRKMIDWNLVTITLVDERFVPVENERSNEKLVRDHLLRDHAGVARFVGL
                     YNPAATAETAALAAASRIDALRRPFDVVVLGMGNDGHTASFFPNADRLDQAINPATRA
                     LVLPIHAEGAGEKRLTLTLPLIAEAEMLVLHIEGAAKQATLEKALAGDDEREMPVRAV
                     FHHARAPIQLYWAS"
     gene            complement(457974..459449)
                     /locus_tag="BAB_RS28565"
                     /old_locus_tag="BAB2_0460"
                     /db_xref="GeneID:3827901"
     CDS             complement(457974..459449)
                     /locus_tag="BAB_RS28565"
                     /old_locus_tag="BAB2_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006199945.1"
                     /note="catalyzes the formation of D-glucono-1,5-lactone
                     6-phosphate from D-glucose 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="WP_002965865.1"
                     /db_xref="GI:489055718"
                     /db_xref="GeneID:3827901"
                     /translation="MTSQTIPVDPFDCIVFGGTGDLAERKLIPALYQRQRAGQLSDPT
                     RIIGASRSQMTDDEYRTFAGNAIKEHVKPEEVDQAEVEIFLKRLHYVAVDAKSDEGWD
                     ALKTLIGKKPEKIRAFYLAVSPTLFGDIATRLKAHGLITRDTRIVVEKPIGRDLDSAK
                     ALNDTLGSVFREDQIFRIDHYLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAE
                     AVGLEGRAGYYDKAGALRDMVQNHILQLLCLVAMEPPSSIEADAVHDEKVKVLRSLQP
                     ISTHNVEELTVRGQYRAGASAGGPVKGYLEDLESDTSNTETFVALKAEIANWRWAGVP
                     FYLRTGKRLATRVSEIVVTFKPIPHSIFGESAGKVIANQLVIRLQPDEGVKQWLMIKD
                     PGPGGMRLRHMPLDMSFAESFEDRNPDAYERLIMDVVRGNQTLFMRRDEVEAAWRWID
                     PILQAWEFNSQPVQGYTAGTWGPSSSIALIERDGRTWHESL"
     gene            459720..460469
                     /gene="fabG"
                     /locus_tag="BAB_RS28570"
                     /old_locus_tag="BAB2_0461"
                     /db_xref="GeneID:3827902"
     CDS             459720..460469
                     /gene="fabG"
                     /locus_tag="BAB_RS28570"
                     /old_locus_tag="BAB2_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443435.1"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_002965866.1"
                     /db_xref="GI:489055719"
                     /db_xref="GeneID:3827902"
                     /translation="MNRLQDKVAIITGAGSGFGLGMARRFAAEGARVVLADVNVKRVE
                     DGLADISSNGISIQADVSRKDDMERVARTAFEEFGRIDIMVNNAGFTHRNMPLTDVDE
                     HNFDLIVAVNMKALYYSTQLVVPIMEHQGGGVIINTASATGLHPRKGLTWYCASKGWV
                     VSATKAMALELAERNIRVNCLCPAESDGEGLKMFLAEDTPEARAALKSTIPLGRFSTP
                     KDVAEAALWLASDDASMVTGVALGIDGGYSI"
     gene            complement(460558..461844)
                     /locus_tag="BAB_RS28575"
                     /old_locus_tag="BAB2_0462"
                     /db_xref="GeneID:3827903"
     CDS             complement(460558..461844)
                     /locus_tag="BAB_RS28575"
                     /old_locus_tag="BAB2_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006161894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002968952.1"
                     /db_xref="GI:489058871"
                     /db_xref="GeneID:3827903"
                     /translation="MSTTQAAAGDASQMETPHPNGSFTQSNADENHEQYWKQNLVICL
                     LGSFTTLIAMSLLLPFLPLYVEQLGVISHAAIVQWSGIAYGATFLAAAFVAPLWGRLG
                     DRYGRKLMLIRASLGMAVAMSLIGMVTSVWQLVALRLFVGIAGGYSSGSMILVATQTP
                     KDKTGWALGALSAGIMAGNLAGPLLGGALPPLIGIRATFWLAGGVIFLTFLATTFLIR
                     EERKPPKPTREEKTQSIWAAIPDKGPVVAMLVTGILLLFANMSIEPILTIYVMQLMDD
                     QTKVTLVSGVVMAAAALGSILSSSRLGQLADRIGHTRVIIGALAVSALLLVPQAFVTD
                     AWQLIGLRFLMGLALGGLLPCITSVIRHNVPDRVAGGILGYSVSAQYVGQVAGPVAGG
                     FVGGHFGMRAVFLGTCLMMAAGAIYNWAVLRNSKTR"
     gene            complement(462044..462343)
                     /locus_tag="BAB_RS28580"
                     /old_locus_tag="BAB2_0463"
                     /db_xref="GeneID:3827904"
     CDS             complement(462044..462343)
                     /locus_tag="BAB_RS28580"
                     /old_locus_tag="BAB2_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965868.1"
                     /db_xref="GI:489055721"
                     /db_xref="GeneID:3827904"
                     /translation="MIDPRVALTILAMASVTYLTRIGGYVLLRNRTLSNRAMAVMEAA
                     PGCVLISVIAPDFVSDKPANLIALAVTVFAATRFSMLPTVLIGMGAASICRYLIG"
     gene            complement(462340..463080)
                     /locus_tag="BAB_RS28585"
                     /old_locus_tag="BAB2_0464"
                     /db_xref="GeneID:3827905"
     CDS             complement(462340..463080)
                     /locus_tag="BAB_RS28585"
                     /old_locus_tag="BAB2_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_002967257.1"
                     /db_xref="GI:489057135"
                     /db_xref="GeneID:3827905"
                     /translation="MDILQVYAPQKGKPAWRSEFRRGIVSGFPVLLGMIPFALVLGAQ
                     AAHTGLTLAEVSMMTGLNFAGGSEFAAFRLWSSPPDVLLIAAITFLVNSRHLLMGAAL
                     APFLRHFPKRTAFLTLFLMCDESWAVSLADAKRRQAKGVNAALNLAYYMGVAIPFYLA
                     WVMSATLGAVFGPMIGDLHPYGFDMAIPAVFLVLIAGMWKGFAAARPWFVSLVAAAAT
                     HVFVPGALYVASGAISGLAAAYLLTGEK"
     gene            463462..463920
                     /locus_tag="BAB_RS28590"
                     /old_locus_tag="BAB2_0465"
                     /db_xref="GeneID:3827906"
     CDS             463462..463920
                     /locus_tag="BAB_RS28590"
                     /old_locus_tag="BAB2_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002972097.1"
                     /db_xref="GI:489062069"
                     /db_xref="GeneID:3827906"
                     /translation="MKLDEIDKKILRALQRNGRIANNDLAREVGLSPSPCLRRVKLLE
                     EAGVIDRYVAVLNPAKIGKGLTFFTRIRLDQQDEETLQKFANEIMRLPQVLECYFMLG
                     DYDAMIRGVATDIEDYRRFQSEYLSRIKGVQNLKTDVPSQIVKQISEMPL"
     gene            464309..464977
                     /locus_tag="BAB_RS28595"
                     /old_locus_tag="BAB2_0467"
                     /db_xref="GeneID:3827908"
     CDS             464309..464977
                     /locus_tag="BAB_RS28595"
                     /old_locus_tag="BAB2_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-regulated protein FrpC"
                     /protein_id="WP_002969314.1"
                     /db_xref="GI:489059243"
                     /db_xref="GeneID:3827908"
                     /translation="MGNKWWHHGGHGSRCLLKGTLVTTPNGPVAVEKLCVGDLVTTVS
                     GECLPIKWIGWQNYRAGEADWNESVMPIRVRRHALDGRTPHRDLYLSPNHALFIDGVL
                     IRVKDLVNGRSIMRIPVERTLDYYNIVLDRHAVVLAEGAAVETFLMRGDGYRGFTNFS
                     EYERLYPDEAEIVMQPCAPAMGYEGARQHMRALLGLSGIVPVRDVVEETYQRLAARAG
                     SYAA"
     gene            465266..465703
                     /locus_tag="BAB_RS28600"
                     /old_locus_tag="BAB2_0468"
                     /db_xref="GeneID:3827909"
     CDS             465266..465703
                     /locus_tag="BAB_RS28600"
                     /old_locus_tag="BAB2_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_002967258.1"
                     /db_xref="GI:489057136"
                     /db_xref="GeneID:3827909"
                     /translation="METKNHVLTDIDYQVLAEWRYRSRRFMSFSATAAEAEGLPPQQH
                     QALLAIKASGPDKLMTVGTLAERLVVAPHTATELTGRLVAAGLVARVVDLADRRRHTL
                     ELTIEAEHILERLSSVHLAEIRELAPKFIDVLIKLNKMANEPE"
     gene            complement(465714..467000)
                     /locus_tag="BAB_RS28605"
                     /old_locus_tag="BAB2_0469"
                     /db_xref="GeneID:3827910"
     CDS             complement(465714..467000)
                     /locus_tag="BAB_RS28605"
                     /old_locus_tag="BAB2_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002965873.1"
                     /db_xref="GI:489055726"
                     /db_xref="GeneID:3827910"
                     /translation="MPYQSPISPGYSWYEANTPDRPQYPELDGSQQADVVVIGGGYTG
                     LSAAYHLAKQGTDVVLIEAARLGDGASGRNGGQFGTGQRTWAEDLETEYGYERAKALF
                     NVAEEAKSYLLAFAEEHAIDMEYVQGHISVVHKPRYLKSYERHVEQMASRFNYPHQRF
                     LDRAETAELLGTSRYHGGVYDSATGHIHPMKLLIGTAKAAHTAGAKLFEDTKATKIST
                     ASGRVEVETTRGTIRARHAFIAVNAYGGRLEPVSASHVMPIRSFIGATAPLGDDSPVI
                     PGGESVDDSRFVVRYFRRSKDGRLLFGGREAYTADNPRDISAHIRRQITEIYPALENV
                     EITHAWGGSVGITMPRQPFVREVMPGVISAGGYSGHGVMLANYVGKLYADTLAGRREK
                     LKLFEELRIPPFPGGRTFRSPLLILALSWYALMDRI"
     gene            complement(467054..467416)
                     /locus_tag="BAB_RS28610"
                     /old_locus_tag="BAB2_0470"
                     /db_xref="GeneID:3827911"
     CDS             complement(467054..467416)
                     /locus_tag="BAB_RS28610"
                     /old_locus_tag="BAB2_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968953.1"
                     /note="crystal structure of protein from Xanthomonas shows
                     pentameric toroidal structure; physiological function is
                     unknown; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965874.1"
                     /db_xref="GI:489055727"
                     /db_xref="GeneID:3827911"
                     /translation="MSINSYRDILVWQQAMELVTAIYKSTETWPREEIYGLTSQIRRA
                     AVSIPANIAEGYGRDTRGAYQQFLRIAQGSLKEMETHLLIAEQLGFIAKERAEPIMAM
                     GESIGKLLRLLIRKLSET"
     gene            complement(467452..468882)
                     /locus_tag="BAB_RS28615"
                     /old_locus_tag="BAB2_0471"
                     /db_xref="GeneID:3827912"
     CDS             complement(467452..468882)
                     /locus_tag="BAB_RS28615"
                     /old_locus_tag="BAB2_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_002965875.1"
                     /db_xref="GI:489055728"
                     /db_xref="GeneID:3827912"
                     /translation="MSADTTEKKATRTPRRRTPAYVKSLRGVKNWKQATEWLAWRDIE
                     DIECITPDQAGVARGKMMPSKKFTSNTSLALPSAVFMTTISGAYPEDGYGFHYPEDDG
                     DLKLLPDLTTLSAVPWETDSTAQVICDLVYQDGHAVEFTPRNVLRNVIAAYSKRGLKP
                     VVAPEIEFYLVRKNPDPDYPLTPPVGRSGRAIGGGQGYSIAGVNEFDELIDDIYHFSE
                     GQGLEIDTLIHEEGAGQLEINLRHGDPVELADQVFMFKRTIREAALKHDMYATFMAKP
                     IQGQPGSAMHIHQSIVDKKTGRNIFTNEDGSESQAFHHFLGGMQRHVPNALVMFAPYV
                     NSYRRLTPDASAPVNVKWGYDNRTTAFRVPRSDPSARRVENRIPSSDANPYLALAASL
                     ACGLIGLVNKIEPEQPATTSVNTKEVELPRGLIDAVELFEEDAELRNLFGSSFMTTYA
                     AIKRAEFETFMEVISPWEREFLLLNV"
     gene            complement(468886..469140)
                     /locus_tag="BAB_RS28620"
                     /old_locus_tag="BAB2_0472"
                     /db_xref="GeneID:3827913"
     CDS             complement(468886..469140)
                     /locus_tag="BAB_RS28620"
                     /old_locus_tag="BAB2_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965876.1"
                     /db_xref="GI:489055729"
                     /db_xref="GeneID:3827913"
                     /translation="MLIIENLAGATFTCRAPSRPACPLPGQSFTGRAFFIVSKGKNIK
                     LRQSHLRGPNKNDPCPQKRKGPFVKSACHSYHINIEMIFW"
     gene            complement(469134..469436)
                     /locus_tag="BAB_RS28625"
                     /old_locus_tag="BAB2_0473"
                     /db_xref="GeneID:3827914"
     CDS             complement(469134..469436)
                     /locus_tag="BAB_RS28625"
                     /old_locus_tag="BAB2_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965878.1"
                     /db_xref="GI:489055731"
                     /db_xref="GeneID:3827914"
                     /translation="MIATSNFTATDLPAGSGRVSAFTQLVKVIFAPALRRWTFSKGKR
                     QVMSLSDFDDHMLHDIGLRREDIYTAMRDRRVEDPTRILSELAIARLRMEAARHIC"
     gene            469603..470571
                     /locus_tag="BAB_RS28630"
                     /old_locus_tag="BAB2_0474"
                     /db_xref="GeneID:3827915"
     CDS             469603..470571
                     /locus_tag="BAB_RS28630"
                     /old_locus_tag="BAB2_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006220664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002967259.1"
                     /db_xref="GI:489057137"
                     /db_xref="GeneID:3827915"
                     /translation="MGAPLDLDQLQTFVAIADAGSFTRAADAVFKTQSAVSMQMRRLE
                     ERIGKPLFDRDGRTNRLTEDGERLLLYARRMMHLNSETIAAFDDTQLEGHVRIGTPDD
                     YADRFLPEIMARFARSNPRVELSVVCEPTVNLDEMIRRGTLDIALVTQCDDKRRSEVV
                     RTEPLLWVTSTNHAVHEEAMLPLAVGRPTCIWRHAAIDVLEAARRDYRIIITSWSATV
                     LAAAVLSGLAVSVLPECALRPGMRVLGEADGFGMLPEIGIGIMRGHSKQNAAVDALAQ
                     HIIESLDNISSPQPGGLAGAMSSAEISPFPAVCTRRVRTNELLPGW"
     gene            470640..472175
                     /locus_tag="BAB_RS28635"
                     /old_locus_tag="BAB2_0475"
                     /db_xref="GeneID:3827916"
     CDS             470640..472175
                     /locus_tag="BAB_RS28635"
                     /old_locus_tag="BAB2_0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease 7 large subunit"
                     /protein_id="WP_002968954.1"
                     /db_xref="GI:489058873"
                     /db_xref="GeneID:3827916"
                     /translation="MASDSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEIS
                     GYRGPHSSGHAYFALKDDRARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSK
                     YQIVIEQMEPAGAGALMALLEERKQRLAAEGLFDPTLKQLLPFMPRVIGVVTSPTGAV
                     IRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVAR
                     GGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDWTLIDLAADMRAPTPTGAAEMA
                     VPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARAMPSADQLLALPRRRFDEAA
                     SRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGVTMLGQRLPRALEAFLRE
                     RRTAFTHRANRLSPEPILRRTRLTGSTLEQLDRRRDQAVRLLIERVKRRSQELDRLMR
                     TLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFRDGDVGVVARAGLTIPDPT
                     KGQ"
     gene            complement(472241..473614)
                     /locus_tag="BAB_RS28640"
                     /old_locus_tag="BAB2_0476"
                     /db_xref="GeneID:3827917"
     CDS             complement(472241..473614)
                     /locus_tag="BAB_RS28640"
                     /old_locus_tag="BAB2_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_002965881.1"
                     /db_xref="GI:489055734"
                     /db_xref="GeneID:3827917"
                     /translation="MARDTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYT
                     ANNSPVPYGGPRGIKAILEGMQARLGWEPIMDEGNIIGLVEPTGQGAISLEPGGQFEL
                     SGAPLSTIHQTCREVNAHLSQVREIAEPLGIRFLGVGGSPKWTLAETPAMPKSRYKIM
                     TNYMPKVGHEGLDMMYRTSTIQVNLDFSSEQDMRRKMQVSMKLQSVATALFASSPFTE
                     GKPNGLLSWRSSIWRDTDNQRSGVLPFVFSENFGFADYVNWALDVPMYFILRDGHYHD
                     CTHVTFRQFMNGALKGEVSDPVPNMGDWTNHLSTLFPEVRLKRFLEMRGADGGPWRRI
                     CALPAYWVGLLYDEEALAAAELLTKDWTYEEVLALRNEVPTKALKTDFHGKPLELIAR
                     ETLKISRLGLLNRKKLNSDGYDETHFLAPLEEIVAAATTDAERMLNAYHSVWAGSVDP
                     IFLEYAY"
     gene            complement(473714..474460)
                     /locus_tag="BAB_RS28645"
                     /old_locus_tag="BAB2_0477"
                     /db_xref="GeneID:3827841"
     CDS             complement(473714..474460)
                     /locus_tag="BAB_RS28645"
                     /old_locus_tag="BAB2_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_002969316.1"
                     /db_xref="GI:489059245"
                     /db_xref="GeneID:3827841"
                     /translation="MRANYRMQRLYVENELRAGVSFDAGAQAAHYLTHVLRMKEGDEV
                     LVFNGRDGEWKASLQPEGRKRLLLEPLEQTRPQPKPSELIYCFAPLKQGRLDYMVQKA
                     VEMGAGVLQPVITQHTQVLRLGTERIRANAIEAAEQCGVLSLPDCREALRFDRFLDQW
                     DTSRRLIFCDEGHESDDPLSILTGLEPGPSGLLIGPEGGFSEEERQLLHRQPFVTAIP
                     LGPRILRADTAAVAAMALVQAVLGDWRNAA"
     gene            474710..475132
                     /locus_tag="BAB_RS28650"
                     /old_locus_tag="BAB2_0478"
                     /db_xref="GeneID:3827842"
     CDS             474710..475132
                     /locus_tag="BAB_RS28650"
                     /old_locus_tag="BAB2_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_002965883.1"
                     /db_xref="GI:489055736"
                     /db_xref="GeneID:3827842"
                     /translation="MKQAWVEFAPLLASAARGWRKAFDAAMAEHGLSDAKAIPLITLL
                     RHGDCIPQGVLAERVGIEGATIVRIVDELEKDGLIQRIVDDADRRVKLIQLTEDGRAV
                     ATQVEKSAARLRAQFLGGFDLQEVDVAMEVLRKLNEKF"
     gene            475190..477286
                     /locus_tag="BAB_RS28655"
                     /old_locus_tag="BAB2_0479"
                     /db_xref="GeneID:3827843"
     CDS             475190..477286
                     /locus_tag="BAB_RS28655"
                     /old_locus_tag="BAB2_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein"
                     /protein_id="WP_002965884.1"
                     /db_xref="GI:489055737"
                     /db_xref="GeneID:3827843"
                     /translation="MTKLAETTPKFWDVVFSLKTFAAAMLALWIGLMANLPNPYWSVA
                     AVYIVAHPLSGATTSKGFYRLIGTIIGGAVTVVFVPHLVNSPEILTLAIGLWMGLCLV
                     ISLLDGTPRSYLFMLAGYTVAIASFAVVQAPETTFDYALGRVEEIAVGIICAAVVNRL
                     VFPRHSGPVLVGRIDNWLRDGSKLAVASMRGEGDSPEFRRDRQRLAADTLELRNLTTH
                     VAYDTSSIRNVAPLLHVLQQRMVAVLPIISSLHDVLLLKPGEGEKPWHPAVQQLLDEV
                     CDWLQSGENLTEERRTVFLRLIEEIDRHSRDASTWGELLPFNLSARIRDLVQIWSDCL
                     TLKQDISSGSRHSLRWRRYDAHLKGRPMHRDYGMALLSGFSSFLATCVATALWVASGW
                     AQGSAAAMMAGIFCCIFATMDDPVPVIRKFNCLLMVVIAAAFVFEFALLPLVNGFMPL
                     VLVLGLFLVPAGMLLVIPSQFLLGMVLCVNLPNMLMLQSHLTLDFPSFANANLATVLG
                     IVIAAVVTSIVRSVGAEWSVRRLVKAGWSDIVLATERRPGRYRREHMNRLLLRMIDRI
                     GMMAPRLALIPDADVAKVDLLRDLRNGMNTIDLQQYRAKLPAPCREAVDEVLDGVGAH
                     YRALSNKTRDTVEHIDERLLAAIDKAIATIIENGSPAVARRPRIALVALRFNLFPKAP
                     PFVLPPLPQLEFAQAA"
     gene            477313..477522
                     /locus_tag="BAB_RS28660"
                     /old_locus_tag="BAB2_0480"
                     /db_xref="GeneID:3827844"
     CDS             477313..477522
                     /locus_tag="BAB_RS28660"
                     /old_locus_tag="BAB2_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965885.1"
                     /db_xref="GI:489055738"
                     /db_xref="GeneID:3827844"
                     /translation="MHPEFDIYGIYIPSLGLLALAAYFANTLMQRLLARVHFYRFVWH
                     RPLFDAAMYFCILGVAAVLLNGIPL"
     gene            477519..478385
                     /locus_tag="BAB_RS28665"
                     /old_locus_tag="BAB2_0481"
                     /db_xref="GeneID:3827845"
     CDS             477519..478385
                     /locus_tag="BAB_RS28665"
                     /old_locus_tag="BAB2_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="WP_002965886.1"
                     /db_xref="GI:489055739"
                     /db_xref="GeneID:3827845"
                     /translation="MKKLLAHSGRVFLTLVMVVMAGLLGWHLWDYYMNAPWTRDGKIR
                     ADVVRIAPDVSGLVSEVLVHDNQTVHKGDVIFRIDQARYKLALQTAEAKADSSKAALD
                     MANRDLVRYRQLNDTTVTRQKLEQVETAAQQAEAAHRQAELDRDLAALNMERSSIKAP
                     VNGVITNFSLQPGDYVSAGSAVTALVDTDSYYVSGYFEENKLERIHIGDPVVVDVMGS
                     KVQLKGKVEGIAGGIEDRERSDSQSLLANVSPTFNWVRLAQRVPVRVKLEDVPQGIHL
                     VAGRTVSVSVVD"
     misc_binding    478504..478736
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            478936..479970
                     /locus_tag="BAB_RS28670"
                     /old_locus_tag="BAB2_0483"
                     /db_xref="GeneID:3827847"
     CDS             478936..479970
                     /locus_tag="BAB_RS28670"
                     /old_locus_tag="BAB2_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002965888.1"
                     /db_xref="GI:489055741"
                     /db_xref="GeneID:3827847"
                     /translation="MKIIKNRPFLAAFYSFAFLVTGFSGSSLAGETRYPLTLKNCGRE
                     VTFHHAPQRAVAIGQSSAEILYNLGLGDRVVGTAVWFGPVMKGYEEVNARVKRLADND
                     PSLESVLAQKSDMVAAQFQWHVGPEGIVAKPEQFEELGIPVYTAPADCIGKVNSGKGD
                     GVRHTVFTMDLIYQEIRELAEIFNVQDRGEKVIADLKAREEAARKKIASANGRLSAVV
                     WFSSAQMDIDPYVAGKNGAPAYILSALGIRNVIGSEEEWPTVGWETIAKSDPTMIIAG
                     KMDRRRYPADDIAVKRKFLETDPVASLMPAVKDGHVFDMDAQAMNPTIRTIEGIETLA
                     DAIAAAGLNK"
     gene            480012..481010
                     /locus_tag="BAB_RS28675"
                     /old_locus_tag="BAB2_0484"
                     /db_xref="GeneID:3827848"
     CDS             480012..481010
                     /locus_tag="BAB_RS28675"
                     /old_locus_tag="BAB2_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965889.1"
                     /db_xref="GI:489055742"
                     /db_xref="GeneID:3827848"
                     /translation="MGAGVLALVLLFVALWLGAAIGETSIPLDVVAKTVANRLWYAGY
                     PLDPIDEGIVWSYRLSRAVVAACCGAALALSGVVLQSLLRNSLADPYILGISAGASTG
                     AVSVAILGIGAGILTLSFGAFIGAIVAFALVAMLAMRAGRGNSAIILAGIAGSQLFNA
                     LTSFIVTKAANAEQARGIMFWLLGNLSGVRWPDVALALPVCLAGLAVCLWHARALDAF
                     TFGAESAASLGIPVRRIYAVLIGASAMMTAVMVSIVGSIGFIGLVIPHAARMIVGVRH
                     DVLLPAAALIGAIFMILADILSRTIIPGQVLPIGVITALFGAPAFALLLGQKRGHP"
     gene            481007..481801
                     /locus_tag="BAB_RS28680"
                     /old_locus_tag="BAB2_0485"
                     /db_xref="GeneID:3827849"
     CDS             481007..481801
                     /locus_tag="BAB_RS28680"
                     /old_locus_tag="BAB2_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphatase"
                     /protein_id="WP_002965890.1"
                     /db_xref="GI:489055743"
                     /db_xref="GeneID:3827849"
                     /translation="MMLSARNVCWAAGCAEILHDVSLDVVKGEFLGIIGPNGSGKTTL
                     LSLLSGIRRPRSGTVLLGNAPIQKFNRREIARRLALVEQQAETTERITARQAVELGRT
                     PYLGALSPWSAADDAIVGKALENVDMAHLAGRCWHTLSGGERQRLHIARALAQEPQIL
                     LLDEPTNHLDIGHQIGLLDLVSRQGLTVVAALHDLNHAAMFCDRIAVMDTGQLVALGS
                     PREVLSAESIRAVFGVEVDVEYHGVRGCHIRYRLPDRPSLELRCLA"
     gene            complement(482261..483712)
                     /locus_tag="BAB_RS28685"
                     /old_locus_tag="BAB2_0487"
                     /db_xref="GeneID:3827851"
     CDS             complement(482261..483712)
                     /locus_tag="BAB_RS28685"
                     /old_locus_tag="BAB2_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968847.1"
                     /db_xref="GI:489058764"
                     /db_xref="GeneID:3827851"
                     /translation="MRIFTASLATETNTFSPVPTDRASFEMAFYAAPDKHPETPTLCS
                     SPIVALRKRAAAEGLTVIEGTATWAEPGGLLQRQTFEELRDEILDQLKAAMPVDAVVL
                     GLHGAMVAQGYDDCEGDLLERVRAIVGPGVLVASEFDPHSHLTPKRVQNLNIFASFLE
                     FPHTDFYERGEHVVELALDALKGRTKPVISTFDCRMIAVLPTSKEPMRSFVDRIKALQ
                     GKDGILSISVIHGFMAADVPEMGTRILVVTDNDPQKGAALAEKLGREQTSMAMLDTDQ
                     GIDRALAAHAANPSKPAVIADVWDNPGGGVAGDGTYILRRLIERGVNNAGIATIWDPI
                     AVTFCHAAGEGAVIDLRFGGKSGPLGGEPIDARVTVLKVANEGWQSFGPSRVTLGPSA
                     VVRIEDTGIDIILNTNRTQTFEPDIFSNLGIDPMTKNVLVVKSTNHFHAGFAPVAAEI
                     IYVDAPSSYPSNPRTTNYRKLNRAIWPRVEDPW"
     gene            complement(483739..484110)
                     /locus_tag="BAB_RS28690"
                     /old_locus_tag="BAB2_0488"
                     /db_xref="GeneID:3827852"
     CDS             complement(483739..484110)
                     /locus_tag="BAB_RS28690"
                     /old_locus_tag="BAB2_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation inhibitor"
                     /protein_id="WP_002965893.1"
                     /db_xref="GI:489055746"
                     /db_xref="GeneID:3827852"
                     /translation="MSRKQVFGASHVPLSPAVRVGDMVYVSGQVPVGPNGQIVEGGIE
                     AQTRQVLENIKAALALAGAAMEDVVKTTVWLEDARDFGRMNAVYGTYFPKEPPARTTV
                     ESRLMIDIKIEIEAVAYAPQK"
     gene            complement(484123..484950)
                     /locus_tag="BAB_RS28695"
                     /old_locus_tag="BAB2_0489"
                     /db_xref="GeneID:3827853"
     CDS             complement(484123..484950)
                     /locus_tag="BAB_RS28695"
                     /old_locus_tag="BAB2_0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965894.1"
                     /db_xref="GI:489055747"
                     /db_xref="GeneID:3827853"
                     /translation="MMSAKLKRTVVAWAVLSPLIVLTLFPFAVMFLTAVKPAQEVLSP
                     NWWPSTFRWQNFSEMWVATNFGNALLNSIYVSVIASVGAIIISIPAAYAMSRFRFAAH
                     GAFRQFLLVSQMISPIVLVLGLFRLLAAYGLIESVSAVGAVYMAFNIAFTVWMLQSYF
                     DTIPRDLEEAAWMEGAGRGKTLVKVFLPLCLPAIAVTAIFTFINAWNEFVVALTMLRR
                     QESYTLPIQVFSLVAGRYTVEWHYVMAATFLATLPVAILFIWLQRYLIKGLALGAVK"
     gene            complement(484947..485816)
                     /locus_tag="BAB_RS28700"
                     /old_locus_tag="BAB2_0490"
                     /db_xref="GeneID:3827854"
     CDS             complement(484947..485816)
                     /locus_tag="BAB_RS28700"
                     /old_locus_tag="BAB2_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965895.1"
                     /db_xref="GI:489055748"
                     /db_xref="GeneID:3827854"
                     /translation="MQNRTLPYFLILPSLLLAAVVIFWPVVHLFEIATHDVNRFGQLR
                     EFNDGANFTALFATAEFMNALWRTAVWTVAVVGGALVLSIPVAIILNMDFYGRSVARV
                     IIMLPWAVSLTMTAIFWRWALNGESGMLNSALHGLGLIDTNIQWLASAATAFPMQILV
                     GILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVLN
                     TIYVFNSFPIIWVMTQGRPANSTDILVTHLYKLAFRLGKFGEASAVSLIMLAILLVFT
                     VIYIRISTRSEQS"
     gene            complement(485889..487124)
                     /locus_tag="BAB_RS28705"
                     /old_locus_tag="BAB2_0491"
                     /db_xref="GeneID:3827855"
     CDS             complement(485889..487124)
                     /locus_tag="BAB_RS28705"
                     /old_locus_tag="BAB2_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bicyclomycin resistance protein"
                     /protein_id="WP_002965896.1"
                     /db_xref="GI:489055749"
                     /db_xref="GeneID:3827855"
                     /translation="MLIRKWKAGLLAGLSILALASSADAGEVRMTVAEYSAKTGPYFE
                     EVKKAFEAENPGITLNFEVVPWDVLLQKLTTDISAGTNADLSIIGTRWLIDFVQQGIA
                     EPLDGYMNDEFKGRFIETFLSPSVLDGKTYGLPIAASARAMYYNKDLFEKAGIKNPPA
                     NWDELKADAAKIKALGGENYGFGLQGKEIETDVYYYYAMWSYGTEILNKDGTSGLSTP
                     GALEAAKLYKSMIDDGLTQPGVTSYAREDVQNLFKQGKVGMMITAPFLSNQIKEEAPN
                     LKYGVAAIPAGPTGARGTYGVTDSVIMFQNSKNKEEAWKVLDFLFQKDWRAKFTQNEG
                     FLPVNKEEAKMDYYVNNADLAAFTALLPDARFAPVIPGWEEIADITSNAMQSIYLGKG
                     EPDAVLKDAAAKADAILKK"
     gene            487304..488077
                     /locus_tag="BAB_RS28710"
                     /old_locus_tag="BAB2_0492"
                     /db_xref="GeneID:3827856"
     CDS             487304..488077
                     /locus_tag="BAB_RS28710"
                     /old_locus_tag="BAB2_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catenin"
                     /protein_id="WP_002965897.1"
                     /db_xref="GI:489055750"
                     /db_xref="GeneID:3827856"
                     /translation="MDHSGEFAGRSVLVTGAGGGLGRALAALFAARGARVIGCDVSMD
                     LMAASDFASRHVFDLLDRAELAAAANKLILADGVPDIVINNAGWTRAETFEGLEQDRI
                     EVEIDLNLTGVASFSNIMAQAMATRGHGAFVFVSSVNSLQHFGNPAYAAAKAGINAFA
                     RGIAVEFGQRGVRANVVCPGSIRTPAWDHRIAQDPSVLDRLQRLYPLGRIVNVGEVAE
                     AVAFLASERASGITGAVLPVDAGLTAGCRPFIEDILGGN"
     gene            488082..489134
                     /locus_tag="BAB_RS28715"
                     /old_locus_tag="BAB2_0493"
                     /db_xref="GeneID:3827857"
     CDS             488082..489134
                     /locus_tag="BAB_RS28715"
                     /old_locus_tag="BAB2_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006264759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_002965898.1"
                     /db_xref="GI:489055751"
                     /db_xref="GeneID:3827857"
                     /translation="MKEVSLRGISKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKST
                     LLRMVAGLEPISGGDLVIGGERANELPPQKRNIAMVFQSYALFPHMTARENIGFGPRI
                     RGEKAAETAAKVDHAASILNLHSYLDRYPRQLSGGQRQRVAMGRAIVREPSVFLFDEP
                     LSNLDAQLRVQMRTEIKALHQRLKSTVIYVTHDQIEAMTMADRIVVMNQGKIQQIGAP
                     LDLYDRPANKFVAGFIGSPSMSFIPGTVADGFFCTGEGEKIAVSAAAKGARAAEAGIR
                     PENFVIAREGAGLTLVVEVIEPTGPETHIYGRIAGEPVRAVFRERIQLAPGEQVPVTA
                     GSEHIHLFDKESGLPL"
     gene            489142..490023
                     /locus_tag="BAB_RS28720"
                     /old_locus_tag="BAB2_0494"
                     /db_xref="GeneID:3827858"
     CDS             489142..490023
                     /locus_tag="BAB_RS28720"
                     /old_locus_tag="BAB2_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_002965899.1"
                     /db_xref="GI:489055752"
                     /db_xref="GeneID:3827858"
                     /translation="MSKVADIITRLHVVAQEGSKSDRRLAGLVLADPHYASKAAISEI
                     AARAGVSEPTVTRFCRALGCDGVRDFKFFLAQALAIGGQYLTAEIPARDVRESRIATA
                     VTDAAIAAIQRAGDGVDMGVLMKVAERLAAGGPVLCLGSGDMSSMLATEMENRLFRLG
                     IPVNAQVDGQLQRMYAAVTTHETTVLAFSVSGFARSVVEAVLVARQYGAETVAITAAG
                     SDLARAADMLIPFQPNEDGNIYKPTSARYGLLAILDMIATAAAEARGPKVLESLRRIK
                     HILNTLTIDDPRLPLGD"
     gene            490028..490192
                     /locus_tag="BAB_RS28725"
                     /db_xref="GeneID:23672542"
     CDS             490028..490192
                     /locus_tag="BAB_RS28725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005976850.1"
                     /db_xref="GI:492821809"
                     /db_xref="GeneID:23672542"
                     /translation="MPIKPKNICEVDTPAILVDVDRVVANIEKAQTHADAAGVKLRPH
                     IKTHKLPFFA"
     gene            490193..491095
                     /locus_tag="BAB_RS28730"
                     /db_xref="GeneID:23672543"
     CDS             490193..491095
                     /locus_tag="BAB_RS28730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_002965900.1"
                     /db_xref="GI:489055753"
                     /db_xref="GeneID:23672543"
                     /translation="MQVKAGAVGITCQKLGEAEVMADAGLTDIFLPYNILGQEKLDRL
                     HALHRRITISVTVDNKTSLAGLAQHFMNEKRPLKVLVECDTGMGRCGVQTPGQARELA
                     HIIEKSAGLCFVGLMTYPATGRGDEAERWLREARDLLAADGIACETISSGGTPDMWRI
                     PAETVVTEYRPGTYIYFDRYQVAEGAATINDCALTVLATVVSHPTPERAISDAGSKAL
                     SSDTLGLADFGELMDRPLARVTGLSEEHGKVTGDVANLNIGDRMRVIPDHVCVVSNLF
                     DEVHLVSGEEVIDILPVAARGKLR"
     gene            491109..491411
                     /locus_tag="BAB_RS28735"
                     /db_xref="GeneID:23672544"
     CDS             491109..491411
                     /locus_tag="BAB_RS28735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965901.1"
                     /db_xref="GI:489055754"
                     /db_xref="GeneID:23672544"
                     /translation="MKGAVNPFAGDKDREQIWEMFVRRDIEAFIAQDWSMVADDFDEA
                     RFLGIHAHNNPDPDKWDAGFPPRLPAIATNGCARLRKVRLSNMPSLWLKAFSGQRI"
     gene            492179..493312
                     /locus_tag="BAB_RS28740"
                     /old_locus_tag="BAB2_0500"
                     /db_xref="GeneID:3827597"
     CDS             492179..493312
                     /locus_tag="BAB_RS28740"
                     /old_locus_tag="BAB2_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_002967262.1"
                     /db_xref="GI:489057140"
                     /db_xref="GeneID:3827597"
                     /translation="MACFKVFGDNPMRAMRELGAGKSKAQIHSDLGATIGVDNATFDI
                     REGEVFVIMGLSGSGKSTLLRLLNRLIEPTAGSIEVEGRDIVKMSKRELIDLRRRDMS
                     MVFQSFALLPNRSVLNNAAFGLEVAGMGEVQRHQKALKALAAVGLEPYAHSMPDQLSG
                     GMKQRVGLARALASEPTVLLMDEAFSALDPLIRTEMQDELKRLQAQHSRTIVFVSHDL
                     DEAMRIGDRICIMQHGKVVQVGTPNEIISAPANDYVRSFFRNVDVSRVFKAADVARDD
                     ELIVFEAEQLATALERFDASGKAYGVLVDADRTYRGLVSRDALAAGQRLNDFAAIEAD
                     APLSGLLVHVAKSPWPVPVTDRQNRYVGAISRSVLLETLGRAG"
     gene            493375..494280
                     /locus_tag="BAB_RS28745"
                     /old_locus_tag="BAB2_0501"
                     /db_xref="GeneID:3827598"
     CDS             493375..494280
                     /locus_tag="BAB_RS28745"
                     /old_locus_tag="BAB2_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006145244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="WP_002965904.1"
                     /db_xref="GI:489055757"
                     /db_xref="GeneID:3827598"
                     /translation="MDLNFSVGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNAL
                     IAVPPFAGVAILSLLALWRVGWKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIA
                     VVIGIPLGIAMARSDAVASIVRPILDLMQTMPAFVYLISAAMFFGLGAVPSTIATVIF
                     AMPPVVRLTNLGIRQVHAEFVEAGLAFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLS
                     LSMVVIASMIGAGGLGNTVLTGIQRLNVGLGFEGGLAVVILAVILDRITQSFGKGGTG
                     LLKRLAFLKRAAGEQPASSFRKQEA"
     gene            494334..495200
                     /locus_tag="BAB_RS28750"
                     /old_locus_tag="BAB2_0502"
                     /db_xref="GeneID:3827599"
     CDS             494334..495200
                     /locus_tag="BAB_RS28750"
                     /old_locus_tag="BAB2_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006097677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_002969318.1"
                     /db_xref="GI:489059247"
                     /db_xref="GeneID:3827599"
                     /translation="MLGKLTRFGLAAVVAGTMTMGAAFAQDGKTVKIGWAPWSDAEFV
                     TKLARKLIEDNLGQKVELVQTDVAPLYQGVSRGDIDAMMMAWLPETHADYYKRVEGKV
                     ENLGPLYEGAKLGWIVPDYIPESEVSSIEDLKKPEVREKLKGEIQGIDPGAGLTRLSQ
                     EAIKKYGLDYKLNISSEAAMLTTVDRANRSEGWFVATSWSPHWMFGKYKLRYIADPKG
                     ALGGAEHIDAVARKGFKEDDPKVAALLAKMSIPINELEAAMFDAQETSYEKAVDKYIA
                     DHPDRIKEWLSQ"
     gene            complement(495246..496145)
                     /locus_tag="BAB_RS28755"
                     /old_locus_tag="BAB2_0503"
                     /db_xref="GeneID:3827600"
     CDS             complement(495246..496145)
                     /locus_tag="BAB_RS28755"
                     /old_locus_tag="BAB2_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965906.1"
                     /db_xref="GI:489055759"
                     /db_xref="GeneID:3827600"
                     /translation="MSHTTIPTPVLSSQQRWAMIALITSGIAIGSSPIFVRLSEVGPL
                     ATGFWRLALAVLPLLLMDGRERHERKDAAPLTLADCLRLALPGFFIAADLGAWHLSLH
                     STSVANATLLANMAPIFVTIGAWLLFRSRVSSSFIVGLVVAVAGVIVLKGGPGELLHS
                     RSSGDAMALLAAVFYAGYILSVGRLRSRFSTMRIMLWSSAIAAIFSLPVAYFMEGHIL
                     PATLYGWLVLAGLAWLTHAAGQSMIAYALAFLPASFSSLTLLLQPVVAAFLAWTILSE
                     PIGLMQAIGGVIVISGILIARRG"
     gene            complement(496554..496997)
                     /locus_tag="BAB_RS28760"
                     /old_locus_tag="BAB2_0505"
                     /db_xref="GeneID:3827602"
     CDS             complement(496554..496997)
                     /locus_tag="BAB_RS28760"
                     /old_locus_tag="BAB2_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lectin-like protein BA14k"
                     /protein_id="WP_002965908.1"
                     /db_xref="GI:489055761"
                     /db_xref="GeneID:3827602"
                     /translation="MNSFRKTCAGALALIFGATSIVPTVAAPMNMDRPAINQNVIQAR
                     AHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLAAFGAGAIIGGAISQPR
                     PVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYSR"
     gene            complement(497179..498348)
                     /locus_tag="BAB_RS28765"
                     /old_locus_tag="BAB2_0506"
                     /db_xref="GeneID:3827603"
     CDS             complement(497179..498348)
                     /locus_tag="BAB_RS28765"
                     /old_locus_tag="BAB2_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_002965909.1"
                     /db_xref="GI:489055762"
                     /db_xref="GeneID:3827603"
                     /translation="MTTLTAKWNFPTTVLFGPGHIKELPAVLKAAGIEHPLFVTDPGL
                     AKLPVVASTLAVLDAAGVQYGVFSDVKPNPVESNLHAGVKVFREGRHDGVIAFGGGSA
                     LDLGKLIAFQAGQTRPVWDFEDIGDWWTRADSNAIAPVIAVPTTAGTGSEVGRAGVLT
                     NESTHTKKVIFHPKMLPVTVIADPELSTGMPPFITAGTGMDALAHCLEAYCAPGFHPM
                     ADGIAVEGIRLVFENLPKAYANGGDIEARANMMAAAAMGATAFQKGLGAIHSLSHPIG
                     ALYDTHHGMTNAVFMPYVLHHNRDAIEKRIARLADYLGIEGGFDGFADAIMKLRTELG
                     VPRTLPDLIKNLQMDNARKELIAEMAVADPTAGGNPVELTKNDALKLLNAALEGR"
     gene            complement(498449..499816)
                     /locus_tag="BAB_RS28770"
                     /old_locus_tag="BAB2_0507"
                     /db_xref="GeneID:3827604"
     CDS             complement(498449..499816)
                     /locus_tag="BAB_RS28770"
                     /old_locus_tag="BAB2_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_002965910.1"
                     /db_xref="GI:489055763"
                     /db_xref="GeneID:3827604"
                     /translation="MAGQLTFDELKKAVAEGRIDTVLACIVDMQGRLIGKRFYGQFFV
                     ESGYDETHGCNYLLADDIDMEPVPGYEAAGWDKGYGDFVMKPDLSTLRLAPWLEKTAI
                     VLCDVLDHHHDDLSHSPRAVLKKQVQRLHERGYRAYFASELEFYIFDETYKSARAKRW
                     HEMETASPYVQGYVIHLTTREEPVLRAMRNHLADAGIPVENSKGEWGPGQQELNVRYC
                     KALEMADRHVIMKNAMKEIAEAHGKCITFMAKYDYARAGSSSHVHNSIWSADGKEPLF
                     FDPKAPYTMTPLMRSWVAGQIKYATDYTYFLAPYINSYKRFQAGTFAPTKIMWSQDNR
                     TAGFRLCGEGTKGIRIECRIGGADINPYLAFAALIAAGLKGVDEKLELDEPFVGDAYS
                     AVRLKEIPYTLREAAAALKGSAFLKEAFGEDVVNHYTHTAHWEQIEYDRRVTDWELYR
                     GFERY"
     gene            complement(499880..500569)
                     /locus_tag="BAB_RS28775"
                     /old_locus_tag="BAB2_0508"
                     /db_xref="GeneID:3827605"
     CDS             complement(499880..500569)
                     /locus_tag="BAB_RS28775"
                     /old_locus_tag="BAB2_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006149571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-formylglutamate amidohydrolase"
                     /protein_id="WP_002972094.1"
                     /db_xref="GI:489062066"
                     /db_xref="GeneID:3827605"
                     /translation="MPESFAGLGLDAETRKTHIAWDPGAVEVARELSKALDAPLVEAG
                     LPRLLIDCNRPLDAPDLIPEISETTLVPGNHGLNTAERMARIDLSHRPFHRRIEEVIA
                     MRAARGQPSWIVTVHSFTPVYRGVSRPWQIGIIHDEDDRIARPLIAALRQDMGLHIGV
                     NEPYSPADRVYYTLERHARPRNAPCVMIEIRNDEITDAGTQTAWGRKLTAILKKYQET
                     MRSAGGAYPYA"
     gene            500804..501646
                     /locus_tag="BAB_RS28780"
                     /old_locus_tag="BAB2_0510"
                     /db_xref="GeneID:3827607"
     CDS             500804..501646
                     /locus_tag="BAB_RS28780"
                     /old_locus_tag="BAB2_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_002965912.1"
                     /db_xref="GI:489055765"
                     /db_xref="GeneID:3827607"
                     /translation="METAAPMSASVAELINERIDAMPAGERSAAQMLIADYPMLGLKT
                     VAEFSTQAGVSSPTILRFVNRLGFQSYPDFQARLQDELAAQLQSPHHRNEQPDKRPDA
                     ADPGVEHTLENIRETFRHLGEKQLHQVVASLSLAKGNVYLIGGRFTDPIAQYMTAHMS
                     IVRARVFHLGGQESMWRDRLLDMGKRDILVVFDIRRYQESLLALAEKARSRGVEVVLV
                     TDQWLSPIARVARHVLAGRIAVPSAWDSSAALFVLAETIIREMTRMLEKDSAARIAEL
                     EALR"
     gene            501758..502987
                     /locus_tag="BAB_RS28785"
                     /old_locus_tag="BAB2_0511"
                     /db_xref="GeneID:3827608"
     CDS             501758..502987
                     /locus_tag="BAB_RS28785"
                     /old_locus_tag="BAB2_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_002965913.1"
                     /db_xref="GI:489055766"
                     /db_xref="GeneID:3827608"
                     /translation="MDDRCIIIGAGHAGSQAAVSLRQEGYAGEIILINDETDIPYHKP
                     PLSKSYLKAPEKGSLVLRPESAYRDNNIEMLFGAHVDAVSIAERTVTLGDGRVLPWSE
                     LVFATGARARIPDVPGVALEGVVTLRRMEDARRIAAMMPDVRNVVIIGGGFIGLEMAH
                     SAIALGKKTVLIEAAPRILGRSVAAPVSAHVEARSRAADITLLTGLGVASIEGENGRA
                     IGVTAGDGTFFPADLVVIGTGAVPNVELAAKAGLSIDNGIRVDEHMRTSAPHVYAIGD
                     CASYAHFHAGRHVRLESVQNATDQAKHVARTIVGRETPYREVAWFWSDQGDMKLQTAG
                     LSFDADRHVLSGEPEENAFSVFHFKGDRLVAVDSINRPAGHMIARRLLAAGISPSEAD
                     IMAGMPRLKELLAVVAR"
     gene            complement(503160..503306)
                     /locus_tag="BAB_RS28790"
                     /old_locus_tag="BAB2_0512"
                     /db_xref="GeneID:3827609"
     CDS             complement(503160..503306)
                     /locus_tag="BAB_RS28790"
                     /old_locus_tag="BAB2_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965914.1"
                     /db_xref="GI:489055767"
                     /db_xref="GeneID:3827609"
                     /translation="MNLIRSYNNWRRYRNTVNELSRLSPRELNDLGILPSEIPFVARK
                     AAAR"
     misc_binding    503728..503808
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
     misc_binding    503811..503913
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
     gene            503960..505063
                     /locus_tag="BAB_RS28795"
                     /old_locus_tag="BAB2_0513"
                     /db_xref="GeneID:3828234"
     CDS             503960..505063
                     /locus_tag="BAB_RS28795"
                     /old_locus_tag="BAB2_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein T"
                     /protein_id="WP_002967267.1"
                     /db_xref="GI:489057145"
                     /db_xref="GeneID:3828234"
                     /translation="MGDTAHLNTLPLQDLHEKAGARFGGFAGWNMPITYPLGVMKEHL
                     HTRDHAGLFDISHMKLVEVSGADAAALLAETCPLDPTILKTGQSKYTFFLNDNGGVLD
                     DLIVTRLGEDRFMVVANAGNADADIEHLNEAASGKAVKVNPLDRVFLALQGPEAKAVI
                     TDAGLPGADLAFMSGFEPKQGWFMTRSGYTGEDGFEIGLPADEARALAEKLLADERVE
                     WIGLAARDSLRLEAGLCLHGQDITPETDPVSAGLTWAITKAVREKAAFNGAKAVLDAI
                     AKGASAKRVGLKPEGRQPVRAGADLFDESGRQIGTVTSGGFGPSAGFPVAMGYVEASL
                     ATPGTRVFADVRGNKVPVDVHALPFTPHRYRKG"
     gene            505069..505437
                     /locus_tag="BAB_RS28800"
                     /old_locus_tag="BAB2_0514"
                     /db_xref="GeneID:3828232"
     CDS             505069..505437
                     /locus_tag="BAB_RS28800"
                     /old_locus_tag="BAB2_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006149574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein H"
                     /protein_id="WP_002968488.1"
                     /db_xref="GI:489058390"
                     /db_xref="GeneID:3828232"
                     /translation="MANILFTEDHEWINVENGVATVGITIHAQEQLGDLVFVELPEVG
                     RTVAKGDGVVVVESVKAASDVYAPVDGEVVEVNDAVASDPSLINQAAEGEGWLFKLKL
                     ADEGQLTGLLDKAGYEKLIG"
     gene            505442..508240
                     /locus_tag="BAB_RS28805"
                     /old_locus_tag="BAB2_0515"
                     /db_xref="GeneID:3828233"
     CDS             505442..508240
                     /locus_tag="BAB_RS28805"
                     /old_locus_tag="BAB2_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P62920.2"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase (decarboxylating)"
                     /protein_id="WP_002967268.1"
                     /db_xref="GI:489057146"
                     /db_xref="GeneID:3828233"
                     /translation="MTEFLPFVARHIGPRHEDERAMLAALGLPSMETLITQAVPAPIR
                     LNRALNLPAALSEADALAELGTIMGRNVVKKSFIGAGYHGVHTPPVIQRNLFENPAWY
                     TAYTPYQSEISQGRLELLFHFQTLVAELTGLPVACASLLDEATAVAEAIGVACRHHRD
                     KRSRILLAGELHPQTVDVVNTRAEPLGWEIATGSDVDDNTAAIVVPWPDTRGVYGDFA
                     KVIADAKAKGALVIAVADPLALTIMEAPARWGADMAVGSMQRYGVPMGFGGPHAAYLA
                     VSEALTRIIPGRIVGQSVDAHGRAAYRLALQTREQHIRRDKATSNICTAQALLANMAA
                     AFAIWHGPAGLQAIATRVAALAARFAAALKAAGVEIAGESLFDTVTAKVPGKAAAIAA
                     EADKGGRLIRIIDADTVGVTFDETSTEEDLTALASLFGAKPVGGDTVLVPGKERGEGF
                     LTQEVFHSHRSETEMMRFLRRLADKDLALDRAMIPLGSCTMKLNAAAEMMPVSWNTVA
                     NLHPFAPAEQVQGYAKMTSDLEAWLCEITGFAGVSLQPNAGSQGEYAGLMAIRHYHQA
                     RGQGHRNICLIPSSAHGTNPASASMAGMSVVVVNCRPDGDIDIDDLKAKAEKHRDNLA
                     AFMITYPSTYGVFEEGIKAFCEIVHDNGGQVYFDGANLNALVGLARPADIGADVCHMN
                     LHKTFCIPHGGGGPGVGPIGVAKHLVPYLPGHVEAGSEHAVAAAQFGSASILVITWMY
                     IRMMGGAGLKKATEAAILNANYIAHRLKGVYPILYTGAHDRVAHECIVDTRVLKDSAG
                     ITVEDVAKRLIDYGFHAPTMSWPVAGTLMIEPTESEPKLEIDRLCDAMIAIAGEAKKV
                     ADGVWPADDNPLANAPHTASDTLATEWKHPYTREEAVFPGGAFDPTAKYWPPVSRVDN
                     VGGDRNLICSCPPVATYG"
     gene            complement(509271..509765)
                     /locus_tag="BAB_RS28810"
                     /old_locus_tag="BAB2_0517"
                     /db_xref="GeneID:3827611"
     CDS             complement(509271..509765)
                     /locus_tag="BAB_RS28810"
                     /old_locus_tag="BAB2_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_002969319.1"
                     /db_xref="GI:489059248"
                     /db_xref="GeneID:3827611"
                     /translation="MRKIDSIDDMDQFDRRILEVLSEDGRIPVTELSKRVGLSKTPCQ
                     ARLKRLVDEGYILGFRAAIDPEKLGLDHIAFTTVKLSDTREAALEAFNVAVRKIREVE
                     ECHMIASSFDYLLKVRTPNIRRYREVLGEKISSLPNVASTSTFVVMESVKDNRPVRVY
                     PGAL"
     gene            509928..513611
                     /gene="putA"
                     /locus_tag="BAB_RS28815"
                     /old_locus_tag="BAB2_0518"
                     /db_xref="GeneID:3827612"
     CDS             509928..513611
                     /gene="putA"
                     /locus_tag="BAB_RS28815"
                     /old_locus_tag="BAB2_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510302.1"
                     /note="proline utilization protein A; multifunctional
                     protein that functions in proline catabolism in the first
                     two enzymatic steps resulting in the conversion of proline
                     to glutamate; in Escherichai coli this protein also
                     self-regulates transcription via a DNA-binding domain at
                     the N-terminus; forms dimers and is a peripherally
                     membrane-associated protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional proline
                     dehydrogenase/pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_002967269.1"
                     /db_xref="GI:489057148"
                     /db_xref="GeneID:3827612"
                     /translation="MTDNIPVSKVAVFQNFAPPIREQSALRQAITAAYRRPEAECVSA
                     LAEQATLPEETRQQIRSTARKLIEALRAKHKGTGVEGLVHEYSLSSQEGVALMCLAEA
                     LLRIPDMATRDALIRDKISNGDWKSHIGGGRSLFVNAATWGLVVTGKLTNTVNDRGLS
                     AALTRLIARCGEPVIRRGVDMAMRMMGEQFVTGETIDEALKRAKELEERGFRYSYDML
                     GEAATTAADAERYYKDYETAIHAIGRASAGRGIYDGPGISIKLSALHPRYTRAQSERV
                     MGELLPKVKALAAIAKSYNIGLNIDAEEADRLELSLDLLQSLCEDPDLAGWDGIGFVV
                     QAYGKRCPLVLDFIIDLARRTKRRVMVRLVKGAYWDAEIKRAQVDGLEDFPVYTRKVH
                     TDVSYIACARKLLAATDVIFPQFATHNAQTLATIYHLAGPDFKTGKFEFQCLHGMGEP
                     LYDEVVGPEKLGRPARIYAPVGPHETLLAYLVRRLLENGANSSFVNRIGDKNVSVDEL
                     IADPVEVVRSMAVVGARHDQIALPENLYGARRNSAGFDLSNEVTLAELSKTLKETAGR
                     AWTAEPQVAGAKVKGVSRPVLNPGDRNDVVGTVTEIAEADVAKAMKAAQTATTSWSAV
                     APAERAACLERAADIMQRDMPALLGLVMREAGKSMPNAIAEVREAIDFLRYYAEQTRR
                     TLGVGHKALGPVVCISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRIL
                     HEGGIPADALQLLPGDGRIGAALVAAPETCGVMFTGSTEVARLIQAQLASRLLPNGKP
                     VPLIAETGGQNAMIVDSSALAEQVVFDVIASAFDSAGQRCSALRVLCLQEDVADRILT
                     MLKGALRELSIGRTDQLKVDIGPVITDEAKNTIEKHIQAMRDLGRKVEQLPLGPETQN
                     GTFVAPTIIEIESLRDLKREVFGPVLHVVRYKRDDMESLIDDINSTGYGLTFGLHTRL
                     DETIANVADRIRVGNIYINRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVETAP
                     IPPRHASVHTDAALKDFARWLGNRGMNDLAQAARDTGSASALGLELELPGPVGERNLY
                     ALHPRGRVLLVPQTEIGLYRQLTAVLATGNTAVIDEACGLRAVLKDLPETVAARAIWT
                     GDWQADAPFAGALIEGDSARIKEVNSRIAALPGPLVLTQAASPEDLAANQDAYCLNWL
                     LEEVSTSINTTAAGGNASLMAIG"
     gene            513841..514866
                     /locus_tag="BAB_RS28820"
                     /old_locus_tag="BAB2_0519"
                     /db_xref="GeneID:3827495"
     CDS             513841..514866
                     /locus_tag="BAB_RS28820"
                     /old_locus_tag="BAB2_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_002965921.1"
                     /db_xref="GI:489055774"
                     /db_xref="GeneID:3827495"
                     /translation="MRSAFMVAALAAGVSSFAFSAQAAGNLNLICSADVVICEQMKNM
                     FEKDTGIKVNMVRLSSGETYAKVRAEARNPKTDIWWAGTGDPHLQAASEGLTLEYKSP
                     MLDQLNDWAKKQAESSGFRTVGVYAGALGWGYNTDIFAKKNLKEPKCWADLLDPSYKG
                     EIQMANPNSSGTAYTALATLVQIMGEDKAFDYLKKLNANVSQYTKSGSAPVKSAARGE
                     TGIGIVFMHDAVAMTADGFPIKSVAPCEGTGYEIGSMSIIKGAKNLENAKKWYDWALT
                     AEVQSHMKDAKSFQLPSNKSAEVPKESPRFEDIKLIDYDFKTYGEPAKRKELLERWDK
                     EVGAVAN"
     gene            515001..517226
                     /locus_tag="BAB_RS28825"
                     /old_locus_tag="BAB2_0520"
                     /db_xref="GeneID:3827496"
     CDS             515001..517226
                     /locus_tag="BAB_RS28825"
                     /old_locus_tag="BAB2_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_002967270.1"
                     /db_xref="GI:489057149"
                     /db_xref="GeneID:3827496"
                     /translation="MTQHNRRLDAVLAIALIAFALLPWYRIEDGFLHFSWIEVLFSES
                     AEAPGILQIFVFGRSWIGAIALLMLICAVARFFLPVGKRSGVLIAASLVGFIFLALQG
                     LAIGFSGWNWTISETLFGPLSDGQPSFGAGAILTGLCFLLIFSFGLAERGVMKGDAFV
                     VSSITLLVALVGVFVFYPVLSMFVGSVQDFDGSFNPDGFIGNIQDSSIWSLACVVGEG
                     RCGVAWRTLWLALMTATGSTILGLAFALVATRTNFPFKKGLRLLTILPIITPPFVVGL
                     ALTLLFGRAGVVTEQISSLFGVEPGRWLYGLTGIWIAQVLSFTPISFLVLIGVVEGVS
                     PSMEEASQTLRADRWRTFKRVSLPLMAPGLANAFLIAFIESMADFGNPMVLGGSHGVL
                     STEIFFAVVGAQNDPSRAAVLAIVLLCFTLSAFLVQRLWLSGKNFATVTGKGDSGIHA
                     GLPRGLKIGVYALVIPWMFFTVVVYVMILVGGFVRQWGLDNSLTLEHYARAFSVSWTD
                     GGLAWTGVAWNSFWTTMEISLMSAPLTAAVGLLTAYLIVRQRFVGRNVFEFALMLSFA
                     IPGTVIGVSYIMAFNLPPLEMTGTALILIACFVFRNMPVGVRGGIAAMSQLDRSLDEA
                     SLTLRAGSFRTIRKVILTLLRPAITAALVYSFVRAITSISAVIFLVSAQYNMATAYIV
                     GLVENGEFGVAIAYSSMLIVVMVVVITSFQLLVGERRLRRENRVAAAAPVKSVRQEKT
                     A"
     gene            517223..518284
                     /locus_tag="BAB_RS28830"
                     /old_locus_tag="BAB2_0521"
                     /db_xref="GeneID:3827497"
     CDS             517223..518284
                     /locus_tag="BAB_RS28830"
                     /old_locus_tag="BAB2_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(3+) ions import ATP-binding protein FbpC"
                     /protein_id="WP_002965923.1"
                     /db_xref="GI:489055776"
                     /db_xref="GeneID:3827497"
                     /translation="MTAIRPGSVTFENVTKKFGNFTALPNLSLTVEPGTLVTLLGPSG
                     CGKTTTLRLLAGLEHPTSGRILIGGKDVTNLPANERDVSMVFQSYALFPHMTSLENVA
                     YGLESSGFKKNEARERAEEGLKLVGLGGMGHRLPAELSGGQQQRVAVARALVLEPQVL
                     LLDEPLSTLDARLRRRVRTEIRELQQRLGFTAVYVTHDQDEALAVSDTIIVMKEGGIA
                     QKGSPRDLYEAPASAFIADFMGEANVVPCEVISAENGEAVIRVAGLTHRVPARNAQPG
                     PAQLAIRPNAVTLQPQAGGGFSGTVAHSAYLGDHIEYEIETEHGKLFIVDPAVEQSLP
                     LQTDVSIQFKTRGLAIINQ"
     gene            518305..519105
                     /locus_tag="BAB_RS28835"
                     /old_locus_tag="BAB2_0522"
                     /db_xref="GeneID:3827498"
     CDS             518305..519105
                     /locus_tag="BAB_RS28835"
                     /old_locus_tag="BAB2_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_002965924.1"
                     /db_xref="GI:489055777"
                     /db_xref="GeneID:3827498"
                     /translation="MTAHSRQDLETRLALAEKIVQEAGAKALDYFNRRETLVIETKRD
                     PQDVVSIADRDVEQLIRARVSESFPQDGFLGEEYGLNAGSSGYTWVVDPIDGTSPFVN
                     GMPNWCVSIAVLKDGEPVVGVILAPCFNELYVSAKGQGATLNGRKLALDPSRNIRNAV
                     TDIGANNYVTPQLVAKVVENLLEAGGTFIRNGSGALMIAYVAAGRLVGYYEPYMHAWD
                     CMAGFCLVREAGGYIHPFPTDGENLTKGNRVFAAAPGAVDDLKKVAGL"
     gene            complement(519137..519946)
                     /locus_tag="BAB_RS28840"
                     /old_locus_tag="BAB2_0523"
                     /db_xref="GeneID:3827499"
     CDS             complement(519137..519946)
                     /locus_tag="BAB_RS28840"
                     /old_locus_tag="BAB2_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-deoxyglucuronate isomerase"
                     /protein_id="WP_002965925.1"
                     /db_xref="GI:489055778"
                     /db_xref="GeneID:3827499"
                     /translation="MPDLLRKPKGTNGKVHDITPESAGWGYVGFDLYRLKAGESAAEK
                     TGAREVILVLVEGKAEISASGEAFGEMGERMSVFEKLPPHCLYVPAESEWSATATTDC
                     VLAVCTAPGKPGRKAQKLGPEGLTLEQRGKGANTRFIHNIAMEGRDVADSLLVTEVFT
                     PQGNWSSYPPHRHDEDSFPDMTYLEETYYHRLNPAQGFGFQRVFTEDGSLDETMAVAD
                     GDVVLVPKGHHPCGAPYGYEMYYLNVMAGPLRKWRFKNHPDHDWIFKRDNP"
     gene            complement(519950..520852)
                     /locus_tag="BAB_RS28845"
                     /old_locus_tag="BAB2_0524"
                     /db_xref="GeneID:3827500"
     CDS             complement(519950..520852)
                     /locus_tag="BAB_RS28845"
                     /old_locus_tag="BAB2_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein TIM
                     barrel"
                     /protein_id="WP_002967271.1"
                     /db_xref="GI:489057150"
                     /db_xref="GeneID:3827500"
                     /translation="MILYGTNPIAWSNDDDRSLGAHITLDQCLDEAAKIGFDGIEKGH
                     KFPQEAAALKAVLEPRGLRYVSGWHSLNLLVNSVEEEKAAMQPALDLLKAMGSKVIIV
                     CETSNAIHGDNDKPLQERPVLEDARWEAFGLGVEALAAHAAAQGITLVYHHHMGTIVE
                     TEDEIDRLMRFTGPHTRLLLDTGHCLFGRGNPERVAQKHIARVGHIHAKNIRRDIVQD
                     VRDQNLSFLEGVRRGVFTVPGDTEGSVDFVPVLKIAAEHGYQGWLVIEAEQDPDVRNP
                     FEYQSLGLKSLKAFAREAGLDKGV"
     gene            complement(520856..522679)
                     /locus_tag="BAB_RS28850"
                     /old_locus_tag="BAB2_0525"
                     /db_xref="GeneID:3827501"
     CDS             complement(520856..522679)
                     /locus_tag="BAB_RS28850"
                     /old_locus_tag="BAB2_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004684910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate decarboxylase"
                     /protein_id="WP_002965927.1"
                     /db_xref="GI:489055780"
                     /db_xref="GeneID:3827501"
                     /translation="MKTVRLTAAQALVRYLANQMTPEGDTFIAGVWAIFGHGNVAGLG
                     EALYGAREHMPTWRGHNEQTMAHAAIAYTKQLGRRRACAVTSSIGPGATNMVTAAALA
                     HVNRLPVLFVPGDVFANRGPDPVLQQIEDFNDGTMTVNDCFRPVSRYFDRITRPEQLL
                     TALPRAFRTMTDPADCGPVTLAFCQDVQAQAYDWPEEFFTPKVWHWRRPPPDERELET
                     AAAAIKTALKPVIVAGGGVHYSGAHEVLRAFVETHGIPVIETQAGKSALPWDHPLNFG
                     PVGVTGADSANAVAAEADLVIGVGTRFQDFTTGSWALFRHPGRRLLSLNVQPYDGAKH
                     NSLPLVADAKIGLEALSGAIGAYRRQAVDASLKNRWFAAANRFTAAPSDGNALPTDMQ
                     VIGAVQRQARENSVVMCAAGTMPGELHQLWKAGRPMSYHMEYGFSCMGYEIAGGLGIK
                     MAEPDRDVIVMVGDGSYMMANSELATSIMMGQKITVVVTDNRGFGCISRLQMATGGAE
                     FNNLLDHAAHVNPSQIDFAAHAAAMGADAKKVGSIRELEGALAEARDSLRTTVIVIDT
                     DPYPTPETGGWWWDVAVPEVSERDEVRAARKNYEAQIKERN"
     gene            complement(522676..524616)
                     /locus_tag="BAB_RS28855"
                     /old_locus_tag="BAB2_0526"
                     /db_xref="GeneID:3827502"
     CDS             complement(522676..524616)
                     /locus_tag="BAB_RS28855"
                     /old_locus_tag="BAB2_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-2-deoxygluconokinase"
                     /protein_id="WP_002970621.1"
                     /db_xref="GI:489060567"
                     /db_xref="GeneID:3827502"
                     /translation="MSKRLDLITIGRSSVDLYGAQIGGLLEDMASFNKYVGGSPTNIA
                     TGTARLGLRSALITRVGDEHMGRFLLRELEREGVDTRGIVTDPERLTALVILGIRDQQ
                     HFPLIFYRENCADMALCEDDIDPDFIAEARCVLATGTHLSHPRTEAAVLKALRLAREN
                     GSRTALDIDYRPNLWGLSGHGDGENRFIESAAVTAKLQSTLHLFDLIVGTEEEFHIAG
                     GSTDTLEALKAVRRVTKAALVCKRGPMGAVVFEGDIPDDLDKGQSGQGFPIEVFNVLG
                     AGDGFMSGLLRGWLKGEDWPTSLKFANACGAFAVSRHGCTPAYPSWEELQFFLQRGIR
                     NKALRKDAELEQVHWSTNRNGTWPHMRVFAFDHRIQLEEMAAEAGASTDKIGEFKQLC
                     LDAALKVAGGAQGYGILCDGRLGRDALYQAAGTGLWIGRPAEWPGSRPLKLEPELGPD
                     CGGLMEWPVEHVVKLLCFYHPDDPAEMRAGQEETVQRLFTAARRNRLEFLLEIIPSKA
                     GPVDDMTTARVIERFYEIGVYPDWWKLEPLKTKAAWANACDAITRNDPHTRGIVVLGL
                     DAPAEELEQSLGIAAGFDLVKGFAVGRTIFAEAARKWLSGTIDDAQAIAEMAARYQSL
                     CDVWDKARAYRTLSLGGRMEEI"
     gene            complement(524708..525538)
                     /locus_tag="BAB_RS28860"
                     /old_locus_tag="BAB2_0527"
                     /db_xref="GeneID:3827503"
     CDS             complement(524708..525538)
                     /locus_tag="BAB_RS28860"
                     /old_locus_tag="BAB2_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_002967273.1"
                     /db_xref="GI:489057152"
                     /db_xref="GeneID:3827503"
                     /translation="MDSTPSPSPAPASIKEFEARLLEVADRLPKRLKQCADYVAANQD
                     RIAVSTVAEMAEGAGVQSSAFMRFCQILGFSGFSEMQRLFRETYAGGWPDYSTRLLHL
                     RETAAGRAPALLAEFAEAGRTSLEGLLKTIEPEALEKAVELLASANTIHIIGIRRAFP
                     VASYLAYALEKMAVPAMLHSAVGKLENLHAIHKGDVLLAITFSPYSPETIGMTEAVAA
                     RGIDVIGITDTIVSPMSKVARQTLLVSEVDFGAFRSLSATLCLAIAIAVAVGTARQAG
                     "
     gene            525712..526716
                     /locus_tag="BAB_RS28865"
                     /old_locus_tag="BAB2_0528"
                     /db_xref="GeneID:3827504"
     CDS             525712..526716
                     /locus_tag="BAB_RS28865"
                     /old_locus_tag="BAB2_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004682008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol 2-dehydrogenase"
                     /protein_id="WP_002965930.1"
                     /db_xref="GI:489055783"
                     /db_xref="GeneID:3827504"
                     /translation="MVTRLALLGAGRIGKVHAGAIASDRRARLVAVADANEDAAKAIA
                     DASGAQVRSIDEIERASDVDAVLICTPTNTHADLIERFARAGKAVFCEKPIDLDIARV
                     HACLAVIRETGAKVMLGFNRRFDPHFVAVRKAIDDGRIGKVEMVTITSRDPGAPPADY
                     IKVSGGIFRDMTIHDFDMARFLLGEEIESVAASASVLVDPKIGELGDYDSASVILTTA
                     SGRQCVISNSRRASYGYDQRIEVHGSLGAVSAENQRPVSIEIASKDGYNRPPLHDFFM
                     TRYTAAYAAEIGAFIDALDSGKAPMPSAEDGLKALALAEAALRSVKEGRTVKVAEILP
                     "
     gene            526757..527881
                     /locus_tag="BAB_RS28870"
                     /old_locus_tag="BAB2_0529"
                     /db_xref="GeneID:3827505"
     CDS             526757..527881
                     /locus_tag="BAB_RS28870"
                     /old_locus_tag="BAB2_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008934615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965931.1"
                     /db_xref="GI:489055784"
                     /db_xref="GeneID:3827505"
                     /translation="MPLQTSPLAKRGIQLRYADMAYDLNNLPLEAFFVPVSAATAALA
                     RLDERLARSPIRDGMVQRLHMHDAVASMWVEGELVHMEDLVLHDALMDSRTPSHALTI
                     AHGVLRMRRQIASRAASWALSPAGMQQLLGRPLEAFAPRDAERPETDEDDPLLDDIDA
                     LLARTDALLEGIAANRRKPEAVPRDQLLYDDDWDEDARLQEWRDCCAATADLPPLLRA
                     AIMHDAWFSLEVVQRSAWVGRLLTAAFLRQSGLAANHLPAISLGPRNKRPDERRSSNR
                     VVRLKTFLAAIEEAAEAIMKEHDRLMLAREQMQRKLKGRRSNSRLPQLMELILRTPLV
                     SSQLVEKELQVTQQGALKLIGELNLREITGRGRFRAWGIL"
     gene            complement(527911..528816)
                     /locus_tag="BAB_RS28875"
                     /old_locus_tag="BAB2_0530"
                     /db_xref="GeneID:3827506"
     CDS             complement(527911..528816)
                     /locus_tag="BAB_RS28875"
                     /old_locus_tag="BAB2_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002965932.1"
                     /db_xref="GI:489055785"
                     /db_xref="GeneID:3827506"
                     /translation="MLNISVRQLHYFLALVQAGSFSRAAEAIGVTQSTLSAAIQALEA
                     ELGATLIDRTGRRMQMLPAGEDFLARARDIVALIEELPEHARQAEHPLTTRLRMGVIP
                     SIAPFLLPKVLPATAKAFPELQLTVREGLTRSLLESLRSGTLDVALVAHPYDLDEFEI
                     AEIGRDPFLLAVRRDHALANRDSVEASDIDDQPFLLLETGHCLREHVMAAIGSKPAQM
                     SGDVHATSIMTLVQLVQFGMGVTLLPQLAIKAGVTRGTDLSVVPYEGKYNFRSLVLAW
                     RTNAARRNEFQLFANHLRSNCLQDV"
     gene            528964..529518
                     /locus_tag="BAB_RS28880"
                     /old_locus_tag="BAB2_0531"
                     /db_xref="GeneID:3828034"
     CDS             528964..529518
                     /locus_tag="BAB_RS28880"
                     /old_locus_tag="BAB2_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009762448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="WP_002965933.1"
                     /db_xref="GI:489055786"
                     /db_xref="GeneID:3828034"
                     /translation="MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWK
                     VIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLGGSTDNEFVKLAWRRDHKDLNKL
                     PIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
                     LDALQTDELCPCNREVGGETLKAA"
     gene            529598..530125
                     /locus_tag="BAB_RS28885"
                     /old_locus_tag="BAB2_0532"
                     /db_xref="GeneID:3827507"
     CDS             529598..530125
                     /locus_tag="BAB_RS28885"
                     /old_locus_tag="BAB2_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YCF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase AhpD"
                     /protein_id="WP_002965934.1"
                     /db_xref="GI:489055787"
                     /db_xref="GeneID:3827507"
                     /translation="MSIDDLKSKIPDFAKDVRLNLSSMASDETLTPQQKYGLFVACGI
                     ASRNADVRKALVAEAAGKVDASVIQAAKAAASIMGMNNVYYRFVHLASNKDYRTMPAR
                     LRMNVISNPGVDKIDFELWSLAVSAINGCGMCIDAHEDVLRKANVTAEAIQAAVRFAS
                     IIQSAAIALEAADTE"
     gene            complement(530203..531483)
                     /locus_tag="BAB_RS28890"
                     /old_locus_tag="BAB2_0533"
                     /db_xref="GeneID:3827508"
     CDS             complement(530203..531483)
                     /locus_tag="BAB_RS28890"
                     /old_locus_tag="BAB2_0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002965935.1"
                     /db_xref="GI:489055788"
                     /db_xref="GeneID:3827508"
                     /translation="MTVAEAVAPQANSVRRVLTASMIGTTIEFFDFYIYATAAVIVFP
                     YLFFPASDGNSALLQSFATFAIAFFARPVGAAIFGHFGDKIGRKATLVAALMTMGLST
                     VAIGFLPTYASIGVAAPLLLALCRLGQGLGLGGEWGGAVLLATENAPEGKRTWYGMFP
                     QLGAPAGFILATGIFLLLAETMTEEQFFAYGWRVPFIASAILVAVGLFIRLRIAETPE
                     FQKAIDKAERVAVPAAQLFRHHKMNLFLGTIGTMATFVLFYLMTVFSLGWGTRALGYS
                     REEFLVLQMIGVIFFGLTIPLSALLSDRYGMRTIMVIVTVLIGLYGFIMAPLFAAGTA
                     GVLGFLIIGFGLMGMTYGPIGAVLAEPFPTSVRYTGASLAFNLAGILGASLAPYIATW
                     LATDYGFAYVGYYMVAAAIISLIGFVFITLKDKK"
     gene            531737..532132
                     /locus_tag="BAB_RS28895"
                     /db_xref="GeneID:23672545"
     CDS             531737..532132
                     /locus_tag="BAB_RS28895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006120483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968851.1"
                     /db_xref="GI:489058768"
                     /db_xref="GeneID:23672545"
                     /translation="MSFVKRDIGVRKTARGHAVLRLPSRAVVLLFSLLFLVSAQLCYG
                     MAHDMPPREAAWDCHMNKPQAKMPQPVEHGAKAPNMCVMMACGGIVRPAGGFSTCAPA
                     QDFGLPPLVSALSGSNPYGVLRPPIVLHA"
     gene            532192..533796
                     /locus_tag="BAB_RS28900"
                     /old_locus_tag="BAB2_0534"
                     /db_xref="GeneID:3827509"
     CDS             532192..533796
                     /locus_tag="BAB_RS28900"
                     /old_locus_tag="BAB2_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase"
                     /protein_id="WP_002965937.1"
                     /db_xref="GI:489055790"
                     /db_xref="GeneID:3827509"
                     /translation="MTGITRRRLLALGASAACVAALRPLGAFAQDAHQHMRHGAVDAP
                     VLKAPPLPLPPLVEPDASGIVRLKVQKGRHSFAKGSTAASAGINGAYLGPLVRLMSGE
                     SVTLSVENAMDEETTLHWHSLFVPSHLDGGPHNVIAPGAKWEPKVAVNQPASFNWFHP
                     HLHGHTARQAHMGIAGLMIVRDGKDAERGLPETYGVDDLPLVLQDRRVIEGDAVYAPD
                     IMDLIHGFRGDWLIVNGAIAPEARVPAAMVRLRLLNGANARNFHIRFADGRPLLVIAS
                     DGGFISQPVSIEQLTISPGERYEVLVDFSNGEAVDLVTYGDNGSGDGLHLMRFTVDPA
                     LEGRVAKPPVSLDGPAAPDEKLSVQRRSFFFDERMAENMKLMMRQPSSNPHASGDDMD
                     HMEMGSMAGMDHDMHGSRSAADAGPALDALTSGVQMAIADKPFDMERIDVEAKLGSWE
                     IWELTSREMAHPFHIHGASFRILSMNGKKPPAHQTGWKDTALIDGKAEILVHFDREAA
                     RSHPFMFHCHLLEHEDVGMMAQFVTV"
     gene            534069..534590
                     /locus_tag="BAB_RS28905"
                     /old_locus_tag="BAB2_0535"
                     /db_xref="GeneID:3827840"
     CDS             534069..534590
                     /locus_tag="BAB_RS28905"
                     /old_locus_tag="BAB2_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase [Cu-Zn]"
                     /protein_id="WP_002972093.1"
                     /db_xref="GI:489062065"
                     /db_xref="GeneID:3827840"
                     /translation="MKSLFIASTMVLMAFPAFAESTTVKMYEALPTGPGKEVGTVVIS
                     EAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTHHHL
                     GPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPL
                     GGGGARFACGVIE"
     gene            complement(534848..535063)
                     /locus_tag="BAB_RS28910"
                     /db_xref="GeneID:23672546"
     CDS             complement(534848..535063)
                     /locus_tag="BAB_RS28910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972092.1"
                     /db_xref="GI:489062064"
                     /db_xref="GeneID:23672546"
                     /translation="MPDIIPVISPLPGVEGLIVATGFSGHGFGIGPGAGRLVADMVCN
                     ETPLVDPSPFHISRFSDGTKIRIENWE"
     gene            complement(535072..536175)
                     /locus_tag="BAB_RS28915"
                     /db_xref="GeneID:23672547"
     CDS             complement(535072..536175)
                     /locus_tag="BAB_RS28915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase"
                     /protein_id="WP_002965939.1"
                     /db_xref="GI:489055792"
                     /db_xref="GeneID:23672547"
                     /translation="MGPITDKVATAESLPQETRITIIGGGVIGVSTALFLAERGIPVT
                     LFEKGEIAGEQSSRNWGWCRRTGRDSREMPLIVESMRLWEGMNARTGRETGFRVKGIV
                     YAAEKEEQMARYAEWIKIARQHGIETHLLNGEQAEALAPGLTRRLAGGMSTPLDGRAE
                     PQKAVPAMAAKAQEDGAVILQNCAVRGIETTNGRVSAVLTEKGRVRCEAVVVAGGAWS
                     RLIISGFKAHLPQLKVRSSVFRTAPIEGGVEPAIAFSDFALRKRLDGGYTVASLSGSI
                     ADIVPDSFRFFRDFIPSLSTEWRSLRFHLGERFFEEAFQWKLRPADQMSIFEKIRTLD
                     PAPHHTANVQVLAQLKKQSRLLRQPSLLRNGPG"
     gene            536412..537515
                     /locus_tag="BAB_RS28920"
                     /old_locus_tag="BAB2_0538"
                     /db_xref="GeneID:3827512"
     CDS             536412..537515
                     /locus_tag="BAB_RS28920"
                     /old_locus_tag="BAB2_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_002965940.1"
                     /db_xref="GI:489055793"
                     /db_xref="GeneID:3827512"
                     /translation="MDARNLQDERPGEEKCRQHSGTALSLSGICRQFGTMQALNHVSL
                     DVEPGEIICLVGHSGCGKTSLLRIIAGIDAPDSGTLTMGGKTLVSNGIFVEPEKRNVG
                     VVFQDYALFPHLTVRENVRFGLSRMRRSEANARAGELLDLVGLGHMADRYPHMLSGGE
                     QQRVALIRALAPKPHVLLMDEPFSNLDRGLRARVRRETVSLLRVLGTTAIIVTHEAEE
                     ALSTGDRVVLMRSGQIVQSGSPRDLHDCPVNRYAADFFCDFNAIPAEVHGDTLVTPFG
                     TIKKEAGFPSGSRVVVYLRPCDIAVLGADDGNLSLHGRIEARTYLGESEELVVKAGDM
                     PLRLHVRGEAPIPSGLADVSLCPHWEKALVFPD"
     gene            537641..538660
                     /locus_tag="BAB_RS28925"
                     /old_locus_tag="BAB2_0539"
                     /db_xref="GeneID:3827513"
     CDS             537641..538660
                     /locus_tag="BAB_RS28925"
                     /old_locus_tag="BAB2_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006215280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_002965941.1"
                     /db_xref="GI:489055794"
                     /db_xref="GeneID:3827513"
                     /translation="MSIIARSALALVAVTLVTGAAHADEVNLYTTREPGLIQPLLDAF
                     KSSTGITVNTVFLKDGLAERVASEGENSPADILMTVDAGNLVDLKDKGLTQPIDSKVL
                     KEAVPAQLRDADGDWYALSMRARVVYADKDMEIDKITYEELSDPKWKGKICIRAGQHP
                     YNTALFADYIAHHGVAKTEEWLAGLKANLARKAAGGDRDGAKDIVGGICDLAVANSYY
                     VGLMRSGKGGEDQKVWGEGIKVLLPTFQGGGTQVNISGAAVAKHAPHKEEAVKLLEYL
                     VSDEAQQQIYAKANYEYPVKPGAPLDPIVESFGELKIDTVPLSEIVSHRKQASELVDK
                     VGFDN"
     gene            538681..540450
                     /locus_tag="BAB_RS28930"
                     /old_locus_tag="BAB2_0540"
                     /db_xref="GeneID:3827514"
     CDS             538681..540450
                     /locus_tag="BAB_RS28930"
                     /old_locus_tag="BAB2_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002970629.1"
                     /db_xref="GI:489060575"
                     /db_xref="GeneID:3827514"
                     /translation="MGNAGVVKHRRCDIERLMAETVAVPESKTLRPPRAGRAWLWLSA
                     VVTVLVLFPVLALALEALQGSAGLWSHLAFTTLPAAFADTVILLSGVGLIAAVLGTSM
                     AWLVTAYDFRGRAVLEWALLLPLAVPTYIIAYAYLDLLHPVGPMQGAVRFLLGYDSPR
                     QFRLPDIRSMGGCIVLLGFVLYPYVYIPTRAMFLTQSASLIEAARTLGVSRKGIFWRV
                     ALPLARPAVAVGVSLALMETLNDVGAAEFLGVRTLTVSIYTTWITRSDLPRAAQLALA
                     LLFLVVALVSIERWARRKQRFASNIRHSRGFDPLKVSGFHGAWLFCLCAIPVMIGFVL
                     PAFYLAVEAIKRMRFAGISPRLAGEALNTVALASVATVLVLICGMLVAYAVRLFPAAF
                     SRWCYRFSTMGYAAPGTVIAIGILVVSGGFDRLLNQFTMQFFGFSAGLVLIGTGAAVV
                     YAYVVRFLAISAGGIDAGLERIPLSLDHASRTLGRSVTETFRAVHLPLSRTAIVAAGL
                     LVFVDCVKELPATLLLRPLNVETFATHLYGEAARGTYEEASIAALAIVITGILPVILL
                     ARVGRRLGRKEKLSAPQGPVRAG"
     gene            540628..541029
                     /locus_tag="BAB_RS28935"
                     /old_locus_tag="BAB2_0541"
                     /db_xref="GeneID:3827282"
     CDS             540628..541029
                     /locus_tag="BAB_RS28935"
                     /old_locus_tag="BAB2_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965943.1"
                     /db_xref="GI:489055796"
                     /db_xref="GeneID:3827282"
                     /translation="MVAGLSVVRNDLNWMMETTLTSQQWLPVELLNIGLAAAVFFACL
                     VHSLWKAVFDELNPVFWRRTAALLWAGVVIVALTGGMDTFNWPQALGWLLVAGGVCAT
                     VWRAGMGYYRQYCAHNSHGFHARRTRLSSGR"
     gene            complement(541099..541443)
                     /locus_tag="BAB_RS28940"
                     /old_locus_tag="BAB2_0543"
                     /db_xref="GeneID:3827284"
     CDS             complement(541099..541443)
                     /locus_tag="BAB_RS28940"
                     /old_locus_tag="BAB2_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_002965944.1"
                     /db_xref="GI:489055798"
                     /db_xref="GeneID:3827284"
                     /translation="MEIRQIDDNYSVTGQINPDDVRDIAAEGFQTIICNRPDGEGGEE
                     QPDFEEIARVAEKAGLAAYYIPAVGGQLTQENVDDMAAALAEAEGPVLAYCRSGARST
                     NIYGIVQNQKRG"
     gene            541553..542362
                     /locus_tag="BAB_RS28945"
                     /old_locus_tag="BAB2_0544"
                     /db_xref="GeneID:3827285"
     CDS             541553..542362
                     /locus_tag="BAB_RS28945"
                     /old_locus_tag="BAB2_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Protein FdhD homolog"
                     /protein_id="WP_002965945.1"
                     /db_xref="GI:489055799"
                     /db_xref="GeneID:3827285"
                     /translation="MTNQKISRDVHHLAHRMSGFQESSRIVPEEAPIAMSYNGTTQAV
                     MMATPGDLEDFAIGFSLTENIVTRIEEIEALDIVAFESGIDIQMKLAKQPEQRLSARR
                     RFMAGPVGCGLCGIDSIEQALRPLHPLEECSTTFTTRDIAAAVASLGAAQALNAKTHA
                     THGAGFFRPGEGLFAVREDIGRHNALDKLIGAVAREGLLAEEGIVAITSRVSVEMVQK
                     AVMLGVPVLAAISAPTALAIRTAEAANLTLVALVRDEEFDIYTHCGRIIES"
     gene            complement(542363..542839)
                     /locus_tag="BAB_RS28950"
                     /db_xref="GeneID:23672548"
     CDS             complement(542363..542839)
                     /locus_tag="BAB_RS28950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006151836.1"
                     /note="RibE; 6,7-diimethyl-8-ribityllumazine synthase;
                     DMRL synthase; lumazine synthase; beta subunit of
                     riboflavin synthase; condenses
                     5-amino-6-(1'-D)-ribityl-amino-2,4(1H,3H)-pyrimidinedione
                     with L-3,4-dihydrohy-2-butanone-4-phosphate to generate
                     6,6-dimethyl-8-lumazine (DMRL); riboflavin synthase then
                     uses 2 molecules of DMRL to produce riboflavin (vitamin
                     B12); involved in the last steps of riboflavin
                     biosynthesis; forms a 60mer (icosahedral shell) in both
                     Bacillus subtilis and Escherichia coli; in Bacillus
                     subtilis this 60mer is associated with the riboflavin
                     synthase subunit (alpha) while in Escherichia coli it is
                     not; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase 2"
                     /protein_id="WP_002965946.1"
                     /db_xref="GI:489055800"
                     /db_xref="GeneID:23672548"
                     /translation="MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSV
                     EVEIFDVPGAYEIPLHAKTLARTGRYAAIVGAAFVIDGGIYRHDFVATAVINGMMQVQ
                     LETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEAAHAALQIVSERSRIAALV"
     misc_binding    complement(542915..543078)
                     /note="FMN riboswitch, RFN element"
                     /bound_moiety="flavin mononucleotide (FMN)"
     misc_binding    complement(542916..543079)
                     /note="FMN riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="flavin mononucleotide"
     gene            543726..544991
                     /locus_tag="BAB_RS28955"
                     /old_locus_tag="BAB2_0547"
                     /db_xref="GeneID:3827287"
     CDS             543726..544991
                     /locus_tag="BAB_RS28955"
                     /old_locus_tag="BAB2_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O06875.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar-binding periplasmic protein"
                     /protein_id="WP_002967274.1"
                     /db_xref="GI:489057153"
                     /db_xref="GeneID:3827287"
                     /translation="MHKLLKLAAMGTAACALLAGMAPVANAQEKQNVEVLHWWTSGGE
                     ASALEVLKKDLESKGISWTDMPVAGGGGTEAMTVLRARVTAGNAPTAVQMLGFDIRDW
                     AEQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDK
                     AGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFID
                     LDPEALGSDTMKQAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGE
                     FLKAGKKPGEDFVCMRYPGTQGAVTFNSDMFAMFKVSEDKVPAQLEMASAIESPAFQS
                     AFNVVKGSAPARTDVPDTAFDACGKKAIADVKEANSKGTLLGSMAHGYANPAAVKNAI
                     YDVVTRQFNGQLSSEDAVKELVAAVEAAK"
     gene            545267..546148
                     /locus_tag="BAB_RS28960"
                     /old_locus_tag="BAB2_0548"
                     /db_xref="GeneID:3827288"
     CDS             545267..546148
                     /locus_tag="BAB_RS28960"
                     /old_locus_tag="BAB2_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006104968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002965949.1"
                     /db_xref="GI:489055803"
                     /db_xref="GeneID:3827288"
                     /translation="MQRNNRLQALVPKLVLGPSFLIVLVFVYGFIIYTGVLSLTNSRM
                     LPSYGFVGLTNYTKLWTLPHWWRAITNLAIFASLYIIICSVIGLFLAILLDQKIRGEG
                     ILRPIYLYPMALSFIVTGTAWKWFLDPGIGLEHTMHLWGWESFSFNWIKSNTMAIYCL
                     VIAAVWQSSGFVMAMFLAGLRGVDNEIIKAAQIDGASTGTIYRRIIIPLMRPVFLSAF
                     VVLAHLAIKAYDLVIALTGGGPGQATELPATFMYSYTFTRNQMGIGASSAIIMLAMIF
                     SIIIPYLYSEIRGGSRP"
     gene            546145..546327
                     /locus_tag="BAB_RS28965"
                     /db_xref="GeneID:23672549"
     CDS             546145..546327
                     /locus_tag="BAB_RS28965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter"
                     /protein_id="WP_002968852.1"
                     /db_xref="GI:489058769"
                     /db_xref="GeneID:23672549"
                     /translation="MSVQSQDNAIKSGKLTRALIYSALIFFAFYYLLPLYVMLVNSFK
                     PLEEIRQGGMLNLPQQ"
     gene            546373..547026
                     /locus_tag="BAB_RS28970"
                     /db_xref="GeneID:23672550"
     CDS             546373..547026
                     /locus_tag="BAB_RS28970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002967275.1"
                     /db_xref="GI:489057154"
                     /db_xref="GeneID:23672550"
                     /translation="MQPTGLKPFFINSILMVVPAVAISTIVGALNGYVLTKWRFRGSN
                     IFFGLLLLSCFIPFQIVLIPMARVLGILGIAGTIWGLILVHVVYGLGFTTLYFRNYYE
                     AFPTELVRAAQIDGASFFQIFWRILLPSSGPIIVVSVIWQFTNIWNDFLFGASFSGAH
                     STPMTVALNNLVSSSTGVKEYNVHFAGAILAALPTLIVYIVSGRYFVRGLMSGAVKG"
     gene            547045..548160
                     /locus_tag="BAB_RS28975"
                     /old_locus_tag="BAB2_0551"
                     /db_xref="GeneID:3827291"
     CDS             547045..548160
                     /locus_tag="BAB_RS28975"
                     /old_locus_tag="BAB2_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006188439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATPase"
                     /protein_id="WP_002967276.1"
                     /db_xref="GI:489057155"
                     /db_xref="GeneID:3827291"
                     /translation="MSFLKITDLYKSYGSVSVLKDINIEIDEGGFLVLVGPSGCGKST
                     LLNTIAGLEPITSGDIAINGKSVSNLHPSQRDIAMVFQSYALYPNMTVAGNIAFGMEI
                     RKVPKPERDKAIQQVADMLQIGHLLDRKPSQLSGGQRRRVAMGRALVRNPQVFLFDEP
                     LSNLDAKLRVDMRTEIKRLHSRMKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTP
                     AEIYNNPANMFVADFMGSPAMNLLPVKVEKSGSDYAITLDQGEGEVLKLPLKAVPQGL
                     AQYVGKEVVFGIRPEALTDPDGADRNAASIVEGDCLIDVVEPAGSDTFAVTRLGGKHV
                     VARLRADARIRAGQSARLAFNLDKSVFFDSASQTRIL"
     gene            complement(548281..548382)
                     /locus_tag="BAB_RS28980"
                     /db_xref="GeneID:23672551"
     CDS             complement(548281..548382)
                     /locus_tag="BAB_RS28980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002970632.1"
                     /db_xref="GI:489060578"
                     /db_xref="GeneID:23672551"
                     /translation="MNDITRTAIIYGMMIISLNTALAIGLLGIDFLR"
     gene            548722..550131
                     /locus_tag="BAB_RS28985"
                     /old_locus_tag="BAB2_0553"
                     /db_xref="GeneID:3827293"
     CDS             548722..550131
                     /locus_tag="BAB_RS28985"
                     /old_locus_tag="BAB2_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_002965954.1"
                     /db_xref="GI:489055808"
                     /db_xref="GeneID:3827293"
                     /translation="MNRIIPLVLAIALFMEQMDSNVISTSLPAIAADIGTSPIALKLA
                     LTAYLVALAVFIPVSGWMADRFGAKNVFRAAIAVFVVGSIACAASNSLPAFVIARFLQ
                     GMGGAMMTPVGRLVLIRSTPRNELVSAMAWLTIPAMVGPLVGPPVGGFITTFLTWHWI
                     FLINVPIGMIGIWFATHFLPDNEERIIKRLDWPGFFLSGFAMSGVVFGLSVVSLPALP
                     PVIGFATLAVGMLCTVLYVLHARRTPDPLLNLRLFDNQVFRSAVFGGSIFRFGIGAIP
                     FLLPLMFQLGFGLTPFQSGMMTFVSAIGAISMKFGAKRIFTRISFRRALMGGSLISAA
                     FIAVNGTFTPATPYWIIIGFLLVGGFARSLFFTGVNALAFAEIPNEKTSQATPLTAVA
                     QQVSIAIGVALAGGILEISTMLRGAPLALVDFHIGFFVVACVSVLAFFWFARLAPDAG
                     KELATPSVTRHHGKPVTTA"
     gene            complement(550330..551052)
                     /locus_tag="BAB_RS28990"
                     /old_locus_tag="BAB2_0554"
                     /db_xref="GeneID:3827294"
     CDS             complement(550330..551052)
                     /locus_tag="BAB_RS28990"
                     /old_locus_tag="BAB2_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8YCD5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA large subunit methyltransferase E"
                     /protein_id="WP_002965955.1"
                     /db_xref="GI:489055809"
                     /db_xref="GeneID:3827294"
                     /translation="MSKAGGNKGGSRTGGRGGAGSSNLHVRVKKKAGTIKESSRRWLE
                     RHLNDPYVHKSRQDGYRSRAAYKLIEINDRYNLLKKGQKIIDLGAAPGGWSQIAARIV
                     GSTDENPQVVGIDYLHVDPLPGVILLEMDFLDDEAPQKLMDALGDKPDLVISDMAAPT
                     TGHRRTDHLRTVHLCEVAADFAVSVLKPGGHFLTKTFQGGTENELLALLKQKFRSVHH
                     VKPPASRAESVELYLLARDFKG"
     gene            complement(551054..552583)
                     /locus_tag="BAB_RS28995"
                     /old_locus_tag="BAB2_0555"
                     /db_xref="GeneID:3827295"
     CDS             complement(551054..552583)
                     /locus_tag="BAB_RS28995"
                     /old_locus_tag="BAB2_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolyphosphatase"
                     /protein_id="WP_002972091.1"
                     /db_xref="GI:489062063"
                     /db_xref="GeneID:3827295"
                     /translation="MKNPEERTADTVHQGASGGQSGTIQARNPSEGGKRKLRKNAAAE
                     AGNARSAPDSGRPKTQNEAEAKGSPGQRKRARRRHRGKASRGTEAASAKPPAAEAAHA
                     EARPCGKISNRHRRARKKKQQACQQNVQPAHVAESAAKAAHHTPRTENHAPAPQAKRK
                     AGTPQPARHAHGEAPLYAALDLGTNNCRLLVASPTRPGQFRVVDAFSRIVRLGEGLST
                     TGALSDNAMHRAVEALKICRDKLAGKKIRRSRLIATEACRSAANGEEFLARVREETGL
                     ELEIVDRQTEARLAVSGCGTLVTPDTDAVVLFDIGGGSSEIALIDVSQRRSPRLTEHI
                     TAWTSLPVGVVTLAERFGGRNVTEESFGAMVDHVTELLSRFAERNCLGPLAASPRFHL
                     LGTSGTVTTLAGIHLGLERYDRRRVDGMWMGADDVTQMTNRLLSWDFEARVANPCIGA
                     DRADLVLAGCAILDAIRKVWPSEKLLVADRGLREGILTELMSRDGAWRHNRASGARNR
                     H"
     gene            complement(552792..553553)
                     /locus_tag="BAB_RS29000"
                     /old_locus_tag="BAB2_0556"
                     /db_xref="GeneID:3827296"
     CDS             complement(552792..553553)
                     /locus_tag="BAB_RS29000"
                     /old_locus_tag="BAB2_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006134682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_002965957.1"
                     /db_xref="GI:489055811"
                     /db_xref="GeneID:3827296"
                     /translation="MIELQHIVKRFDDAVILNDINITIAEGTVTALVGPSGGGKSTLL
                     RCINLLEIPTSGTLLLGGQSITFEPNRKPSWQTIQSIRRQTGMVFQNFQLFPHQTAIQ
                     NVMEGLVTVLKWPKNKTRERAMELLTKVGMAHKADAWPSTLSGGQQQRIAIARALAPS
                     PRVLLCDEPTSALDPELASEVVDVLSKLAQEGTTMVIATHDLRLASKIAKNVVFLETG
                     NVVETGSAHDVFTHPTRERTKQFVATINAAHSYDI"
     gene            complement(553550..554230)
                     /locus_tag="BAB_RS29005"
                     /old_locus_tag="BAB2_0557"
                     /db_xref="GeneID:3827297"
     CDS             complement(553550..554230)
                     /locus_tag="BAB_RS29005"
                     /old_locus_tag="BAB2_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter permease"
                     /protein_id="WP_002967278.1"
                     /db_xref="GI:489057157"
                     /db_xref="GeneID:3827297"
                     /translation="MPDWLQLMADSLPTLLWAGLIFTIPLTLLSFTFGLALGLLTALV
                     RLFAPVWLSSVARFYVWIFRGTPLLVQLFVIFYGLPSIGIYLDAFPAALIGFTLNIGA
                     YSSEIIRTVISSVPKGQWEAAYSIGMSWRQALIRTILPQATRTAVPPLSNTFISLIKD
                     TSLAAAITVPELFQSAQRIVATTYEPLILYIEAALIYLALSSILSALQVRLERRFGRY
                     GGTLETNA"
     gene            complement(554410..555183)
                     /locus_tag="BAB_RS29010"
                     /old_locus_tag="BAB2_0558"
                     /db_xref="GeneID:3828224"
     CDS             complement(554410..555183)
                     /locus_tag="BAB_RS29010"
                     /old_locus_tag="BAB2_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006107928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_002965959.1"
                     /db_xref="GI:489055813"
                     /db_xref="GeneID:3828224"
                     /translation="MKFAQILATAGIIQAVLFTGAMAGENLDAIKSAGVLKIGTEGTY
                     APFTYHDKDNKLVGFDVEIGEAIAGKLSVKPEFVEGKWDGLIAGLDANRYDAVINQVG
                     ITEERKKKFNFSNPYIVSKVVLIVNDKNDTIKDFADLKGKKAAQSLTSNYGRLAKEAG
                     AKLVATDGFDQSIQLVLTGRADATLNDSLSYLDFRKHQPKAPVKVVAEKDEATASGII
                     VRKGDDELVAAINKALDKIKADGTYNKISQKYFGQDVSK"
     gene            complement(555470..559084)
                     /locus_tag="BAB_RS29015"
                     /old_locus_tag="BAB2_0559"
                     /db_xref="GeneID:3827298"
     CDS             complement(555470..559084)
                     /locus_tag="BAB_RS29015"
                     /old_locus_tag="BAB2_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006196362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxoprolinase"
                     /protein_id="WP_002969323.1"
                     /db_xref="GI:489059252"
                     /db_xref="GeneID:3827298"
                     /translation="MMSAAWDFWIDRGGTFTDVIGRDPEGHLHARKVLSENPSAYKDA
                     AVHGIRLHLGLKTGEPVPAGIIGEVRMGTTVATNALLERKGERLALVTTKGFRDALKI
                     GYQERKNIFATEIIKPEALYDKVVELDERVRADGTVEKALALAEAEKALRALKAEGYK
                     SIAIALMHAYKFPAHEIEIARIASDMGFEQVSVSHEVSPLIKLVGRGDTTVVDAYLSP
                     VLRRYVAQVSDELDVERTGARVMFMMSSGGLTAADLFQGKDAILSGPAGGVVGLARTG
                     ETAGFGQVIGFDMGGTSTDVAHFDGEYERAFETEVAGVRVRAPMMLIHTVAAGGGSIL
                     HYEAGRFRVGPDSAGANPGPACYRNGGPLAVTDANVMLGKLLPEFFPAIFGPQQNQPL
                     DVARVRELFTALAGEIGDGRSPEAVADGFIRIAVANMVEAIKKISVQRGYDVTRYALN
                     CFGGAGGQHACLVADALGMKNILLHPMSGLLSAYGMGLADIRATRQKALGVALDPAAP
                     KALKELGEELADECVAELASQGIETDAMKQHLRAHIRYAGTDTALSIEATFPAEDDAA
                     RLRAEFEAAHKRRFGFIAENKALVIDAVEVEAVGGGAGEMENAQSLDSDQEAKPAKLT
                     RFFSQGEFHEAGVVLREAMQRGQTVTGPAIIIEKNQTIVIEDGWQARLTAHDHVVLTR
                     IKALPARTAIGTEADPVMLEIFNNLFRSIAEQMGVTLQNTAYSVNIKERLDFSCAVFD
                     AEGNLVANAPHMPVHLGSMDASVATAIRENKDIKPGDVFLINAPYNGGTHLPDLTVCT
                     PVFDDAGHQIRFWVASRGHHADIGGIAPGSMSPLAVNIEQEGVYIDNFKLVDRGTFRE
                     EALAALLTGATYPVRNLTQNVNDLKAQIAANEKGVAELKKMIGLFGEDVVKAYMGHVQ
                     DNAEESVRRVLDRLPDGHFIYEMDQGCQIEVRVTIDREKREATVDFTGTSEQRPDNFN
                     APEPVTRAAVLYVFRVLVEGDIPMNAGCLRPIRIIVPQGSMLSPRYPAAVVAGNVEVS
                     QAVTNCLFGATGAMAAAQGTMNNLTFGNDEYQYYETICSGAPAGPGFNGADAVHTHMT
                     NSRLTDPEILETRFPVLLEDFHIRKGSGGKGKWHAGDGTRRTIRALEKLDFAILSGHR
                     RVRPFGLKGGKPGETGRNEVCRKDGSVEVLKGCDQTLLEAGEAFTVITPTGGGYGEPE
                     "
     gene            559210..559818
                     /locus_tag="BAB_RS29020"
                     /old_locus_tag="BAB2_0560"
                     /db_xref="GeneID:3827299"
     CDS             559210..559818
                     /locus_tag="BAB_RS29020"
                     /old_locus_tag="BAB2_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006175429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002965961.1"
                     /db_xref="GI:489055815"
                     /db_xref="GeneID:3827299"
                     /translation="MGRMRKTGDGPEAPVDPREAGFEDVTLPKHLRPVASIGPIVSSA
                     HLAEGGSPAMSEVEYGLILASHAFSRWMVRCMAAAGLPGLSPIEILILHSIRHRDREK
                     KLADICLVLDIEDTHIATYAIRKLEKAGLLTTGKAAKEKTVKITAKGAEACAHYAQIR
                     ERLLVDSTANARPSEETLSELAALLRFMSGAFNQATRSAITL"
     gene            complement(559871..560629)
                     /locus_tag="BAB_RS29025"
                     /old_locus_tag="BAB2_0561"
                     /db_xref="GeneID:3827300"
     CDS             complement(559871..560629)
                     /locus_tag="BAB_RS29025"
                     /old_locus_tag="BAB2_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006164581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_002965962.1"
                     /db_xref="GI:489055816"
                     /db_xref="GeneID:3827300"
                     /translation="MIEISQVSKSYNGTLVVDDVTLRLPARGITSIIGPNGAGKSTLL
                     SMVSRLLPMDKGSVTVDGLDITTTSGDVLARRLSILRQENAINSRLTVRDLVTFGRYP
                     YSKGRPNSEDRKHVEQAIGYLGLEGLSERFLDELSGGQRQRAFVAMVLCQDTDYVLLD
                     EPLNNLDMKHSASMMKLLRRAADELGKTIVLVLHDINFASCYSDHIVAMRHGKVVHQG
                     SPDELIHPEILGEIYEMEIGVEIIGGKRIGVYYL"
     gene            complement(560626..561576)
                     /locus_tag="BAB_RS29030"
                     /old_locus_tag="BAB2_0562"
                     /db_xref="GeneID:3827653"
     CDS             complement(560626..561576)
                     /locus_tag="BAB_RS29030"
                     /old_locus_tag="BAB2_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin ABC transporter permease"
                     /protein_id="WP_002967279.1"
                     /db_xref="GI:489057158"
                     /db_xref="GeneID:3827653"
                     /translation="MHKRPAIVIALLGALTLLACVAFMTLGAKGSWSFVLSFRGTKLA
                     AMVLVAYSVAVSTVLFQTVTNNRILTPSIMGFDALYILIQTLVVFFGAVQIDWLGPNA
                     RFLAETAIMVVFAGTLYYWLFSGAARSLHLIMLVGIVCGVFFRSISNLMQRMLDPNLF
                     AILQDRFFASFNAINADILVISAIVVAAVSLYGLRYLYVLDVLSLGRDPAINLGVDHA
                     RVVRKILFIVTVLVSVSTALVGPITFFGLLVANLAYMISGSARHRIVLPVAVLLAVLC
                     IVGGQTLLERVLAFNTALSVIIEFLGGLFFIILLVRGNAR"
     gene            complement(561569..562531)
                     /locus_tag="BAB_RS29035"
                     /old_locus_tag="BAB2_0563"
                     /db_xref="GeneID:3827654"
     CDS             complement(561569..562531)
                     /locus_tag="BAB_RS29035"
                     /old_locus_tag="BAB2_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_002965964.1"
                     /db_xref="GI:489055818"
                     /db_xref="GeneID:3827654"
                     /translation="MKGLAAAVIVVAVLAVISLFIGVSDVSLHTLFGKASTDRATEVL
                     LISRIPRTLAIILAGMSMAVAGMIMQMLTRNRFVEPSTAGTVESASLGILLVILFAPE
                     TPVFGKMLMASVSALAGTALFLRILRSIPLRSVLVVPLVGIMLGGVINAITTFIAYRF
                     DLLQSLNSWTTGDFSGVLRGRYELLWIAFALTVVAYVAADRFTVAGLGEDFTTNLGLN
                     YRRVVTLGLVIVSMVSASVVVTVGMIPFLGLIVPNVVSMFIGDNMRRAVPWVALLGAG
                     LVLACDIVGRLIRFPYEIPIGTMMGVVGSAIFLYLLLRRGSRLA"
     gene            complement(562588..563535)
                     /locus_tag="BAB_RS29040"
                     /old_locus_tag="BAB2_0564"
                     /db_xref="GeneID:3827655"
     CDS             complement(562588..563535)
                     /locus_tag="BAB_RS29040"
                     /old_locus_tag="BAB2_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_002965965.1"
                     /db_xref="GI:489055819"
                     /db_xref="GeneID:3827655"
                     /translation="MKGSNIMLTFRQKITRLCGVAAMALALSSAAYAADITVKHAQGE
                     TAVPASPEKVVVFDLASLDNLDRLGVKVTGVPSGVPFPEYLKKYQGDDYAKVGTLFEP
                     DYEAVNAAEPDLIIVGGRSAAKYAALKKIAPTVDLTVDARNFIADTEANIEKLGQIFG
                     KEAEAKAEAEKLNKELAALHEKAAGKGTGLLILTSGGKISAYGPGSRFGVLHDSFGVK
                     PAAPNLSIGNHGQPISSEFILETNPDWLFVIDRDAAIGREGNSAKQLLDNELVRQTNA
                     WKKDQVVYLDAQNWYLVGGGFSALHNTIRQLSEAFDKSK"
     gene            complement(564013..565458)
                     /locus_tag="BAB_RS29045"
                     /old_locus_tag="BAB2_0566"
                     /db_xref="GeneID:3827657"
     CDS             complement(564013..565458)
                     /locus_tag="BAB_RS29045"
                     /old_locus_tag="BAB2_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_002965966.1"
                     /db_xref="GI:489055820"
                     /db_xref="GeneID:3827657"
                     /translation="MLQKNLIQKTQFYIDGAWRSPVEEKTIEVMNPADEKPYAVISAG
                     SAADVDLAVAAARRAFPAWSETPAEERIAYIRRIAEIYESRLDEMAKTISMEMGAPIK
                     LARESQAAAGLSHTKAFIAACENFEVEEVLSPKYPNQTVVHEPIGVCGLITPWNWPMN
                     QITLKVIPAIAVGCTVVLKPSEIAPMSAMLFAEFVDQAGLPKGVFNLVNGEGPVVGEA
                     LSQHPEVDMMSFTGSTRAGTAVSRAAAATVKRVSLELGGKSPNIVFADSDLEKAISRS
                     LAHCFENTGQSCNAPTRMLVERSVYDKAVELAKKAAESTKVGDPAQEGDHIGPLSSSI
                     QFEKVQALIQKGIDEGARLVAGGTGRPEGFTEGDYVKPTVFADVNNNMTIAREEIFGP
                     VLAMIPFDTEEEAIAIANDTPYGLAAYIQTGSPERAKRVARKLRAGMIQINGTSRAPG
                     SPFGGYKQSGNGREGGKWGLEDFMEVKLISG"
     gene            complement(565584..565988)
                     /locus_tag="BAB_RS29050"
                     /db_xref="GeneID:23672552"
     CDS             complement(565584..565988)
                     /locus_tag="BAB_RS29050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002968467.1"
                     /db_xref="GI:489058369"
                     /db_xref="GeneID:23672552"
                     /translation="MVELANNIETLEFIISKAREYDVQVPAVDEDSGSNPGDDRDVDI
                     LDASIGNPTRKELFAAISSLNEDERIELLALMWVGRGDFSATEWEEALSTASERHNGR
                     EAKYLIGTPLLGDYIEEGLVALGFDVETYDNE"
     gene            complement(566117..567772)
                     /locus_tag="BAB_RS29055"
                     /old_locus_tag="BAB2_0569"
                     /db_xref="GeneID:3827660"
     CDS             complement(566117..567772)
                     /locus_tag="BAB_RS29055"
                     /old_locus_tag="BAB2_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016149354.1"
                     /note="proposed role in polysaccahride synthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="WP_002967280.1"
                     /db_xref="GI:489057159"
                     /db_xref="GeneID:3827660"
                     /translation="MADADAIIIGAGLAGLAAAHELAGAGKKVILLEQEGENSIGGQA
                     FWSLGGLFMIDSPEQRRLGVKDNLELARQDWFGSAQFDRPEDHWPKQWAEAYLQFAAG
                     EMRPWLHSLGMRWFPVVGWAERGGSHAHGHGNSVPRFHVTWGTGPGVVAPFERLLREA
                     MHQNLVTLKCRHRVNGIVTTNGRISGVHGDVLAPSSVERGQPSSREVIADFEFSAGNI
                     IVTSGGIGGDPERVRRAWPRERLGNPPEDMVLGVPAHVDGRGIDIAVAAGGHVINGDR
                     MWHYTEGLRNWNPIWPNHGIRILPGPSSMWFDAQGNRLPAPCLPGFDTLATLKHILST
                     GYGYSWFILTEKIIRKEFSLSGSEQNPDLTGKDWKLLVKSRLGKTPPQPVKAFIDKGE
                     DFITAQTLEELVAGMNRLTGENLLDAAHIRTQIEARDREIANRYSKDAQIMAIRNARA
                     YLGDRLTRAVPLHALLDPANGPLIAVKLHILTRKTLGGLHTNLQSAVLDASGKPVPGL
                     YAAGEAAGFGGGGYHGYNALEGTFLGGCIFSGRAAGRAAASTI"
     gene            complement(567844..568605)
                     /locus_tag="BAB_RS29060"
                     /old_locus_tag="BAB2_0570"
                     /db_xref="GeneID:3827661"
     CDS             complement(567844..568605)
                     /locus_tag="BAB_RS29060"
                     /old_locus_tag="BAB2_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965969.1"
                     /db_xref="GI:489055823"
                     /db_xref="GeneID:3827661"
                     /translation="MIEHTPLFLTVAVIAAFLVGLSKGGLPTVGTLSVPLMALVISPV
                     TAAALLLPIYVVSDMFGLYLYRHHFSARNLAILTPSAIVGVGIGWLFSSHLSSTFIGM
                     LVGLVGLLFCFNAWVGARYRKKTRKADIPGGIFWGILTGLTSFVSHSGAPPFQMYVLP
                     QHLEKLVFAGTSTILFAIVNAVKLVPYWELNQFSNLDLSLGLWLVPAAVIGTYAGAIF
                     TRIMPDGPFFLLVQLTLFGLSIKLVADWIVPFFFA"
     gene            complement(568778..569632)
                     /locus_tag="BAB_RS29065"
                     /old_locus_tag="BAB2_0572"
                     /db_xref="GeneID:3827663"
     CDS             complement(568778..569632)
                     /locus_tag="BAB_RS29065"
                     /old_locus_tag="BAB2_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_002965970.1"
                     /db_xref="GI:489055824"
                     /db_xref="GeneID:3827663"
                     /translation="MTDTRAMWTYYKGEWREGDVRILGAASQATWLGSLVFDGARLFE
                     GVTPDLDRHSARANDSARALGLEPTLSANDIEALAREGLKKFAPDTDVYIRPMYWAEE
                     GDASTVAPLASSTDFALCLEAIPMVEPKGFTITTTSFRRPYLEVMPVNAKAACLYPNN
                     ARMLREAKAKGFHNALVTDVLGNVAETATSNVFMVRGGEVFTPVPNGTFLNGITRQRV
                     IKLLREAGVSVHETTLKIEDFREADEIFSTGNMSKVVPIIGFDERKLDYGLVTKRARA
                     LYWEWAHA"
     gene            complement(569751..570668)
                     /locus_tag="BAB_RS29070"
                     /old_locus_tag="BAB2_0573"
                     /db_xref="GeneID:3827664"
     CDS             complement(569751..570668)
                     /locus_tag="BAB_RS29070"
                     /old_locus_tag="BAB2_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_002965971.1"
                     /db_xref="GI:489055825"
                     /db_xref="GeneID:3827664"
                     /translation="MLYGILLAFASYAAFAVSDACVKFLDGTLSPYEIAFYGAVLGLL
                     AIPFTQKADDAWLDMFRTGNIKMWLLRTVTAAMGVIGSVAAFTYLSMAEAFALIFLLP
                     AYVTILSVIFLKEQVGWRRWSAVAIGFAGVLVALRPGFRELSIGHLGALAAGMGGATS
                     IIIFRVMGKNEKRISLYTSGLVGPILICGALMAPSYQAPGTMQWVYLAGYGLLAALAN
                     IMLMLAAQRPPASAIASPQYSQMIWAILFGYFVFHDHIDMPMLIGIVLITISGLFTFI
                     RERQRGVEGPPAVAAEPTPALVQEKAGYF"
     gene            570927..571064
                     /locus_tag="BAB_RS29075"
                     /old_locus_tag="BAB2_0574"
                     /db_xref="GeneID:3827665"
     CDS             570927..571064
                     /locus_tag="BAB_RS29075"
                     /old_locus_tag="BAB2_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965972.1"
                     /db_xref="GI:489055826"
                     /db_xref="GeneID:3827665"
                     /translation="MNIRQKVMQYVSRRRALRELGAMDDHLLADIGVSRSQIQSAVFG
                     R"
     gene            complement(571068..571250)
                     /locus_tag="BAB_RS29080"
                     /old_locus_tag="BAB2_0575"
                     /db_xref="GeneID:3827666"
     CDS             complement(571068..571250)
                     /locus_tag="BAB_RS29080"
                     /old_locus_tag="BAB2_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012243416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002965973.1"
                     /db_xref="GI:489055827"
                     /db_xref="GeneID:3827666"
                     /translation="MSHLEARFDLIESDRNAEHAGRKGLKQQKRQDWRPTLSLLYFKF
                     IPDFKFNPGGLSKAAP"
     gene            571433..571921
                     /locus_tag="BAB_RS29085"
                     /old_locus_tag="BAB2_0576"
                     /db_xref="GeneID:3827667"
     CDS             571433..571921
                     /locus_tag="BAB_RS29085"
                     /old_locus_tag="BAB2_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002965974.1"
                     /db_xref="GI:489055828"
                     /db_xref="GeneID:3827667"
                     /translation="MIDLIWRGILIGIGATVVMDIWAQLLALLPGQSRPKWGLVGRWF
                     WHLRHGQIFHDDISQSEPCRHEVALGWIGHYAVGILYGVIFALYGGAAWFANPIFLPA
                     WIFGILTIAAGWFLLQPGLGIGWAASKLPNAGNVRILNLIAHTFFSLGMYGTALILLN
                     TV"
     gene            572359..573651
                     /locus_tag="BAB_RS29090"
                     /old_locus_tag="BAB2_0578"
                     /db_xref="GeneID:3827669"
     CDS             572359..573651
                     /locus_tag="BAB_RS29090"
                     /old_locus_tag="BAB2_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine permease"
                     /protein_id="WP_002971227.1"
                     /db_xref="GI:489061187"
                     /db_xref="GeneID:3827669"
                     /translation="MFEKLFKLQEHGTSARTEIIAGVTTFLTMSYIIFVNPDILSTTG
                     MDRNAVFVATCLAAALGSIIMALVANWPIGMAPGMGLNAFFAFTVVGAMGFSWQQALG
                     AVFISGVIFLLLTVTGVRRWLVDGIPHSLRSAIAAGIGMFLALIGLKSAGVVVGNQAT
                     LVGMGDLTQSGPLLAIAGFFIIAILDALKVRGAILIGILVITVASIALGISQFGGIFS
                     APPSLAPTFLQLDIMGALHTGILHVILVFVLVEVFDATGTLIGVAKRGGLIETGKPNN
                     LGRALFADSGAILAGSLIGTSSTTAYVESAAGVQAGGRTGLTALIVGILFLAALFISP
                     LAGSVPAYATAPALVYVACLMMRELTEIEWHEVTEAAPAALAALAIPFTHSIANGLAF
                     GFISYVVMKTFTGKVREIHAATWLVAALFVIRFAFFAE"
     gene            573712..574311
                     /locus_tag="BAB_RS29095"
                     /old_locus_tag="BAB2_0579"
                     /db_xref="GeneID:3827670"
     CDS             573712..574311
                     /locus_tag="BAB_RS29095"
                     /old_locus_tag="BAB2_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_002965977.1"
                     /db_xref="GI:489055831"
                     /db_xref="GeneID:3827670"
                     /translation="MQPEELNLLERLIDIIEQDIIPLTERGVAEGNKVFGAALLRNSD
                     LSLVLAETNNETENPLWHGEVHTLKRFYEMPEKERPDTKDMVFLSTHEPCSMCLSAIT
                     WSGFDNFYYLFSHEDSRDAFSIPHDLKILKEVFTLEPGGYNRDNAFWHSHSIPKMVAS
                     LAEPDRSRLEKRLNAIRARYDAMSGSYQAGKEGNAIPLS"
     gene            complement(574389..576155)
                     /locus_tag="BAB_RS29100"
                     /db_xref="GeneID:23672553"
     CDS             complement(574389..576155)
                     /locus_tag="BAB_RS29100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006080497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_002965978.1"
                     /db_xref="GI:489055832"
                     /db_xref="GeneID:23672553"
                     /translation="MTHQQILSFTVIALMMGAFIWGKFRYDVVALCALLLAIAVGVVP
                     FDRAFSGFSDDIVIIVGSALIVSAGVARSGVMQVAVQRFLPEMSSVRLQLAVLVALVT
                     VLSAFVKNVGALAIMIPVAFQFARRSNVSPSTFLMPMAFGALLGGLMTQVGTSPNIVV
                     SRIRGEMVGTPFTMFDFTPVGAVLSVVGLIYLVLFYWLVPQRTRENISLNEAIKNYAS
                     EARVTKTSTMVGKRVTDLIKTAEGEAMVTSIVRRNQRLTPLPDMILHEGDVILLEGDP
                     KALDTIISAGKLTLSENRNPSDTSGSSDIEAVEAVIGKNSRLIGLTAQRLDLYARYDV
                     NLLAVSRPGERITERLSEVVLRFGDVVVLQGRQANLSNFLPEFELLPLARRKLMLGSV
                     RRGLIPLAILIAAVAATAFSIMPVAVAFFAAAVAMLVFKVIPLNEVYDEIDGPILVML
                     AALIPVSDALRTTGGTEIIAQGLASLGQQLPPAGALALILVAAMMVTPFLNNAATVLV
                     MAPIATSFAAGLGFRPEAFLMAVAIGAGCDFLTPIGHQCNTLVMGPGGYKFSDYPRLG
                     LPLSIIIAIVTVPTLMFFWPLK"
     gene            complement(576417..577472)
                     /locus_tag="BAB_RS29105"
                     /old_locus_tag="BAB2_0582"
                     /db_xref="GeneID:3827695"
     CDS             complement(576417..577472)
                     /locus_tag="BAB_RS29105"
                     /old_locus_tag="BAB2_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate import ATP-binding
                     protein UgpC"
                     /protein_id="WP_002970644.1"
                     /db_xref="GI:489060590"
                     /db_xref="GeneID:3827695"
                     /translation="MSKIVLDNVRKSYGGNIEVIKGVSLEIADGEFVVLVGPSGCGKS
                     TLLRMIAGLESITSGTISIGERVVNNVEPAERDIAMVFQNYALYPHMTVRENLAYGLK
                     NRKTPKEEIERRIAKAAKALEIEQFLERKPRQLSGGQRQRVAMGRAIVREPAAFLFDE
                     PLSNLDAKLRVQMRVEIKRLQRSLGTTSVYVTHDQMEAMTMADRLVVLNAGHIEQVGT
                     PIELYEKPASTFVATFIGSPSMNLLQSPESAPWQPGRAITLPSGGYTFGVRPEDIRIL
                     EEGDQDADGFNAQVRIEAVELVGAESYIHAALSDGKPLIFRVAGRSTHNIDEMVRVGA
                     SATDVHIFGADGRRVSD"
     gene            complement(577472..578320)
                     /locus_tag="BAB_RS29110"
                     /old_locus_tag="BAB2_0583"
                     /db_xref="GeneID:3827696"
     CDS             complement(577472..578320)
                     /locus_tag="BAB_RS29110"
                     /old_locus_tag="BAB2_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769372.1"
                     /note="with UgpABC is involved in uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate transport system
                     permease protein UgpE"
                     /protein_id="WP_002968959.1"
                     /db_xref="GI:489058879"
                     /db_xref="GeneID:3827696"
                     /translation="MIEQRPVSNLIGHLILILGIIIVAFPIYYTFVASSMTSTQIIRP
                     PISLLPGDHLVENYREAIFGGVERVVGVSLERLLWNSFVVAMAIAVGKIIISFMSAFA
                     IVFFRFPMRMFFFWMIFITLMLPVEVRILPTYKVIVDLGMIDTYAGLTLPLMASATAT
                     FLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPLSKTNIAALFVILFIYGWTQYLW
                     PLLVTNDAKMNTIIIGLRRMVDWADASTPWNYVMVTAILAIIPLILVVVLMQRWFVKG
                     LVETEK"
     gene            complement(578332..579213)
                     /locus_tag="BAB_RS29115"
                     /old_locus_tag="BAB2_0584"
                     /db_xref="GeneID:3827693"
     CDS             complement(578332..579213)
                     /locus_tag="BAB_RS29115"
                     /old_locus_tag="BAB2_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006138483.1"
                     /note="with UgpEC is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate transport system
                     permease protein UgpA"
                     /protein_id="WP_002965981.1"
                     /db_xref="GI:489055835"
                     /db_xref="GeneID:3827693"
                     /translation="MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDA
                     FGLKSTFVELANFTAVLSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQ
                     TFYRTLLIWPYAVAPAVAGMLWLFIFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVV
                     VAAAWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLV
                     VNTVYAFFDTFGIIHAVTGGGPAKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVI
                     ALTAFQFRFVEKRVHYS"
     gene            complement(579286..580587)
                     /locus_tag="BAB_RS29120"
                     /old_locus_tag="BAB2_0585"
                     /db_xref="GeneID:3827694"
     CDS             complement(579286..580587)
                     /locus_tag="BAB_RS29120"
                     /old_locus_tag="BAB2_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006161953.1"
                     /note="with UgpACE is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate-binding periplasmic
                     protein UgpB"
                     /protein_id="WP_002965982.1"
                     /db_xref="GI:489055836"
                     /db_xref="GeneID:3827694"
                     /translation="MFTRLITTSVLTGAIALTIGSQAFAQTELAWWHGMTGANNEMVN
                     ELSKEFNESQSEYKIVPVYKGNYPETLNAGIAAFRSKQPPAILQVFDAGSGVMMAAEG
                     AIVPAAEVLEKGGYKFDKSQYLPGIVAYYSKPDGTMLSFPYNSSSPILYYNKDAFKKA
                     GLDENKPPKTWPEVFEAAKKIKASGASPCGFTSTWLTWIQTENFAAWNNVPYGTNENG
                     LAGTDVKLEINSPLYVEHFQAIADLAKDGTFRYGGRTSEAKQLFTSGECAMLTESSGG
                     LGDVVKSGINYGIGQLPYYEGHGPQNTIPGGASLWVFAGLSDDQYKGIAEFFNFLSQT
                     KIQVKLHEKSGYLPVTLAAYEETKKSDFYEKNPGRETPILQMMGKEPTENSKGVRLVN
                     LPQVRDILNEEFEAMLGGKQDAKTALDNAVKRGNAAIAAAQ"
     gene            complement(580920..581960)
                     /locus_tag="BAB_RS29125"
                     /old_locus_tag="BAB2_0586"
                     /db_xref="GeneID:3828113"
     CDS             complement(580920..581960)
                     /locus_tag="BAB_RS29125"
                     /old_locus_tag="BAB2_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_002967282.1"
                     /db_xref="GI:489057161"
                     /db_xref="GeneID:3828113"
                     /translation="MATEQTIKVFDGHNDVLLRLWSSNQPEPENRFLEGESSGHIDLP
                     RARKGGLGGGLCAVYVPSPSHDLDADGNLPTPSQQDALKTTLAMSAILQNIERKSEGQ
                     VRICRTAADIRDAFAKDIFASVYHIEGVEAFDADLDALYVLHAAGLRSLGPVWSRPNI
                     FAHGIPFRFPSSPDIGPGLTDHGKALIRACNELKVMIDLSHMNEKGFWDIAALSDAPL
                     VASHSNAHVLCQQSRNLTDRQLDAIRETGGLVGLNFGVSFLREDGKHDPDTKLEELVR
                     HADYIVGRIGIDHVAFGSDFDGTIISSTLRDVADLQLVIETFRKHGYDDASLVKLAHG
                     NWIDVLERTWGK"
     gene            582065..583864
                     /locus_tag="BAB_RS29130"
                     /old_locus_tag="BAB2_0587"
                     /db_xref="GeneID:3828114"
     CDS             582065..583864
                     /locus_tag="BAB_RS29130"
                     /old_locus_tag="BAB2_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="WP_002965984.1"
                     /db_xref="GI:489055838"
                     /db_xref="GeneID:3828114"
                     /translation="MIADAQMQAPVENQVYCGLRHCDSFCELIPMKGCEAMLEWMIDQ
                     GAGREPADIVLKGGRFLDLITGELVESDIAICEDRIVGTFGTYRGKHEIDVSGRIVVP
                     GFIDTHLHIASSQVTPHEFDRCVLPQGVTTAICDPHEIANVLGAEGIRFFLDSALETV
                     MDIRVQLSSCVPATHMETSGAELLIDDLLPFADHPKVIGLAEFMNFPGVLAKDPECMA
                     KLRAFQGRHIDGHAPLLRGLDLNGYIAAGIRTEHEATNAEEALEKLRKGMYVLVREGS
                     VSKDLKALMPIITERHAQFLALCTDDRNPLDIADQGHLDYLIRTAIAGGVEPLAIYRA
                     ASVSAARVFGLFDRGLVAPGQRADLVVVDSLEGCHAEIVLSAGRVVSEALFAARKPVA
                     EVGRNSVKAPRVTASNFRSQSNSGKTRAIGIVPGKIITQNLEFDLKVGPNGVEPDLER
                     DVVKVAVIERHGKNGNIATGFVHGFGLKAGAIASTVSHDSHNICVVGASDEDIATAAN
                     RLGEIEGGFVVVRDGKVLAEMPLPIAGLMSTEPYETVREALRKLRHAAEDLGSVLEEP
                     FLQLAFIALPVIPHLKITDRGLVDVDKFEFVGN"
     gene            complement(583865..584581)
                     /locus_tag="BAB_RS29135"
                     /old_locus_tag="BAB2_0588"
                     /db_xref="GeneID:3828115"
     CDS             complement(583865..584581)
                     /locus_tag="BAB_RS29135"
                     /old_locus_tag="BAB2_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter"
                     /protein_id="WP_002965985.1"
                     /db_xref="GI:489055839"
                     /db_xref="GeneID:3828115"
                     /translation="MSAASLEIRNLSSGYGPTRVIEDVSFKAEPGSRLAILGRNGVGK
                     TSLFATIAGQTRRYGGEILLDGRNIAPLPSAARALAGLGYVPQTRDIFPTLTVEENLF
                     VGLKNRPKDALEEAYAMFPRLKERRRNLGSQLSGGEQQMLSTARSILGQPTVLLLDEP
                     LEGLAPVICEELMAAFSALAQKGDMTILLVEQRIQSALDFADHVIILERGRIAWSGTA
                     AELADNPQTVEELLGVGGLH"
     gene            complement(584578..585327)
                     /locus_tag="BAB_RS29140"
                     /old_locus_tag="BAB2_0589"
                     /db_xref="GeneID:3828116"
     CDS             complement(584578..585327)
                     /locus_tag="BAB_RS29140"
                     /old_locus_tag="BAB2_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006145262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin III"
                     /protein_id="WP_002965986.1"
                     /db_xref="GI:489055840"
                     /db_xref="GeneID:3828116"
                     /translation="MSTVFEVSKLRKNFGGLAVTNDVSLSMAKGDRVALIGPNGAGKT
                     TFVNLVTGNLAATSGTVTLGGENVSKLNAMQRVRRGLVRSFQVTRLFFDMTPEEHVAL
                     AILQREGKTGRILGNYRRMPQVMDEARDILHMLGLLPLAQLRVSEIAYGQQRLLEIAL
                     ALALRPKVLLLDEPAAGVPQSDTGRIEEALDRLPPDLAVLMIEHDMDLVFRFAKRVVV
                     LAAGTVIFDGLPQAVVQDARVREAYLGSYAQ"
     gene            complement(585311..586309)
                     /locus_tag="BAB_RS29145"
                     /db_xref="GeneID:23672554"
     CDS             complement(585311..586309)
                     /locus_tag="BAB_RS29145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006256495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_002967283.1"
                     /db_xref="GI:489057162"
                     /db_xref="GeneID:23672554"
                     /translation="MTELTQPLPQTRHSYAGLIGIVAIIAASVVGWFLFPDNLALLTR
                     IIAIALLVLSLDLVTGYCGIATLGHAALFGAGAYGAGIAAAHFGVTDPILMTVIGLLA
                     GAVTGLVSGAVILRATGLAQLVLSIAVVHLFHEAANKASGWTGGSDGLSGISPDPIFG
                     IFEFDLYGRTVYIYAVILLLISFIFLRYVVRSPFGMLCRGVKEDPIRIHAMGASVQGA
                     QLRMYVISGAVAGISGALNAISTQVVGLDSLSFTMSAEALVMLVLGGPDLFSAGWLAR
                     SSSCGLRTWYPPPIRSIGSPWSARSSLPWCSSPRAAFTEPSPIILKRRRAANEHRV"
     gene            complement(586306..587175)
                     /locus_tag="BAB_RS29150"
                     /old_locus_tag="BAB2_0592"
                     /db_xref="GeneID:3828119"
     CDS             complement(586306..587175)
                     /locus_tag="BAB_RS29150"
                     /old_locus_tag="BAB2_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006217505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002965988.1"
                     /db_xref="GI:489055842"
                     /db_xref="GeneID:3828119"
                     /translation="MQTVLSIAVDALAYGMVLFVISIGLSVTMGLMRVVNLAHGAFAM
                     IGGYFASYAAQQLGLNYGFAIIIAVVGTMIIAVPVERLLYRRIYGAPELTQVLMTIGV
                     TFCIIGITNYIFDPTLKTIPLPEMLRGSVDLGFRAIAKHRIFAIGCGLAVAVGLWYAV
                     ERTAFGVKLRAAVDNANMAAALGVRTEIVYAVSFALAIGLAAFGGVVGAELLPVEPYY
                     ALRYMVTFLVVVSVGRAGSIPGALVACLLLGAIDTTGRYLAPEYGEFFFYLAVIVIVT
                     LFPRGLAGRLARK"
     gene            complement(587348..588520)
                     /locus_tag="BAB_RS29155"
                     /old_locus_tag="BAB2_0593"
                     /db_xref="GeneID:3828120"
     CDS             complement(587348..588520)
                     /locus_tag="BAB_RS29155"
                     /old_locus_tag="BAB2_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Leu/Ile/Val-binding protein homolog 6"
                     /protein_id="WP_002965989.1"
                     /db_xref="GI:489055843"
                     /db_xref="GeneID:3828120"
                     /translation="MKKIALTALAVFSLAASAAYADVVKVGVIGPFSGPFALQGKNFK
                     AGIDAYMAEHGNKVGDDTVEVVYRDVPQADPAQSKALAQELVVKEGVQYLAGFYFTPD
                     AMAVTPILKQGNVPMVVMNAATSSIVTKSPYVVRTSFTTWQTSTPIARVALDKGVKKV
                     ISVVSDYGPGVDAENAFKAAFTDAGGEVVEAIRMPLATNDFSPIMQRIKDSGAQGVFA
                     FLPSGPTTFGFMKAYVDNGLKSSGIQLFAPGDLTQESDLPALGENALGVLTTFHYAVS
                     HDSPENRKFVEEARKAIGNPAELSFPSVGAYDGMHVIYKMIEATGGKKDAAKAVEAVK
                     GMEWVSPRGPVSIDPESRHITQNIYLREVAKADDGTYYNKEIQTFEKQGDPGLKAQ"
     gene            complement(588656..589720)
                     /locus_tag="BAB_RS29160"
                     /old_locus_tag="BAB2_0594"
                     /db_xref="GeneID:3828121"
     CDS             complement(588656..589720)
                     /locus_tag="BAB_RS29160"
                     /old_locus_tag="BAB2_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799889.1"
                     /note="Catalyzes the cycloisomerization of
                     cis,cis-muconate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /protein_id="WP_002965990.1"
                     /db_xref="GI:489055844"
                     /db_xref="GeneID:3828121"
                     /translation="MSISVFEHPFLTGLFGDDEEISSLFTAYADIAAMLKFEAALAGA
                     QADLGIIPAHAAERIMSATETMEPDLAQLEHGTARDGVVVPALVRNLRKTVGEDVAAH
                     VHFGATSQDVIDTSLMLRLARVRDILVARIEQLSERFNWLETTFGQNDLTAYTRMQPA
                     ISTTVADRVESWRAPFSDHAQRLAALQFLLQFGGAAGTLEKFVGKGAKLRAELAKRLG
                     LEDRPQWHSQRAFIADFGHLLSLVTGSLGKFGQDIALMAELRDEISLSGGGGSSAMPH
                     KQNPVRAELLVTLARFNAVQVSGLHQAMVHEQERSGTAWMLEWMILPPVVAATGAALK
                     AALVLSDNIVRMGKDRLPET"
     gene            complement(589724..590341)
                     /locus_tag="BAB_RS29165"
                     /old_locus_tag="BAB2_0595"
                     /db_xref="GeneID:3828039"
     CDS             complement(589724..590341)
                     /locus_tag="BAB_RS29165"
                     /old_locus_tag="BAB2_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit alpha"
                     /protein_id="WP_002965991.1"
                     /db_xref="GI:489055846"
                     /db_xref="GeneID:3828039"
                     /translation="MVQPLGYLKETASQTAGPYVHIGLTPNFVGINGVFAEDLGTGPL
                     YNDKAHGERITIKGRVIDGMGAPLRDALVEIWQADAAGLYNSPSESRGKADPHFRGWG
                     RCPSNMETGEFIFETIKPGRVPFRDGRLMAPHVTLWIVARGINLGLQTRMYFSDEEAA
                     NAEDPVLARIEHRMRVPTLIGQREGDVYHFDIHLQGEKETVFFDI"
     gene            complement(590343..591083)
                     /locus_tag="BAB_RS29170"
                     /old_locus_tag="BAB2_0596"
                     /db_xref="GeneID:3828040"
     CDS             complement(590343..591083)
                     /locus_tag="BAB_RS29170"
                     /old_locus_tag="BAB2_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protocatechuate 3,4-dioxygenase subunit beta"
                     /protein_id="WP_002967284.1"
                     /db_xref="GI:489057163"
                     /db_xref="GeneID:3828040"
                     /translation="MKNSLPETSPFFARDLSMHPPAYTPWYKTSVLRSPTRALISLEG
                     TRSEITGPVFGHNMLNELDNDLILNYARPGEMPVGPRILVHGRVLDEGNRPVPGALLE
                     FWQANAGGRYRHKKETYLAAIDPNFGGVGRTITDENGYYWFKTIQPGAYPWPNGVNDW
                     RPAHIHFSVFGHGFAQRLITQMYFEGDPLIWRCPIVKTIPDKSAIERLIAPLDMNATL
                     PMDMRAFKFDIVLRGRRSTFFENRPEGN"
     gene            complement(591080..591499)
                     /locus_tag="BAB_RS29175"
                     /old_locus_tag="BAB2_0597"
                     /db_xref="GeneID:3828037"
     CDS             complement(591080..591499)
                     /locus_tag="BAB_RS29175"
                     /old_locus_tag="BAB2_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="WP_002965993.1"
                     /db_xref="GI:489055848"
                     /db_xref="GeneID:3828037"
                     /translation="MMAENATETAPSERYKLGMRVRRSVLGDTHVDRASNGATELDAP
                     FQALITEAAWGTVWARPGWSKRERSIVTIALLAALGQDDEVAMHIRATRNTGATKEDI
                     CEALMHVAIYAGVPASNHAFKIAKQTYAQMEAEEAEK"
     gene            complement(591500..592303)
                     /locus_tag="BAB_RS29180"
                     /old_locus_tag="BAB2_0598"
                     /db_xref="GeneID:3828043"
     CDS             complement(591500..592303)
                     /locus_tag="BAB_RS29180"
                     /old_locus_tag="BAB2_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002965994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate enol-lactonase"
                     /protein_id="WP_002965994.1"
                     /db_xref="GI:489055849"
                     /db_xref="GeneID:3828043"
                     /translation="MQFAKVNDIVVHYDLRWNGNDKPVLVFINSLGTDFRIWNKVRAR
                     LGHDVSTLVYDKRGHGLSDIGKTPYTIELLAQDLIALLDRLSIHKAVICGLSVGGLIA
                     QGLYAARPDLVAGLVLSNTAHKIGTPEMWNARIDAIMQNGLASILDATMPRWFTAAYR
                     RPDNAAYQAYCNMFTRQPLEGYAATCAALRDADFTAAAHKISVPVRCVAGDQDGSTPP
                     TLVQELASLIPGAVFSQIANSGHIPCVEQPDAYTALLRDFLSHNLLHGE"
     gene            592397..593305
                     /locus_tag="BAB_RS29185"
                     /old_locus_tag="BAB2_0599"
                     /db_xref="GeneID:3828122"
     CDS             592397..593305
                     /locus_tag="BAB_RS29185"
                     /old_locus_tag="BAB2_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_002967285.1"
                     /db_xref="GI:489057164"
                     /db_xref="GeneID:3828122"
                     /translation="MIGNRIKFRHLHTFVEVARQKSVVKASEILNISQPAVTKTMREL
                     EEILGVPVLERDGRGIRITRYGEVFLRHAGTALTALRQGLDSVSQELDGSGPPIRIGA
                     LPTVSTRIMPKAISLFLGEKTGSKVKIVTGENAVLLEQPRFGDLDLVVGRLAAPEKMT
                     GFSFEHLYSERVRFLVRAGHPLLDDDTIFDHLANYPVLMPTRNSIIRPFVERLLITNG
                     VGSLPTQIETVSDAFGRAFVRDSDAVWIISEGVAAHDVAEGKLVALPIDTSETTGPVG
                     LTMRTDMVQTAPLQILVQTIREAADH"
     gene            complement(593850..594887)
                     /locus_tag="BAB_RS29190"
                     /db_xref="GeneID:23672555"
     CDS             complement(593850..594887)
                     /locus_tag="BAB_RS29190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006233426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate 3-monooxygenase"
                     /protein_id="WP_002965996.1"
                     /db_xref="GI:489055851"
                     /db_xref="GeneID:23672555"
                     /translation="MRTKVVIIGSGPAGLLLGQLLTRAGIDNVILDRVSENYILGRVR
                     AGVLEEGTVRLMDEAGASDRLHREGLPHDGFSLAFDGRDHRIDLHKLTGKRVTVYGQT
                     ELTHDLMSERHRSGAHGIYEADNITPHDFDTASPYVTYEKDGITHRIDCDYIAGCDGY
                     HGVSRKSVPQKAIRIFEKVYPFGWLGVLADIPPVDHELIYANHERGFALCSMRSLTRS
                     RYYIQCALDEKVEDWSDERFYDELRRRLPAHHAEAMVTGPSFEKTIAPLRSFVAEPMR
                     FGRLFLAGDAAHIVPPTGAKGLNLAASDVHYLFEGFCANFISKIQPPASMPIRRARLP
                     ASGRRSVFHGP"
     gene            595000..595917
                     /locus_tag="BAB_RS29195"
                     /old_locus_tag="BAB2_0602"
                     /db_xref="GeneID:3828052"
     CDS             595000..595917
                     /locus_tag="BAB_RS29195"
                     /old_locus_tag="BAB2_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_002967286.1"
                     /db_xref="GI:489057165"
                     /db_xref="GeneID:3828052"
                     /translation="MRKRIPTYELYGEETDQKPDFWLHCETLYSRSSLHNFEISLHRH
                     DNFFQFLYVESGTGNVNFDGVLHSFRTPCAIIVPPNFNHGFAFSRNIVGHIVTVLQPQ
                     MPFLESGFGTSTADWMMRPKLVQMEGADEADLAFLALTMRRIQSEYQSRKMHKNSMLE
                     SLLKSSLVQIIRHALALQPEHDTWQSYREPRIERLLELIDRHFREHRPVSFYAGQLGL
                     SATHLNRLTRRVAGAPVQHMIARKLIDMARRDLVAMPSSVQHVAYSLGFSDPAYFSRF
                     FQKMTGETPRAFRLRERERLSASMPVTAQ"
     gene            complement(595924..596694)
                     /locus_tag="BAB_RS29200"
                     /old_locus_tag="BAB2_0603"
                     /db_xref="GeneID:3828124"
     CDS             complement(595924..596694)
                     /locus_tag="BAB_RS29200"
                     /old_locus_tag="BAB2_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_002965998.1"
                     /db_xref="GI:489055853"
                     /db_xref="GeneID:3828124"
                     /translation="MRETDFVGGFAKGLRVIEALGEDRPRLSIADVSKITGLDRATAR
                     RCLLTLAELGYAEYDGKFFMLLPRILRLGHAYLSGTPLPTIIQPHLDRLSQSVGESAS
                     ASVLDGAEIVYIARASQMRVISINLMAGSRLPAYCASMGRVLLAWLDESEARTILEQT
                     ELRARTPFTQKDPEKLMEELRRIRAQGFAVNDQELELGLRSIAVPVFNHRGAVVAALN
                     IGAPVAHVEVSDLVWRILPEMLKIQSELRSMLRQRLFE"
     gene            596878..597585
                     /locus_tag="BAB_RS29205"
                     /old_locus_tag="BAB2_0604"
                     /db_xref="GeneID:3828041"
     CDS             596878..597585
                     /locus_tag="BAB_RS29205"
                     /old_locus_tag="BAB2_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit A"
                     /protein_id="WP_002967287.1"
                     /db_xref="GI:489057166"
                     /db_xref="GeneID:3828041"
                     /translation="MDKRIGSAAEAVAEIGDGATVMIGGFGGSGAPIELIHALTDKES
                     KGLTVINNNAGNGRIGIAAMIDAGMVRKMICSFPRSSDPRAFTDRYLAGEIELELVPQ
                     GTLAERIRAGGAGIPAFYTPTAYGTELADGKVIAEFDGRPYVQERWLKADFALVKAHL
                     GDSHGNLTYRMAARNFNPLMCMAAAKTIVQVSRIVPLGGIEPENVITPGIFVDRVVEI
                     ANPQQEEELIRAGVAYI"
     gene            597582..598271
                     /locus_tag="BAB_RS29210"
                     /old_locus_tag="BAB2_0605"
                     /db_xref="GeneID:3828042"
     CDS             597582..598271
                     /locus_tag="BAB_RS29210"
                     /old_locus_tag="BAB2_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /protein_id="WP_002966000.1"
                     /db_xref="GI:489055855"
                     /db_xref="GeneID:3828042"
                     /translation="MTIDTLEDIKLSNAQIAWRAAQDIADGAYVNLGIGFPEMVARYQ
                     PEGREAIFHTENGILDFGEAPPPGEEDWDLINAGKKAVTLKPGAAFFHHADSFSMVRG
                     GHLDVAILGAYQVAQNGDLANWRVGAKGVPAVGGAMDLVHGAKQVVVITEHVTKKGEP
                     KLVEQCTFPLTGVKCITRIYTSHAVVDVSEGRFVLREKLAAMTLEELQAMTGAKLHIE
                     GPVADLVVPEL"
     gene            598280..599404
                     /locus_tag="BAB_RS29215"
                     /old_locus_tag="BAB2_0606"
                     /db_xref="GeneID:3828038"
     CDS             598280..599404
                     /locus_tag="BAB_RS29215"
                     /old_locus_tag="BAB2_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006114097.1"
                     /note="catalyzes the thiolytic cleavage of
                     beta-ketoadipyl-CoA to succinate and acetyl-CoA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_002969327.1"
                     /db_xref="GI:489059256"
                     /db_xref="GeneID:3828038"
                     /translation="MTEAYICDYIRTPIGRYGGALSSVRADDLGAVPLKALMERNGSV
                     DWEAVDDVIFGSANQAGEDNRNVARMSLLLAGLPVGVSGTTINRLCGSGMDAVITAAR
                     AIKAGEAELIVAGGVESMSRAPLVMPKADSAFSRKAEIYDTTIGWRFINPLMKKQYGV
                     DSMPETGENVAEDYNISREDQDAFALRSQDKAAAAQANGRLAREIVSVTIPQRKGDPV
                     IVEKDEHPRATSREALAKLPTPFRQGGTVTAGNASGVNDGAAAGVPPRVMGIGPAPAT
                     RKLCARIGIAPDAFDVIELNEAFASQGLAVLRQLGIADDDKRVNPNGGAIALGHPLGM
                     SGARIAGTAALELSLNNGKYALATMCIGVGQGIAIALERA"
     gene            complement(599515..601242)
                     /locus_tag="BAB_RS29220"
                     /old_locus_tag="BAB2_0607"
                     /db_xref="GeneID:3828125"
     CDS             complement(599515..601242)
                     /locus_tag="BAB_RS29220"
                     /old_locus_tag="BAB2_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014489616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation pathway signal
                     protein"
                     /protein_id="WP_002975888.1"
                     /db_xref="GI:489065885"
                     /db_xref="GeneID:3828125"
                     /translation="MCLMCGPAAKTILNITRRNLLKGLGAASLTAAIPFRAESADSEP
                     GQIVFFGGPIITMEPGAEQVEAVAVTNGVISAAGSKAEILDKKATDVLLVDLKGRTLL
                     PGFIDPHMHTIFSYFEDWLDMGPFVNGSYEQIMDKLRADAKAAKPGDWVRGWQYDPSI
                     TPGAQPITLALLDEIAPNNPLFILEGNGHVTYANSKAFELAGITKDTQDPPEGRYIKD
                     KNGNLSGRIEEYPAFVPFVEKMPQVSPDEMERRVRALFDRGASNGCTAMMDCGLGLLM
                     GEQDVRTIQGVVAKDTPVRVRGALASTMYDKWVELGFKPGFGDDLFRIHAIKAWVDGS
                     NQARTGYMRDPYLNSTTRGQLNYSLEDLTATMKRSHEDGWQICVHANGDAGIDNALKA
                     YAATLQDAPRADHRHRIEHCSVLHDEQIKSMGDLGLSPSFLIGHVDYWGEAFRDDILG
                     PERANLYDRCGSARKAGLRISLHSDYNVTPIKPLQHIQTAVTRIMRANGEVLNPDERI
                     PVEAAIRAVTIDAAWQWHMDDLTGSIKAGKAADFVILEDNPLTVDPDKISQIKVSETW
                     LDGKRRYSA"
     gene            complement(601522..601949)
                     /locus_tag="BAB_RS29225"
                     /note="AsnC family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23672556"
     gene            602073..603176
                     /locus_tag="BAB_RS29230"
                     /old_locus_tag="BAB2_0610"
                     /db_xref="GeneID:3828128"
     CDS             602073..603176
                     /locus_tag="BAB_RS29230"
                     /old_locus_tag="BAB2_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="saccharopine dehydrogenase"
                     /protein_id="WP_002966005.1"
                     /db_xref="GI:489055860"
                     /db_xref="GeneID:3828128"
                     /translation="MKKIVVVGAGKIGATIADLLASTGEYAVTVVDRSQAQLDALEAG
                     AAVKTQALDIEDAKALETALAGKFAVLSAAPFHLTTRIAEAAAKAGVHYLDLTEDVAS
                     TRRVKELAKEAKTAFIPQCGLAPGFISIVAYDLAKRFDTLDSVRMRVGALPQYPSNAL
                     NYNLTWSTDGVINEYIEPCEAIVNGELTEVPALEEREEFSLDGVTYEAFNTSGGLGTL
                     CETLEGKVRTLNYRTIRYPGHVALMKALLNDLGLRHRREVLKDIFENALPTTLQDVVV
                     IFVTVSGTKNGRLVQETYANKVYAAQIGKIVRSGIQITTASAICAVLDMLAKGDLPQQ
                     GFIRQEDITLEAFLANRFGKAYAQEDHCARMVD"
     gene            603361..604134
                     /locus_tag="BAB_RS29235"
                     /old_locus_tag="BAB2_0611"
                     /db_xref="GeneID:3828129"
     CDS             603361..604134
                     /locus_tag="BAB_RS29235"
                     /old_locus_tag="BAB2_0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_002971234.1"
                     /db_xref="GI:489061194"
                     /db_xref="GeneID:3828129"
                     /translation="MLKSLVLAGLASVVLTVSVQAPVQAKEWKEIRIASEGAYPPFNY
                     MSPDGKLVGFDLDIANALCEAMEAKCTIVANDWDGMIPGLQANKFDAVIASMAITDER
                     KKQVAFTDRYYTTPLAVVVPKDSDIVSLEPSAFAGKMVGAQAGTTQGNYADDVYGKAG
                     ADVKLYPTADEANADLESGRLDALAADKFIAADWLKKQGADCCKFLGDIPGSETQIAV
                     ALRQGDDDLREQFNAAIKKIRENGTYETIRKKYFDFDIY"
     gene            604290..605051
                     /locus_tag="BAB_RS29240"
                     /old_locus_tag="BAB2_0612"
                     /db_xref="GeneID:3828130"
     CDS             604290..605051
                     /locus_tag="BAB_RS29240"
                     /old_locus_tag="BAB2_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010658897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_002966007.1"
                     /db_xref="GI:489055862"
                     /db_xref="GeneID:3828130"
                     /translation="MLKAIVFAGIASVIAVLPAQAREWKEIRIATEGAYPPFNFVASD
                     GSLQGLDVDIAKALCKAMDAKCTIVANDWDGMIPGLKSNKFDAVIASMSVTEERKKEV
                     AFTDKYYSTPLSVAVPKDSDITSVAPESFKGKTVGAQGSTTQGNYAEDVYGKAGAEVK
                     LYPTADEANADLKSGRLDAVVSDKFPISDWIKGDGADCCKLIGDIPGTQTDTAVALRL
                     GDDDLREQFNAAIKKIREDGTYATIVKKYFDFDIY"
     gene            605140..606390
                     /locus_tag="BAB_RS29245"
                     /old_locus_tag="BAB2_0613"
                     /db_xref="GeneID:3828131"
     CDS             605140..606390
                     /locus_tag="BAB_RS29245"
                     /old_locus_tag="BAB2_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006280805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid dehydrogenase"
                     /protein_id="WP_002969328.1"
                     /db_xref="GI:489059257"
                     /db_xref="GeneID:3828131"
                     /translation="MPMQQQDVIVLGAGIVGVSTALHLQARGRSVLLIDKGEPGEGTS
                     YGNAGLIERSSVIPYSFPQGLWNLLRYGMNRRSDVRYDPLYLPRIARWLFQYWRESSP
                     ERLKIATQAMLPLVEAGVREHDFLVQQAGCAKLIRAQGWIEVFRHAPAFNAAVRRLPD
                     LQRFNLSYDILDAPALRQRETALGEVAGGIHWLDPKTVVNPGGLVKAYADLFRRRGGA
                     ILRGDAASLEATGAGWQVKAQEGHVQAREAVVALGPQSGVIFRKLGYPIPLGIKRGHH
                     LHFNMKDGVRLGHTVVDEEAGYVLAPMVQGVRLSTGIEFASPSAPANRIQLKRAEEIA
                     RRLVPQLGQPVEEKPWLGLRPCLPDMRPVIGEAPRHKGLWFNFGHAHHGLTLGPASGR
                     LLAEMMTGAEPFTDPTPYSAERFS"
     gene            606799..607704
                     /locus_tag="BAB_RS29250"
                     /note="AraC family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23672557"
     gene            complement(607805..608086)
                     /locus_tag="BAB_RS29255"
                     /old_locus_tag="BAB2_0616"
                     /db_xref="GeneID:3827342"
     CDS             complement(607805..608086)
                     /locus_tag="BAB_RS29255"
                     /old_locus_tag="BAB2_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966011.1"
                     /db_xref="GI:489055866"
                     /db_xref="GeneID:3827342"
                     /translation="MTEEYTDFPRKRAIVILGRRIPMPQSVMMRRTLGGTLMVGGALG
                     FLPILGFWMLPLGLIVLSHDSHRVRRLRRRSEVHIWRKWLKRGSASQGE"
     gene            608254..608328
                     /locus_tag="BAB_RS29260"
                     /old_locus_tag="BAB2_1169"
                     /db_xref="GeneID:3827785"
     tRNA            608254..608328
                     /locus_tag="BAB_RS29260"
                     /old_locus_tag="BAB2_1169"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:608286..608288,aa:Asn,seq:gtt)
                     /db_xref="GeneID:3827785"
     gene            complement(608462..609136)
                     /locus_tag="BAB_RS29265"
                     /old_locus_tag="BAB2_0617"
                     /db_xref="GeneID:3827343"
     CDS             complement(608462..609136)
                     /locus_tag="BAB_RS29265"
                     /old_locus_tag="BAB2_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012243412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_002969330.1"
                     /db_xref="GI:489059259"
                     /db_xref="GeneID:3827343"
                     /translation="MTDIYNPSIHTRKKRVIVFDTETTGILPYDRIITLGAVKIEGGE
                     LLTQSLYLIFDPRKDSSPQAEAVHGFDNWMTRYQDLFHELAAPIRKWFSWADEVVAHN
                     AQFDMHYIQREFRKAEVDMLDQPVYCTMDGARRLWRGDSTKLDHCLAKIGLARTGHRH
                     GALEDAYLTAGLYLHQQGVAKPLPKINSWQPPKNLKPYPERPAGELPRRTPKRRSAAV
                     SACSTV"
     gene            complement(609230..609427)
                     /locus_tag="BAB_RS29270"
                     /db_xref="GeneID:23672558"
     CDS             complement(609230..609427)
                     /locus_tag="BAB_RS29270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002969331.1"
                     /db_xref="GI:489059260"
                     /db_xref="GeneID:23672558"
                     /translation="MIYPIHDQYGARIGTVMTEEGNPPQERWVAYTLHGERKAFASWD
                     AAQQWVGETASQPVRNDSPTA"
     gene            complement(609574..609762)
                     /locus_tag="BAB_RS29275"
                     /old_locus_tag="BAB2_0619"
                     /db_xref="GeneID:3827345"
     CDS             complement(609574..609762)
                     /locus_tag="BAB_RS29275"
                     /old_locus_tag="BAB2_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966014.1"
                     /db_xref="GI:489055869"
                     /db_xref="GeneID:3827345"
                     /translation="MLPQTERFNVEVEASNEAEIFELQMQQRTARLVRYGIFAAAILL
                     EILFLVFVVISHSNFFQV"
     gene            complement(609907..610212)
                     /locus_tag="BAB_RS29280"
                     /old_locus_tag="BAB2_0620"
                     /db_xref="GeneID:3827346"
     CDS             complement(609907..610212)
                     /locus_tag="BAB_RS29280"
                     /old_locus_tag="BAB2_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006133822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002971236.1"
                     /db_xref="GI:489061197"
                     /db_xref="GeneID:3827346"
                     /translation="MNVANLQLEGLCLAIAAINHALVEKGILSQLEIDEALRKAEATA
                     RGDNRFIEDLKPSNRDAICFPIRVLQIANDTGAERPWTFSELARLVGGIKEPYNDML"
     gene            610353..610730
                     /locus_tag="BAB_RS29285"
                     /old_locus_tag="BAB2_0621"
                     /db_xref="GeneID:3827347"
     CDS             610353..610730
                     /locus_tag="BAB_RS29285"
                     /old_locus_tag="BAB2_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_002968441.1"
                     /db_xref="GI:489058343"
                     /db_xref="GeneID:3827347"
                     /translation="MTRINCIPPAELTGPHLVAEYRELPRVFALVRAAIQRGEAPQDS
                     RNPQQYTLGAGHVRFFYARLGYLAKRQAALIAEMQARGYAPQFTNIEELLIGIPLEWR
                     ADWEPTAEAIAINRARIAERLRR"
     gene            611890..612351
                     /locus_tag="BAB_RS29290"
                     /db_xref="GeneID:23672559"
     CDS             611890..612351
                     /locus_tag="BAB_RS29290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_002972084.1"
                     /db_xref="GI:489062056"
                     /db_xref="GeneID:23672559"
                     /translation="MASVDPLTGLLNRRSFIQQFNAANKAGVRGWFLIVDVDYLKQIN
                     DQYGHPAGDDAIIAVAQALEDCLSSDSLIARIGGDEFCAFVPKGAINDVDSVLSDISL
                     RADGLLREKRPNVGSSLTVSVGRISCKTGQIFEEVLSIADEQLYRKKSQRQ"
     gene            complement(612617..612690)
                     /locus_tag="BAB_RS29295"
                     /old_locus_tag="BAB2_1170"
                     /db_xref="GeneID:3827787"
     tRNA            complement(612617..612690)
                     /locus_tag="BAB_RS29295"
                     /old_locus_tag="BAB2_1170"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(612656..612658),aa:Cys,seq:gca)
                     /db_xref="GeneID:3827787"
     gene            complement(612880..615069)
                     /locus_tag="BAB_RS29300"
                     /old_locus_tag="BAB2_0624"
                     /db_xref="GeneID:3827350"
     CDS             complement(612880..615069)
                     /locus_tag="BAB_RS29300"
                     /old_locus_tag="BAB2_0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_002967290.1"
                     /db_xref="GI:489057169"
                     /db_xref="GeneID:3827350"
                     /translation="MSKRSLTFALLTALSASVAFSASAEPVFNRIASFAVAENLPEGA
                     DRSKPTSSEIITVSEDGKTLIYSDSPYGAIGFIDITGPAAPKAGGLLKVEGEPTSVVV
                     AGPRVFAGVNTSESYKNPSGRLDVIDIASRKVEQSCDLDGQPDSVATSPDRKFLAVAI
                     ENERDEEFNNGELPQMPGGNLKIIELKDGKPDCAAMKTVDLTGIAEIAPEDPEPEFVA
                     FNGKNEIAVTLQENNHIAIVDAASGKILSHFSAGSVDLDKIDTKKDGQIKFNGEMKGV
                     NREPDSVKWLDDDRIVIANEGDYKGGSRGFSIFSKDGKLLHESGNTLEHRIARAGHYP
                     EKRNKKGVEIEGAEAAIFGDTHYIFAASERGSVVGVYKDTGKEPEFLQLLPSGIGPEG
                     LLAIPSRKLFVTANETDLVKDGGARSHVMIYELQDKPAAYPQIVSNLAEDGTPIGWGA
                     LSGLVADPQKDGIFYAVSDSAYYAAPTIYTIDANTKPAKITAALLVKRGKDAAQKLDL
                     EGITTDGEGGFWLANEGNQAKLVPHAILNVDEKGVIRKEVALPADLLKQQTRFGLEGI
                     TRLGEGDDAVLWMAVQREWADDDKGQVKLLAYSPKDESWKAVAYPLDAKEKGWVGLSE
                     ITAHDGNLYIIERDNLIGTEAVNKRLYKVALDGLKPVAIGAKLPVVKKTLVHDFIPDL
                     KKLNGFVPDKLEGFAITRTGNAYAVTDNDGVDGSSGETQFFSIGKID"
     gene            complement(615245..616582)
                     /locus_tag="BAB_RS29305"
                     /old_locus_tag="BAB2_0625"
                     /db_xref="GeneID:3827351"
     CDS             complement(615245..616582)
                     /locus_tag="BAB_RS29305"
                     /old_locus_tag="BAB2_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015799884.1"
                     /note="involved in translesion DNA polymerization with
                     beta clamp of polymerase III; belongs to Y family of
                     polymerases; does not contain proofreading function;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_002969333.1"
                     /db_xref="GI:489059262"
                     /db_xref="GeneID:3827351"
                     /translation="MAESPIVNHPEQGLCRDCLSLQKTQTSRRCHACGSPRLIRHKEL
                     YRLSLAHVDCDAFYASVEKRDNPDLRDKPLIVGGGKRGVVSTACYLARIHGVRSAMPM
                     FKALEACPDAVVIKPNMEKYARVGREVRQMMRDLTPLVEPISIDEAFLDLSGTERLHK
                     APPAVVLARFSKRVENEIGITASIGLSYCKYLAKVASDLEKPRGFSVIGEAEALDFLR
                     DKPVGMIWGVGKAFAAKLESDGIRTIGQLQTMEEGALMKAYGTMGQRLYRLSRGQDSR
                     KVEPDHDMKSVSAETTFNTDLSAAGDLVPVLRALSEKVSRRLKAGEIAGRTIVLKLKT
                     QDFKLRTRNRQLGDPTQLADRIFRTGLQLLEKEMDGTRFRLLGIGVSDLSPSDRADPP
                     DLVDIQATKRAVAESAIDRLRNKFGLNAVETGYTFSKGNLARTQTPTDRDNEP"
     gene            617033..617542
                     /locus_tag="BAB_RS29310"
                     /old_locus_tag="BAB2_0626"
                     /db_xref="GeneID:3827352"
     CDS             617033..617542
                     /locus_tag="BAB_RS29310"
                     /old_locus_tag="BAB2_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase regulator"
                     /protein_id="WP_002969334.1"
                     /db_xref="GI:489059263"
                     /db_xref="GeneID:3827352"
                     /translation="MNGKNRKKPNIVVSEVDYERLMGLASNASERFEEIAEELMAELD
                     RAKVVTAKRIPENVVQMGSTVEFRANDGHERRVTLVYPGEADIAKNRISILTPIGTAL
                     IGLAPGQSISWTARDGKQHELNVLKVMRTDEAAEEVRAKAGNVVAFAGRDAVGVASED
                     DNDPGPSAA"
     gene            complement(617598..617885)
                     /locus_tag="BAB_RS29315"
                     /db_xref="GeneID:23672560"
     CDS             complement(617598..617885)
                     /locus_tag="BAB_RS29315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966021.1"
                     /db_xref="GI:489055876"
                     /db_xref="GeneID:23672560"
                     /translation="MKKLMSEADAQGLAIEALAWLAQDKDLLPRFLALTGIEASSIRQ
                     AAREPGFLAGVLQFFLGHEPTLIRFCEETGHDPALFEKAVALLPGGFNQHL"
     gene            618066..618437
                     /locus_tag="BAB_RS29320"
                     /old_locus_tag="BAB2_0628"
                     /db_xref="GeneID:3828149"
     CDS             618066..618437
                     /locus_tag="BAB_RS29320"
                     /old_locus_tag="BAB2_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7BBW0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polar-differentiation response regulator DivK"
                     /protein_id="WP_002966022.1"
                     /db_xref="GI:489055877"
                     /db_xref="GeneID:3828149"
                     /translation="MTKSVMIVEDNELNMKLFRDLIEASGYETIRTRSGLEALDLARE
                     HHPDLILMDIQLPEVSGLEVTKWLKDDEELRHIPVIAVTAFAMKGDEERIRQGGCEAY
                     ISKPISVPRFIETIKSYLGDA"
     gene            618558..619928
                     /gene="pleD"
                     /locus_tag="BAB_RS29325"
                     /old_locus_tag="BAB2_0630"
                     /db_xref="GeneID:3827355"
     CDS             618558..619928
                     /gene="pleD"
                     /locus_tag="BAB_RS29325"
                     /old_locus_tag="BAB2_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966023.1"
                     /note="involved in swarmer-to-stalked cell differentiation
                     in Caulobacter crescentus; catalyzes the condensation of
                     two GTP molecules to form the secondary messenger cyclic
                     di-GMP (c-di-GMP); upon phosphorylation of domain D1 the
                     protein dimerizes; presumably this allows the two
                     GTP-bound GGDEF (diguanylate cyclase) domains to catalyze
                     the condensation reaction; allosterically inhibited by
                     c-di-GMP; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_002966023.1"
                     /db_xref="GI:489055878"
                     /db_xref="GeneID:3827355"
                     /translation="MTARILVVDDVDSNVKLLEARLLSEYYEVVPAYSGAEAIEICLD
                     GQIDIVLLDVLMPGLDGFEVCRRLKANPRTANIPVIMITCLTSPEDKVRGLEAGAEDF
                     LSKPVNDLELLSRLKSLTRLKMMSDELFQRAGRIADAEVDALLARKMAGKDGNKDEIA
                     RILVVDEDELAAARLRHILDENYRVDVASDAETALIRAIETDYDTIIVSASFTYYDPL
                     KLCTQLRTIQRTRLIPIILMVWEDEGALELGVNDYLMRPLEKIELFARLRTQIKRKCY
                     NDILRQSMERTITQSVTDGLTGLHNRRYIDMHMPLLLTRAIERKQPLSIIMIDLDHFK
                     QVNEQYGHGAGDHVLREFSGRLRRNIRGMDLISRYGGEEFVVVLPDTDRQAAFNVAER
                     VRGIVAEAPFVLDDGKRRASLTVSVGVAALRPAGDSLEALFTRATDALIQAKQSGRNR
                     IVLSAA"
     gene            complement(620035..620202)
                     /locus_tag="BAB_RS29330"
                     /old_locus_tag="BAB2_0631"
                     /db_xref="GeneID:3827837"
     CDS             complement(620035..620202)
                     /locus_tag="BAB_RS29330"
                     /old_locus_tag="BAB2_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q92QM4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_002966024.1"
                     /db_xref="GI:489055879"
                     /db_xref="GeneID:3827837"
                     /translation="MAKATTIKIKLLSTADTGFFYVTKKNSRTMTEKMTKTKYDPIAR
                     KHVEFKETKIK"
     gene            complement(620361..621503)
                     /locus_tag="BAB_RS29335"
                     /old_locus_tag="BAB2_0632"
                     /db_xref="GeneID:3827356"
     CDS             complement(620361..621503)
                     /locus_tag="BAB_RS29335"
                     /old_locus_tag="BAB2_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="WP_002968963.1"
                     /db_xref="GI:489058883"
                     /db_xref="GeneID:3827356"
                     /translation="MHWRSLAAAIATISAVGAAIGLGIPLLSVLLESRGYSASLIGAN
                     TAVAGLASIAAAPLAAPIAARLGVVKAILLMLLIGGGAFLGFHFLQPLWAWFALRVML
                     HFALTVLFVLSEYWINASAPPEKRGLVLGIYSTSLSLGFALGPWLFSKIGSTGGLPFY
                     VGFAIIMVALIPVLVAWRDSPNFEEGEHVPFLPFIFAVPTATMAVFVFGAVETGGFAL
                     FPVFGTRVGYSEADAALLLTMIGLGNMLMQIPLGIVSDRISDRRKLLLFCATTGLIGM
                     MALPYLMQHWYFMAGILFLWGGVVAGLYTVGLAHLGSELTGRELASANAAFIFCYAIG
                     MLAGPQLVGIGMDAMGPKGFPMTLGIFFAAYALFAAVRLLLRKKQS"
     gene            complement(621578..622309)
                     /locus_tag="BAB_RS29340"
                     /old_locus_tag="BAB2_0633"
                     /db_xref="GeneID:3827357"
     CDS             complement(621578..622309)
                     /locus_tag="BAB_RS29340"
                     /old_locus_tag="BAB2_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_002968964.1"
                     /db_xref="GI:489058884"
                     /db_xref="GeneID:3827357"
                     /translation="MSEPKPIPAKPRRCLRPRDAASLLLVDRSGATPRILMGRRHSSL
                     AFMPGKFVFPAGRADPADGAIAAASELSQNDTQKLLKGMGARASLRRARALGLCAIRE
                     TFEETGLRIAHPASAHIVPPKHEDWCAFLERGMLPQLDSLRYFARAVTPPGNVRRFDT
                     RFFIAFRDSLPEVETQKLVPSGELEDLDWVLIDQIEKLDLARITQAILNEATALLMDT
                     QLDLPATLPVVQYSKRHDRFVREVI"
     gene            complement(622318..622779)
                     /locus_tag="BAB_RS29345"
                     /old_locus_tag="BAB2_0634"
                     /db_xref="GeneID:3827358"
     CDS             complement(622318..622779)
                     /locus_tag="BAB_RS29345"
                     /old_locus_tag="BAB2_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966027.1"
                     /db_xref="GI:489055882"
                     /db_xref="GeneID:3827358"
                     /translation="MSTLEANSEQNIQVFGGKNPKAILPKRPVGEALWRGFRCRCPHC
                     YEGKLFRAFVKPVDKCMACGEDYTEQRADDLPAYLTILVVGHIVVGLFMGVEATTNLS
                     LWAYMAIWGPMTLIMSLLLLQPIKGSVIGLQWALYMHGFGGENESEYGDAA"
     gene            complement(622779..625130)
                     /locus_tag="BAB_RS29350"
                     /old_locus_tag="BAB2_0635"
                     /db_xref="GeneID:3827359"
     CDS             complement(622779..625130)
                     /locus_tag="BAB_RS29350"
                     /old_locus_tag="BAB2_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="WP_002966028.1"
                     /db_xref="GI:489055883"
                     /db_xref="GeneID:3827359"
                     /translation="MARRFSKSDTGRSARTERRAATAQSKDSAAFLPTREEVLKYIEE
                     NPDRAGKRELAKAFNIKGDARVYLKDLLRELADEGLVEKRARKLSRPGSLPSVAVLDI
                     TGRDEDGGLLARPAEWDEASHGKPPVVLLRRTRLNKTSESGPVVGVGDRVLAKIFRNE
                     DHAGPDFSARVMKRLEHHANAVLGVVRKLGNGKWRLEPVNRKQGEVQLDPAMLENAES
                     GDLVEVELLSARRYGLPRGKVRQVVGSIDSEKALSMIAIHEHEIPHVFPDEVLREAET
                     AGPATLEGREDWREIPLITIDPADAKDHDDAVYAESDTDPENPGGQVVIVAIADVAAY
                     VRPGSALDREAQKRGNSVYFPDRVVPMLPERISNDLCSLREMEDRPALAVRMIFSADG
                     RKKSHKFHRIMMRSAAKVAYGQAQAAIDGAPDDKTGPILDTVLKPLWNAYAVLKRGRD
                     AREPLELDLPEKKILLTPEGKVDKVIVPERLDAHKLIEEFMIQANVSAAETLEGRHQP
                     LIFRIHGEPALAKQETLREFLRTLDLNLAKGAQLQPAQFNRILAAVDGTDHQELVNQV
                     VLRTQSQAEYSPDNIGHFGLHLRRYAHFTSPIRRYADLIVHRALIKALGLGTDGLTSA
                     EEAQLEEISALISATERRAMLAERETVDRLIAHFLASHLGDEYEGRVTGVTRAGLFVN
                     LATYGADGLVPISILGDEYYLYDEANHAIAGERSGRGFRLGDTVTVRLVEALPVAGAL
                     RFEMVSEPHPLPMSTRSHHKASRAMRGRKGKPAGIPRHKRRGH"
     gene            complement(625134..627767)
                     /locus_tag="BAB_RS29355"
                     /old_locus_tag="BAB2_0636"
                     /db_xref="GeneID:3827957"
     CDS             complement(625134..627767)
                     /locus_tag="BAB_RS29355"
                     /old_locus_tag="BAB2_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014517394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_002968861.1"
                     /db_xref="GI:489058778"
                     /db_xref="GeneID:3827957"
                     /translation="MNVVVVESPAKAKTINKYLGSDYKVLASFGHVRDLPAKDGSVRP
                     DEDFAMSWEVDSNSAKRLADIVKALKDSDGLILATDPDREGEAISWHVLEVLRQKKAL
                     NGKTVKRVAFNAITKKAVLDAIAHPRDIDEPLVDAYLARRALDYLVGFTLSPVLWRKL
                     PGARSAGRVQSVALRLVCDREAEIERFVREEYWNIAALLKTPRNDSFTARLTALDGKK
                     LGKLDIKNGEQAGAIRTMLESANFKAVSVEAKPTKRNPGPPFTTSTLQQAASGQLGFS
                     ASRTMQVAQRLYEGVDIGGETAGLITYMRTDGVQIAPEAINAARDAIAKSFGAKYVPE
                     KPRYYSSKAKNAQEAHEAIRPTDFSRHPKDVRRFLDEDQARLYELIWKRAIASQMQAA
                     DIERTTVDIEATNGSRAAMLRANGSVTKFDGFLAAYMDHREEEDDDEESAKLPEIRSG
                     EALAREKIDATQHSTEPPPRYSEATLIKKMEELGIGRPSTYAATLATLRDREYIIIDK
                     RKLIPEAKGRLVTAFLESFFERYVEYDFTADLEEKLDLISDGKLSWKEILRDFWRAFS
                     GSVEDIKELRVTNVLDALNEELAPLVFPAREDGRDPRSCPTCGTGTLSLKLGRYGAFV
                     GCSNYPECKYTRQLGGEANGETAASDEPKPLGKDPFTGEQITARTGRFGPYIQRGEGK
                     EAKRASLPKGWTLDTVDHEKAIALLSLPRDIGLHPETGKMISAGIGRYGPYVSHDGTF
                     ANLENVEEVFSVGLNRAVSVLADKQSKGGGRGRSTPAALATLGDHPDGGAITVRDGRY
                     GPYVNWGKVNATLPKGKDPASVTLEEALALITEKAGSSKGRKAPARKSAASSEKKTTA
                     KKTATKKAPAKAKSKAKAAEE"
     gene            628023..628190
                     /locus_tag="BAB_RS29360"
                     /old_locus_tag="BAB2_0637"
                     /db_xref="GeneID:3827958"
     CDS             628023..628190
                     /locus_tag="BAB_RS29360"
                     /old_locus_tag="BAB2_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006192003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966030.1"
                     /db_xref="GI:489055885"
                     /db_xref="GeneID:3827958"
                     /translation="MQRRATRREMFIYIEQLIDELAKLAKQAQNPMLVYLLEMAQEEA
                     RDSIEQITAQD"
     gene            complement(628200..629381)
                     /locus_tag="BAB_RS29365"
                     /old_locus_tag="BAB2_0638"
                     /db_xref="GeneID:3827959"
     CDS             complement(628200..629381)
                     /locus_tag="BAB_RS29365"
                     /old_locus_tag="BAB2_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006016127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_002967291.1"
                     /db_xref="GI:489057170"
                     /db_xref="GeneID:3827959"
                     /translation="MKQGANPKTGIRLSDRQRLNWLRLIRTDNIGAVTFRDLILFCGS
                     ASNALEMLPDLNIRGGSARPIRIISVDEAERELEAIERMGARLIGMGEPEYPPQLKNC
                     EAPPPLVIIKGDPGVFRKPPVAIVGSRNASVVGARFTEKLAHDLGSEGFCVVSGLARG
                     IDAAAHKASLSTGTAAVLAGGLDRPYPPENLPLYRAIPENGGALITEMPMGAEPRSRD
                     FPRRNRIIAGLSLGLIVVEAAERSGSLISARMAGEMGRTVFAVPGSPLDPRARGTNLL
                     LKQGATLVTGVEDVIETLLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERD
                     LVIDALGPVPVDVDTLVRHTGIETDAIQLILLELDLAGRLLRYPGNRVAIVPCDEFTQ
                     A"
     gene            complement(629378..629983)
                     /locus_tag="BAB_RS29370"
                     /old_locus_tag="BAB2_0639"
                     /db_xref="GeneID:3827960"
     CDS             complement(629378..629983)
                     /locus_tag="BAB_RS29370"
                     /old_locus_tag="BAB2_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_002967292.1"
                     /db_xref="GI:489057171"
                     /db_xref="GeneID:3827960"
                     /translation="MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGS
                     GNIGATNVLRTGNKKLAAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPV
                     WIGFKGGKGVATYLGVLIGLAWAGALVFAAAWIVTALLTRYSSPSALVASLIVPIALY
                     SRGNQALAALFAIMTVIVFIKHRANISRLLNGTESKIGAKG"
     gene            complement(630058..631344)
                     /locus_tag="BAB_RS29375"
                     /old_locus_tag="BAB2_0640"
                     /db_xref="GeneID:3827961"
     CDS             complement(630058..631344)
                     /locus_tag="BAB_RS29375"
                     /old_locus_tag="BAB2_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019443385.1"
                     /note="Catalyzes the reversible hydrolysis of the amide
                     bond within dihydroorotate. This metabolic intermediate is
                     required for the biosynthesis of pyrimidine nucleotides;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_002966033.1"
                     /db_xref="GI:489055888"
                     /db_xref="GeneID:3827961"
                     /translation="MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAP
                     EGAEIVDLDGKAVMPGLVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMPDTDP
                     VIDDVALVEFVKRTARDTAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNT
                     IANTQIMRRALTYARDFNAVIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIP
                     LERDLRLAALTRSRYHAAQLSCAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEF
                     RTFFRLSPPLRGEEDRLAMVEAVKNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLE
                     TLLAAALRLYHNDNIPLLRLVEVLSTAPAKIFGLNAGTLKPGASADIAIVDLEEPWVV
                     REEDLHSRSKNSCFESARFQGRVVRTIVAGKTVYSA"
     gene            complement(631341..632309)
                     /gene="pyrB"
                     /locus_tag="BAB_RS29380"
                     /old_locus_tag="BAB2_0641"
                     /db_xref="GeneID:3827823"
     CDS             complement(631341..632309)
                     /gene="pyrB"
                     /locus_tag="BAB_RS29380"
                     /old_locus_tag="BAB2_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P65612.1"
                     /note="catalyzes the transfer of the carbamoyl moiety from
                     carbamoyl phosphate to L- aspartate in pyrimidine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_002966034.1"
                     /db_xref="GI:489055889"
                     /db_xref="GeneID:3827823"
                     /translation="MTNQTVSPLFPHRHLLGIKGLSPLDILCLLDLADQEIAVSRQPE
                     KKKSVLRGRTQINLFFEASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAM
                     TLNAMQPDILVIRHASAGAAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGQ
                     IENLIVAICGDVLHSRVARSNILLLNALGARVRVVAPSTLLPAGMADMSVEVFNSMEE
                     GLKDADVVMMLRLQRERMAGSFVPSVREYFHFYGLDREKLKFAKPDALVMHPGPMNRG
                     VEIASDVADGPQSVIQQQVEMGVAVRMAVMEALLDPRRNPGNGEPA"
     gene            632493..634121
                     /locus_tag="BAB_RS29385"
                     /old_locus_tag="BAB2_0642"
                     /db_xref="GeneID:3827962"
     CDS             632493..634121
                     /locus_tag="BAB_RS29385"
                     /old_locus_tag="BAB2_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_002966035.1"
                     /db_xref="GI:489055890"
                     /db_xref="GeneID:3827962"
                     /translation="MKTHEVTNQTPPITGTNAYLGDPLLMQIAARFPKELHTELEQAG
                     RFVLSAEAQDLARLANTELPKLRTHDRQGRRIDLVEYHPAYHALMRRSVAQGLHSSIW
                     EDNPLESGRRHQARAARFYLTAQLEAGHLCPLTMTSASLAALMASPEVYKQWSPAVLS
                     RKYDFSQKPAFRKQGVTLGMGMTEKQGGTDVRANATRAEPAIGGAWRLTGHKWFMSAP
                     MSDAFLTLAQTKEGLSCFLLPRLGEKGESNGFFFQRLKDKLGNRSNASSEVEFDGALG
                     QMIGSPGEGVKTIMDMVTLTRLDCAVASAGLMRSGLAEAVHHSRHRHVFGKPLVEQPL
                     MQRVLADMALDVAGATALSMRLARAFDMAASDRAEAAFARSMTPVVKYWVCKIAPALL
                     YEAMECLGGNGYIEDGNLARAYREAPVNAIWEGSGNVMALDVARVLSRAPALFDGVLD
                     WISGQLGPRGQGTIDVLRAALQLTETDQGVARLLTEQLAFAAAAAELRQLGADDIADA
                     FIETRLGGLWRTTYGMLDARHNAMRIIDQLYPAS"
     gene            complement(634106..634594)
                     /locus_tag="BAB_RS29390"
                     /old_locus_tag="BAB2_0643"
                     /db_xref="GeneID:3827963"
     CDS             complement(634106..634594)
                     /locus_tag="BAB_RS29390"
                     /old_locus_tag="BAB2_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006236364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase"
                     /protein_id="WP_002966036.1"
                     /db_xref="GI:489055891"
                     /db_xref="GeneID:3827963"
                     /translation="MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPR
                     PVIKRVKFTIDAQVLLKALETDKVGVIMIGLPMNMDGTAGPRVQATRAFVRTMQPLTD
                     LPFVFWDERLSTVAAERALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRNDYD
                     AG"
     gene            634694..635407
                     /locus_tag="BAB_RS29395"
                     /old_locus_tag="BAB2_0644"
                     /db_xref="GeneID:3827964"
     CDS             634694..635407
                     /locus_tag="BAB_RS29395"
                     /old_locus_tag="BAB2_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_002971239.1"
                     /db_xref="GI:489061200"
                     /db_xref="GeneID:3827964"
                     /translation="MKITWLGHAAFRVETAKAVILIDPFLNGNPGAKGIDFKEATRGV
                     THIALTHGHGDHVGDTVAIAREHGATVIANADLASWLGSQGVEKLDPGNTGGTLAHEG
                     FTITFVNALHSSAMLTENGVSQALGNPNGLVFHFEDSPTLYHMGDTDIFSDMALINEL
                     HQPEIGIVPIGDRFTMGGAVAALACQRYFNFNSVLPCHYASFPIIDRTADKFIAGMAD
                     HPATKVLADPAGTVHSFQA"
     gene            635502..635789
                     /locus_tag="BAB_RS29400"
                     /old_locus_tag="BAB2_0645"
                     /db_xref="GeneID:3828231"
     CDS             635502..635789
                     /locus_tag="BAB_RS29400"
                     /old_locus_tag="BAB2_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P64204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase subunit C"
                     /protein_id="WP_002966038.1"
                     /db_xref="GI:489055893"
                     /db_xref="GeneID:3828231"
                     /translation="MSVDISTVKRVAHLARIAVSEDDAERMTGELNAILGFVEQLNEV
                     DVEGIEPMTSVTPMKMRMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE"
     gene            635848..637329
                     /gene="gatA"
                     /locus_tag="BAB_RS29405"
                     /old_locus_tag="BAB2_0646"
                     /db_xref="GeneID:3828230"
     CDS             635848..637329
                     /gene="gatA"
                     /locus_tag="BAB_RS29405"
                     /old_locus_tag="BAB2_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6X562.1"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
                     /protein_id="WP_002966039.1"
                     /db_xref="GI:489055894"
                     /db_xref="GeneID:3828230"
                     /translation="MSELTALTIAEARDKLKAKAITATELTDAYLSAIDAANDAINAY
                     VAVTHDQARSMAKASDERIAKGEAGALEGIPLGVKDLFATKGVHTQACSHILDGFKPE
                     YESTVTANLWADGAVMLGKLNMDEVAMGSSNETSYYGPVKNPWRAKGSNADLVPGGSS
                     GGSAAAVAAHLCAGATATDTGGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFASSLDQA
                     GPIARDVRDAAILMKSMASLDLKDTTSVDLPVPDYEAALGRSVKGMKIGIPREYRVDG
                     MPGEIEELWQKGIQYLKDAGAEIVDISLPHTKYALPAYYIVAPAEASSNLARYDGVRY
                     GLRVPGKDIADMYEQTRAAGFGKEVKRRIMIGTYVLSAGYYDAYYLRAQKVRTLIKKD
                     FEDVFAKGVDAILTPATPSAAFGLADEVLANDPVKMYLNDIFTVTVNMAGLPGIAVPA
                     GLNGQGLPLGLQLIGRPFEEETLFQAAHVIEQAAGRFTPAKWW"
     gene            637563..637745
                     /locus_tag="BAB_RS29410"
                     /old_locus_tag="BAB2_0648"
                     /db_xref="GeneID:3827966"
     CDS             637563..637745
                     /locus_tag="BAB_RS29410"
                     /old_locus_tag="BAB2_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966041.1"
                     /db_xref="GI:489055896"
                     /db_xref="GeneID:3827966"
                     /translation="MWIMLTDVSGDKIAVNFNHVLSYNVYGTGTRLVTLSADLTFFVR
                     ESTEEIETRLGIKVRE"
     gene            complement(637751..639850)
                     /locus_tag="BAB_RS29415"
                     /old_locus_tag="BAB2_0649"
                     /db_xref="GeneID:3827967"
     CDS             complement(637751..639850)
                     /locus_tag="BAB_RS29415"
                     /old_locus_tag="BAB2_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_002966042.1"
                     /db_xref="GI:489055897"
                     /db_xref="GeneID:3827967"
                     /translation="MDDSNDLFSRVVNNARERQMERQTGENTVAQPVVQPAPSAPKPV
                     PAAAKAPPAASGGDDYNASSIRVLEGLEPVRLRPGMYIGGTDEKALHHLFAEVIDNSM
                     DEAVAGHANFIEVTVDKEGFVTVSDNGRGIPVDEHPQVPGKSTLEVIMTKLHAGGKFD
                     GKAYETSGGLHGVGVSVVNALSDVLEVEVARNRRLYRQCFSRGIPQGGLEELGEVHNR
                     RGTRVRFHPDPEIFGKNAHFDPHRLYRMARSKAYLFGGVEIRWNCDPSLLDPKKETPE
                     KAVFHFPGGLKDYLEASLGKEHQVTREVFAGRTEKQGGHGAVEWAVAWFGGDGFVHSY
                     CNTIPTGDGGTHEAGLRIALTRGLKAYAELTNNKRASIITTDDVMVSAAGMLSVFIRE
                     PEFVGQTKDKLATVEAQRLVENAIRDPFDHWLAASPQEASRLLEWVIDRADERLRRRQ
                     EKETVRKSATRKLRLPGKLADCTQNAAAGAELFIVEGDSAGGSAKQARNRANQAILPL
                     RGKILNVASAGREKLTANQQIADLVQALGCGTRKNYREDDLRYDRVIVMTDADVDGAH
                     IASLLITFFYQEMPELIRNGHLYLAVPPLYRLSQGGKTAYARDDAHKEELLRTVFTGR
                     GKIEIGRFKGLGEMRADQLKETTMDPAKRTLLRVQVDEEYGDETRNTVDDLMGTKPEA
                     RFRFIQDRAAFVEELDI"
     gene            640155..641084
                     /locus_tag="BAB_RS29420"
                     /old_locus_tag="BAB2_0650"
                     /db_xref="GeneID:3827968"
     CDS             640155..641084
                     /locus_tag="BAB_RS29420"
                     /old_locus_tag="BAB2_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002966043.1"
                     /db_xref="GI:489055898"
                     /db_xref="GeneID:3827968"
                     /translation="MPKTTGGGVEAHVKGMGFMVLSVLMLPLMDAIGKWLAMMDDLPP
                     ATATFMRFFVQCWLMFFIILVVGGLRALATSHLMGNLLRGALMGFGGLCFFTAVKYMP
                     LADAMAVFFAEPLILTLFSALFLKEKVGWRRFSAVGIGLIGTMIVIQPSFEIFGMVSL
                     LPLATAVTFAIYLILNRKYGAKESPLTMQLYAGLGGWLFVGVAMLLAADRSFDDMHFA
                     LPHSVQPWLLLLLLGTIGTVSHLIVVQAFKLAPASMLAPFQYLEIVNAVLMGLIIFGD
                     FPTPSKWLGIAIIIGSGFYVFMRESKKKTGRIS"
     gene            complement(641088..641891)
                     /locus_tag="BAB_RS29425"
                     /old_locus_tag="BAB2_0651"
                     /db_xref="GeneID:3827174"
     CDS             complement(641088..641891)
                     /locus_tag="BAB_RS29425"
                     /old_locus_tag="BAB2_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q577Y8.1"
                     /note="lipoyl/octanoyltransferase; catalyzes the transfer
                     of the lipoyl/octanoyl moiety of lipoyl/octanoyl-ACP onto
                     lipoate-dependent enzymes like pyruvate dehydrogenase and
                     the glycine cleavage system H protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octanoyltransferase"
                     /protein_id="WP_002967293.1"
                     /db_xref="GI:489057172"
                     /db_xref="GeneID:3827174"
                     /translation="MPTGKLRQKPPYAAIMTNSPVTPSTETQQPKRDALYARFLPQEA
                     DAPPVEWLIAEGLTDYEEALAFMEARVQATREGTASELVWLVEHPPLYTAGTSANAED
                     LLTPDRFPVFNTGRGGEYTYHGPGQRVAYVMLDLKRRREDVRAFVASLEQWIIETLAA
                     FNIKGERREDRVGVWVVRPEKPRLADGSMCEDKIAAIGIRLRRWVSFHGIAINVEPDL
                     SHYGGIVPCGISEHGVTSLVDLGLPVTMGDVDVALGKAFESVFGPRQTK"
     STS             641139..641811
                     /standard_name="D10Bir17"
                     /db_xref="UniSTS:141482"
     gene            complement(642019..643488)
                     /locus_tag="BAB_RS29430"
                     /old_locus_tag="BAB2_0652"
                     /db_xref="GeneID:3827969"
     CDS             complement(642019..643488)
                     /locus_tag="BAB_RS29430"
                     /old_locus_tag="BAB2_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="blue-light-activated histidine kinase"
                     /protein_id="WP_002971240.1"
                     /db_xref="GI:489061201"
                     /db_xref="GeneID:3827969"
                     /translation="MAIDLRPFIPFGRGALSQATDPFRAAVEFTLMPMLITNPHLPDN
                     PIVFANPAFLKLTGYEADEVMGRNCRFLQGHGTDPAHVRAIKSAIAAEKPIDIDIINY
                     KKSGEAFWNRLHISPVHNANGRLQHFVSSQLDVTLELSRLVELEKERKTLSIETARSK
                     DQLDYIVEVANIGFWTREFYSGKMTCSAECRRIYGFTPDEPVHFDTILDLVVLEDRMT
                     VVQKAHQAVTGEPYSIEYRIVTRLGETRWLETRAKALTGENPLVLGIVQDVTERKKAE
                     ANKALVSREIAHRFKNSMAMVQSIANQTLRNTYDPEQANRLFSERLRALSQAHDMLLK
                     ENWAGATIQQICATALAPFNSTFANRIHMSGPHLLVSDRVTVALSLAFYELATNAVKY
                     GALSNEKGVINITWAIMEDKGEKKFHMRWAESRGPEVMQPARRGFGQRLLHSVLAEEL
                     KAKCDVEFAASGLLIDVLAPITPEVFPGMGHNVPEQRIA"
     gene            643728..644228
                     /locus_tag="BAB_RS29435"
                     /old_locus_tag="BAB2_0653"
                     /db_xref="GeneID:3827970"
     CDS             643728..644228
                     /locus_tag="BAB_RS29435"
                     /old_locus_tag="BAB2_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002967296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002967296.1"
                     /db_xref="GI:489057175"
                     /db_xref="GeneID:3827970"
                     /translation="MLKSLKKVMVGMLGATFLISALAPVSAAPTMLSAPAVANENLQQ
                     VRDHRWGGGDRHWGGHRPGYRPGWQGRPGYWNGHRGYRYYRHGYRRHSDGWWYPLAAF
                     GAGAIIGGALATPPPPPPPVYPAPAYRYSNAHIQWCYNRYKSYRASDNTFQPYNGPRQ
                     QCYSPY"
     gene            644572..644647
                     /locus_tag="BAB_RS29440"
                     /old_locus_tag="BAB2_1171"
                     /db_xref="GeneID:3827792"
     tRNA            644572..644647
                     /locus_tag="BAB_RS29440"
                     /old_locus_tag="BAB2_1171"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:644605..644607,aa:Lys,seq:ttt)
                     /db_xref="GeneID:3827792"
     gene            complement(644732..645892)
                     /locus_tag="BAB_RS29445"
                     /old_locus_tag="BAB2_0654"
                     /db_xref="GeneID:3827971"
     CDS             complement(644732..645892)
                     /locus_tag="BAB_RS29445"
                     /old_locus_tag="BAB2_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014008520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor"
                     /protein_id="WP_011382435.1"
                     /db_xref="GI:499701701"
                     /db_xref="GeneID:3827971"
                     /translation="MDAMLARNIIVMPVELGPWRAALDKEDGECNYLDSDFEAIAKEA
                     LRGLDLGVYFHPVLTGIGQGATIAYAAASDSPDATIAGAVSLDPTPARTRLPSCTEKA
                     EAIKGPDGGFTYSVNAALPAPALLISPPGSPVNNPVEARRKNIAVLQTAPDFSARMKM
                     AVDNVVAMADQDAKNEALPIIDLPAKGGNADMVAVFYSGDGGWRDIDKSIGEWLQAHG
                     VHVIGVDSLRYFWSERTPEEIANDTTAMIKKADPTGKLPVAVLGYSFGADTFPFAWKY
                     LDPSIQDRTRMVGLLGVETTTTFQVSIEGWLGMNGDKDVVPAIASIPLDRVVCVYGQE
                     EDDTACTADELKGMDTMKLPGGHHFDENYEPIAAALLDKMRSRAGLPPRPAR"
     gene            complement(646141..648759)
                     /locus_tag="BAB_RS29450"
                     /old_locus_tag="BAB2_0655"
                     /db_xref="GeneID:3827972"
     CDS             complement(646141..648759)
                     /locus_tag="BAB_RS29450"
                     /old_locus_tag="BAB2_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004690208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysylphosphatidylglycerol synthetase"
                     /protein_id="WP_002966049.1"
                     /db_xref="GI:489055904"
                     /db_xref="GeneID:3827972"
                     /translation="MSLIDDEIPSSQPQVSGRHFGWLKQYQHFLFPIAGIAIALLAIY
                     DLENLLRHTSRTETLAALHNISWTTLALAVFFTALSYAAVALYDVVAVDTIAPNQIPR
                     RIAAVAGAAGYAISNALGFSLLTGGALRYRIYAAEGISLADIGKIVGTSWFAIWFALI
                     IMVGAALLIDPQDVPFLSAIDIRIDIVAGILILGGIGWLIYWLSHGERNVSIGSFSLR
                     LPNSKGALTQIFAGVVDVGAAAATLYVLLPEGAVPSFAVFALVYVIAIVLGIASHAPG
                     GLGAFEATIIAGLGLGGKPDAIAGLLAYRLIYTVLPLVVATAGILIWEVMRRRHMLDK
                     QARFAKRLVEPLVPGLSASIIFLGGIILLISGATPDMRYRVKLLSDIVPEFLVEMSHL
                     AASLVGVALLIVARGLSKRLERAWVAAMVLLLCGAVFSIAKGLDWEEASILCLFALSL
                     WGFRDSFYRRPIAGPFELSWNWIATVGTTVLVSTWLGFFVYRHIEYSSDLWWDFAWNG
                     NAPRFLRATVLVFAVVAAVGLHSIINRHGQRRRKVDHSIPDAVPALVARCPHTDAALA
                     MLGDKQFLLAPDDSAFIMYAQSGGSLIALGEPIGDAEAGKELAWSFHSLADRLALRTV
                     FYGVGPQSLPLFLDMGLIALKLGEVARVDLTDFSLEGPRRQPFRYADRKVDKDGLTFE
                     IIPAADVPPLIPRLRAISDAWLDHKSGSEKGFSLGYFNDEYLKRFDIAVLKKDGEIVA
                     FANIWRGADKYEITVDLMRYMPNVHKLLMDALFAKLLTFSKQEGYKWFNLGAAPLSGL
                     SGSRLASRWNRFGSFIYRRGADLYHFDGLKVFKEKFDPVWTPHYMVCPGGLETPRALL
                     DATTLINGSPLEFIRK"
     gene            648947..649693
                     /locus_tag="BAB_RS29455"
                     /old_locus_tag="BAB2_0656"
                     /db_xref="GeneID:3828136"
     CDS             648947..649693
                     /locus_tag="BAB_RS29455"
                     /old_locus_tag="BAB2_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_002966050.1"
                     /db_xref="GI:489055905"
                     /db_xref="GeneID:3828136"
                     /translation="MLDISYMTAAGAGALSFLSPCVLPLVPPYLCYMAGVSVEDFRAD
                     ASKATAKPSARRSLGFAALCFVLGFTTVFVALGAGASSIGAFLRTWQQQIAIVAGVVI
                     ILMGLNFLGLLRLSFLSREARFQARNAPASPLGAYIMGLAFAFGWTPCIGPVLGPILT
                     LAGGSSTVGEGALLLATYSLGLGIPFLIAALFSGAFMRFLSRFRVHLGKVEKAMGVLL
                     IIAGVVFLTGGMQSFSFWLLENFPALGRLG"
     gene            649775..651139
                     /gene="glmU"
                     /locus_tag="BAB_RS29460"
                     /old_locus_tag="BAB2_0657"
                     /db_xref="GeneID:3827973"
     CDS             649775..651139
                     /gene="glmU"
                     /locus_tag="BAB_RS29460"
                     /old_locus_tag="BAB2_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009364306.1"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein GlmU"
                     /protein_id="WP_002966051.1"
                     /db_xref="GI:489055906"
                     /db_xref="GeneID:3827973"
                     /translation="MTDRTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVR
                     GTGKSDVALVVGRGAEDVRSAVEKIAGPVSAFEQKERLGTAHAVLAAHEAIARGYDDL
                     LIVFGDTPLIEAQSLLAARERLAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEK
                     EATDEQKKIGFCNGGLMALRGQHALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTA
                     IEVPVDNVIGINNRAELAEAETIWQNRKRRELMLSGVTLIAPETVFFSYDTVIEPDVV
                     IEPNVFFGPSVHVASGALIHSFSHLEGAQVGEKAEIGPFARLRPGADLAEKSKVGNFC
                     EVKNAKVGKGAKINHLAYIGDAVIGASSNIGAGTITCNYDGYNKFKTIIGDNAFIGSN
                     SSLVAPVEIGDNAYIASGSVITADVPADALALGRARQETKEGRAKILREKYAAIKAAK
                     SVSK"
     gene            651243..653066
                     /locus_tag="BAB_RS29465"
                     /old_locus_tag="BAB2_0658"
                     /db_xref="GeneID:3827974"
     CDS             651243..653066
                     /locus_tag="BAB_RS29465"
                     /old_locus_tag="BAB2_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008510617.1"
                     /note="Catalyzes the first step in hexosamine metabolism,
                     converting fructose-6P into glucosamine-6P using glutamine
                     as a nitrogen source; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--fructose-6-phosphate aminotransferase
                     [isomerizing]"
                     /protein_id="WP_002967298.1"
                     /db_xref="GI:489057177"
                     /db_xref="GeneID:3827974"
                     /translation="MCGIIGIIGNDEVAPRLVDALKRLEYRGYDSAGIATLQNGRLDR
                     RRAEGKLVNLEKRLAGEPLPGVIGIGHTRWATHGRPVEHNAHPHITTRLAVVHNGIIE
                     NFAELRAMLEAEGRKFETETDTEAVAHLVTRELEKGKSPVEAVRDCLPHLKGAFALAF
                     LFEGDEELLIGARQGPPLAVGYGEGEMFLGSDAIALAPFTDTISYLEDGDWAVLTRNG
                     VSIYDENNKPVERPVQKSQNTNMLVSKGNHRHFMQKEMFEQPEVISHTLANYLDFTTG
                     KVRKEAIGIDFSKVDRLTITACGTAYYAATVAKYWFEQIARLPVDSDIASEFRYREMP
                     LSKDSLAMFVSQSGETADTLASLRYCKAQGLKIASVVNVTGSTIARESDAVFPTLAGP
                     EIGVASTKAFTCQLSAMASLAIAAARARGAIDEVREQELVHQLSEAPRFINQVLKLED
                     QIAAVCHDLSKVNHVLYLGRGTSFPLAMEGALKLKEISYIHAEGYAAGELKHGPIALI
                     DETMPVIVIAPSDRLYEKTVSNMQEVAARGGRIILITDKKGAESASIDTMATIVLPEV
                     PEFISPLVYALPIQMLAYHTAVLMGTDVDQPRNLAKSVTVE"
     gene            complement(653221..655329)
                     /locus_tag="BAB_RS29470"
                     /old_locus_tag="BAB2_0659"
                     /db_xref="GeneID:3827832"
     CDS             complement(653221..655329)
                     /locus_tag="BAB_RS29470"
                     /old_locus_tag="BAB2_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_032448589.1"
                     /db_xref="GI:694105706"
                     /db_xref="GeneID:3827832"
                     /translation="MRPSMLDPFFASVRSLSGIGPKVAVLLGKLLGTDVPGGEPKIGQ
                     LLFLPPHSIIDRRNRPGIAFAQEGAIVTLEVTVDQHQPAPKGRGNVPHRVFAHDDTGE
                     IALTFFHAQLPWLQKMLPEGETVIVSGKVEWFNGRASMVHPDYIASMDDAASLPLVEP
                     VYPLTAGLSPKTLGRAIKEALTRVPVLPEWIDAPLLAREGFPAFQQALNTLHQPEDPG
                     DIALESITRRRLAYDEFLAGQLALALVRAKTRRLSGRPLEGTGNIVAEIMRHLPYRLT
                     KAQEQAVREIITDLKSPQRMLRLLQGDVGSGKTVVGLLSMAHAAESGGQSALMAPTEV
                     LARQHFATIAPLAEKAGLKAALLTGREKGRERNAVLEGLKSGEIDIVIGTHALFQEKV
                     EYHDLVFVIIDEQHRFGVHQRLMLTAKGSAPDMLVMTATPIPRTLVLTAFGDMDVSKL
                     TEKPVGRQPITTAIVPMERMGELVERIRKAVSEDQKIYWICPLVEESEVVELTSAEER
                     FESLKSVFGERIGLIHGRMSGAEKDEAMRAFKQGETRLLVATTVIEVGVDVPDATIIV
                     IEHAERFGLSQLHQLRGRVGRGDKPSTCLLLYKGPLGEIAQARLKVMRETEDGFRIAE
                     EDLKLRGEGELLGTRQSGTPGFRLASIEAHGDLLEIARKDARYILASDPDLESERGQA
                     LRVLLYLFGRDEAIRLLRAG"
     gene            655480..655767
                     /locus_tag="BAB_RS29475"
                     /old_locus_tag="BAB2_0660"
                     /db_xref="GeneID:3827975"
     CDS             655480..655767
                     /locus_tag="BAB_RS29475"
                     /old_locus_tag="BAB2_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966054.1"
                     /db_xref="GI:489055909"
                     /db_xref="GeneID:3827975"
                     /translation="MTGSTMATENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVS
                     FNDDQLNEFEHILEVLDRDLLKWVTGESPIPAEYDTPLFRDIVAFRDRVEF"
     gene            655778..659290
                     /locus_tag="BAB_RS29480"
                     /old_locus_tag="BAB2_0661"
                     /db_xref="GeneID:3827180"
     CDS             655778..659290
                     /locus_tag="BAB_RS29480"
                     /old_locus_tag="BAB2_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="WP_002966055.1"
                     /db_xref="GI:489055910"
                     /db_xref="GeneID:3827180"
                     /translation="MPVFSKLGLKPGAIANKGRHIVIDGVADGFEAFCLARLVEEIGE
                     RGPIMYIVRDGQRIADLEQVLGFVSPDLPVLHLPAWDCLPYDRVSPGADAAARRLAAL
                     SALCALKKAPHPAVILTTSNAVLQKLPPQAALGEQVISARPGNQLDMNDLAARLERNG
                     FERVSTVRDIGEYAVRGGILDLYAPGAEEPLRLDFFGDTLETIRAFDPASQRTTGTRK
                     EFVLQPMSEITLSSDMISRFRKNYVAMFGAPQRDDALYQAISEGRRFAGMEHWLPLFY
                     DNLETVFDHAGPMPVVFDHLVHEALTERHTMVVDHYEARLRQAEGKEAGSDAVPYKPV
                     KPEMLYLTPGQVEEAAEAAGLRIDLTPFGAPEVSGRTIIHADVHKGRSFAEERAATDV
                     NLFEAVVKHIADLRASGKKVLVAAWTEGSLDRLCQVLDEHGLEKIETVDRLSTVKALS
                     RDKVTAAVLAVESGFDAGDLVVVAEQDILGDRLIRRSRRRKRDQDFISEVASLTAGDI
                     VVHVDHGIGRFIGLKTITAAGAPHDCLEIHYAGDDRLFLPVENIELLSRYGSEGSDAV
                     LDKLGGGAWQARKAKLKKRLLEIAGHLIQIAAERQMRGAPVMTPPDGLYAEFAARFPY
                     DETDDQLTAIEAVADDLAQGKPMDRLICGDVGFGKTEVALRAAFIAAMSGVQVAVVVP
                     TTLLSRQHFKTFSNRFHGLPINVAHASRLVGAKGLAATKKGLEEGTVDIVVGTHALLG
                     SSIKFKNLGLLIIDEEQHFGVKHKERLKELKSDVHVLTLSATPIPRTLQLALTGVREL
                     SLITTPPVDRMAVRTFVSPFDPLVIRETLLRERYRGGQSFYVVPRIADLTDIEEFLKE
                     HVPELKVAVAHGQMAPGVLDDIMNAFYDGQYDVLLSTTIVESGLDIPTANTMIVHRAD
                     MFGLAQLYQLRGRVGRSKQRAFALFTLPAGKMLTQMAERRLKVLQSLDTLGAGFQLAS
                     HDMDIRGAGNLLGEEQSGHIKEVGFELYQQMLEEAVATLKGSGEVEDSQWSPQIAIGT
                     AVMIPEAYVPDLQLRLGLYRRLADLEEPQDIDAFGAELIDRFGPMPDEVQHLLKIVYI
                     KALCRRANVEKLDAGPKGVVIQFRHATFNNPVGLVKMIGEQGSMAKIRPDQSIVFIRD
                     WPTPEKRLNGSAVIMTQLAKIAAA"
     gene            659362..659781
                     /locus_tag="BAB_RS29485"
                     /old_locus_tag="BAB2_0662"
                     /db_xref="GeneID:3828248"
     CDS             659362..659781
                     /locus_tag="BAB_RS29485"
                     /old_locus_tag="BAB2_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004687281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fosmidomycin resistance protein"
                     /protein_id="WP_002966056.1"
                     /db_xref="GI:489055911"
                     /db_xref="GeneID:3828248"
                     /translation="MVQGLSHMTFIVRDLDRMEEILTTVFDARRVYDSGAETFSLSKE
                     RFFLIGNGKEPIWIATMEGEPLPTRTNNHVAFKIANNEYEAYLKRIRALGLEVREGRS
                     RVPGEGQSIYFYDDDNHMFELHTGTLDERLKRYGQGR"
     gene            complement(659957..660631)
                     /locus_tag="BAB_RS29490"
                     /old_locus_tag="BAB2_0663"
                     /db_xref="GeneID:3828249"
     CDS             complement(659957..660631)
                     /locus_tag="BAB_RS29490"
                     /old_locus_tag="BAB2_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_002966057.1"
                     /db_xref="GI:489055912"
                     /db_xref="GeneID:3828249"
                     /translation="MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRP
                     FQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLRALGEEYGIVFDFDAIIRAPNTL
                     DAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
                     LQSEADKDTIRDEIATANPIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEP
                     GIAEDR"
     gene            complement(660810..662657)
                     /locus_tag="BAB_RS29495"
                     /old_locus_tag="BAB2_0664"
                     /db_xref="GeneID:3828250"
     CDS             complement(660810..662657)
                     /locus_tag="BAB_RS29495"
                     /old_locus_tag="BAB2_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bicyclomycin resistance protein"
                     /protein_id="WP_002967300.1"
                     /db_xref="GI:489057179"
                     /db_xref="GeneID:3828250"
                     /translation="MLNRFIAFFRSVFLIGLVATAFGALPARAANETAPDYALSMHGD
                     VALPADYTHFPYTNPDAPKKGSLTVGVVGTFDSLNPFVLKSMRTTARGLYNDGEFGNM
                     VYQTLMLRSRDEPFTLYSLLAEKVAIDPERKWVEFTLNPKAKWSDGQPVTVDDVLFTY
                     DILTEKGRPPYNSRMSRVAKIEKTGERSVRFTFNEKSDREFPMLIAGSMPVLPKHAIN
                     RDTFGNSTLEPPIGSGPYVVASVQPGQRIVYKRNPDYWGKDLPSQRGFNNFDKISIEY
                     YRNETSLFESFKKGILDIFIEGNPIRWEKLYDFPAVEQGKVIKDTFEKGTPADMLGFV
                     FNTRRPIFADRRVRQALGLLFDFEWANSNLFAGQYRRTQSFWEGAQLSSVGRPADARE
                     RELLAPFPGAVREDVMNGTWHPPVTDGSGHDRVPAKKAYDLLSQAGFQFKDGMAIDPT
                     GKPFAFEIMTRSPDEEKIALAYQRNLSRLGIAVEIHTVDDAQYQQRLQTFDYDMILGA
                     LASSLSPGNEQWLRWGSASRDVQGSFNFAGVADPAVDAMIEALLAARNRADFVSAVRA
                     LDRVLISGDYYVPLYHLPYQWVARWDRIEHPQKTPLSGYQLPAWWHTSQ"
     gene            663002..663619
                     /locus_tag="BAB_RS29500"
                     /old_locus_tag="BAB2_0665"
                     /db_xref="GeneID:3828251"
     CDS             663002..663619
                     /locus_tag="BAB_RS29500"
                     /old_locus_tag="BAB2_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002971243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="invasion protein B"
                     /protein_id="WP_002971243.1"
                     /db_xref="GI:489061204"
                     /db_xref="GeneID:3828251"
                     /translation="MSSTKTIAAASAIAGAFALLASATMPASAQQPPQGWFKVCSKQE
                     DNDICNTQNIVTADSGQLLTAVNLIEIKGKINRKIFQVTVPIGRLIPAGVGLQIDNNK
                     PVKLEYGICFPDRCIAEAPLTDELINALKKGSKLTLTSVNYQNKPNPIPVALTGFSQA
                     LTGPALKQSELEERQKELQDAVQKRQKEFEAKMKAEQDKAKGAAK"
     gene            complement(663752..664090)
                     /locus_tag="BAB_RS29505"
                     /old_locus_tag="BAB2_0666"
                     /db_xref="GeneID:3828252"
     CDS             complement(663752..664090)
                     /locus_tag="BAB_RS29505"
                     /old_locus_tag="BAB2_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966060.1"
                     /db_xref="GI:489055916"
                     /db_xref="GeneID:3828252"
                     /translation="MGMAQIKHAKYQIGQVVQHRLFPFRGVIFDVDPEFANTEEWYQN
                     IPEDARPRRDQPFYHLLAENGETEYVAYVSEQNLVPDLSGEPLRHPQIDEMFDRMDNG
                     TFRVKAQHSN"
     gene            complement(664163..665407)
                     /locus_tag="BAB_RS29510"
                     /old_locus_tag="BAB2_0667"
                     /db_xref="GeneID:3827801"
     CDS             complement(664163..665407)
                     /locus_tag="BAB_RS29510"
                     /old_locus_tag="BAB2_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006123248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_002969339.1"
                     /db_xref="GI:489059268"
                     /db_xref="GeneID:3827801"
                     /translation="MNDVVVNKPLTDIVISGGGPAGMMAALALGVRGYHTVLLGPETD
                     KTDRRTTALMMPAIRFLEQIGVWAAIEPEAAPLQSMRIVDATRRLIRSPAVMFRASEI
                     DEIAFGYNIPNAVLNAKLAEAVAASRNIRRITVPAIEYRPNGDHVTVTLKGGDTLHTR
                     LLVAADGRNSGARDAAGIRTRRWSYPQTAVVLSFSHMIDHENISTEFHTEEGPFTQVP
                     LKGRRSSLVWVVNPARAEKLLSMSDEALAVHIEEMMQSMLGKITLEVRPQAWPLSGLV
                     PHVFAAKRTILIGEAAHVFPPIGAQGLNLGTRDVETLVKAIESDSVDPGSERVMRAYD
                     RARRPDIFARTGSVDALNRSLLSSMLPAQILRGVGLEMLRSFAPLRAFFMREGLRPGS
                     GFSHLLPRLPRLPGKADDAARQ"
     gene            665707..666537
                     /locus_tag="BAB_RS29515"
                     /old_locus_tag="BAB2_0668"
                     /db_xref="GeneID:3828253"
     CDS             665707..666537
                     /locus_tag="BAB_RS29515"
                     /old_locus_tag="BAB2_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylcholine synthase"
                     /protein_id="WP_002966062.1"
                     /db_xref="GI:489055918"
                     /db_xref="GeneID:3828253"
                     /translation="MGVQKEMADSVKTKLTGKLKAKKVTAPQAKAFSVHLLTASGSFL
                     AFLSVVAASDGRYTAMWWWLGLALFVDGIDGPIARKLEVKYVLPNWSGELLDSIIDYV
                     TYVLIPAFALYQSGFMGTNLSFISGAIIVVSSAIYYADTGMKTKENFFKGFPVVWNMV
                     VFTLFIVRPGEWVAFGTVVASAILSFLPINFLHPVRVVRLRPLNLTIFLLWCAFGVIA
                     LYYMLDAPLWVRIGISVTGLYIYFIGAIMQLFPSLGREAALAKARKLVEKQQKSGEAP
                     "
     gene            666534..667250
                     /locus_tag="BAB_RS29520"
                     /old_locus_tag="BAB2_0669"
                     /db_xref="GeneID:3827824"
     CDS             666534..667250
                     /locus_tag="BAB_RS29520"
                     /old_locus_tag="BAB2_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004689000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_002966063.1"
                     /db_xref="GI:489055919"
                     /db_xref="GeneID:3827824"
                     /translation="MINAIRVHRTGGPDVLHYEQVEIGEPGPGEARVRHEAVGLNFID
                     VYFRTGLYKAAKMPFTPGNEGAGIVVAVGAGVENVRVGERVAYAATPGSYADERILPA
                     DRLVKVPDTIDLKTAASMMLKGMTAQYLLRRTFRVEPGQTILFHAAAGGVGLIAGQWA
                     KHLGATVIGTAGSEEKIALARKHGYDHVINYRSENFVERVRELTNGEGVDVVYDSVGR
                     DTYMGSLDVLKPLGMFACFG"
     gene            667328..667510
                     /locus_tag="BAB_RS29525"
                     /db_xref="GeneID:23672561"
     CDS             667328..667510
                     /locus_tag="BAB_RS29525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002972077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_002972077.1"
                     /db_xref="GI:489062048"
                     /db_xref="GeneID:23672561"
                     /translation="MFNYIARRVDLEKTTAELFDVVESGAVKIEINQTYALKDACKAH
                     EALEARKTTGTSILLP"
     gene            667614..669176
                     /locus_tag="BAB_RS29530"
                     /old_locus_tag="BAB2_0670"
                     /db_xref="GeneID:3828254"
     CDS             667614..669176
                     /locus_tag="BAB_RS29530"
                     /old_locus_tag="BAB2_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016650873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_002966064.1"
                     /db_xref="GI:489055920"
                     /db_xref="GeneID:3828254"
                     /translation="MSARSTDRPLLDVRRLTKVFGQLRACDGVDLTIAEGEIHALLGE
                     NGAGKSTFVKMLFGALQPLEGQIVWKGQGVAIHEPAAARKLGIGMVFQHFSLFDSLTA
                     AENIALSLDRSLPLAEVARRAREVGRTYGLPVDPQAHVGDLSVGERQRIEIVRCLLQQ
                     PDLIILDEPTSVLTPQEADRLFETLERLRAEGKSILYISHRLEEVKRLCDRATVLRHG
                     KVVGHCDPRKETAASLARMMVGNDIDVVARSTIAANGAGEPLFEIRAMSQPPRGPFST
                     ALKDISLCVAAGEVVGIAGVAGNGQGEFFEAISGEVLQAGASVVRIGGKDAGRLGISE
                     RRMMGAAFVPEERLGHGAVPGMTLTDNLFLSRYKTDARAFLRGGKLKLIAESALRSAT
                     KRIIERMDVRKSAENPAASALSGGNLQKFIIGREFDRAPSVMVVNQPTWGVDAGAAAH
                     IRQALVDLARSGSAVLVISQDLDELLEISDRIAVMNHGRLSDPIPIADVTLEKIGLLM
                     GGMAGETQAGAA"
     gene            669176..670258
                     /locus_tag="BAB_RS29535"
                     /old_locus_tag="BAB2_0671"
                     /db_xref="GeneID:3828255"
     CDS             669176..670258
                     /locus_tag="BAB_RS29535"
                     /old_locus_tag="BAB2_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002971245.1"
                     /db_xref="GI:489061206"
                     /db_xref="GeneID:3828255"
                     /translation="MRIELVKRPQPSRLFSALSPVLALALTLIFGGLAFLVMGKDPLH
                     ALYVFFVEPLFDIWSWHELLVKAAPLILIAVGLCVCFLSNNWNIGAEGQFIMGAIAGS
                     ILPVMFPDLESWIVLPLMMAMGMAGGAAYASIPALLKVRFNTNEILTSLMLVYVAQLF
                     LDWLVRGPWRNPEGHNFPETRQFNDSAILPEIWSASGRAHWGFIFALVAAVMVWFLLK
                     HTLKGFEVKVIGQSPRAGRFAGFSAGRMVFFVFALSGALAGLAGIAETSGAIGQLRPV
                     ISPGYGFTAIIVAFLGRLNPLGAIVAGLVLALSYLGGEAAQVAIGISEKSARVFQGMI
                     LFFVLACDTLILYRIRIVMNRQAGKA"
     gene            670263..671168
                     /locus_tag="BAB_RS29540"
                     /old_locus_tag="BAB2_0672"
                     /db_xref="GeneID:3828256"
     CDS             670263..671168
                     /locus_tag="BAB_RS29540"
                     /old_locus_tag="BAB2_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006214367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002966066.1"
                     /db_xref="GI:489055922"
                     /db_xref="GeneID:3828256"
                     /translation="MDLTQAILLTIATAATPLLIAAIGELVVERSGVLNLGVEGMMLM
                     GAVSGFAVAQITGSAWLGLVAAVLVGALFAAVFGFLTLTLVTNQVATGLALTILGVGV
                     SALLGESFVGLPGVRLNPIYIPYLTDLPLIGRFLFGQDPIFYMSIALVIGVAWFLFRT
                     RAGLTLRAIGDSHGSAHALGVHVVRTRYLAVLFGGACAGLAGAQLSLVYVPQWVENMT
                     AGRGWIALALVVFASWRPWRVLVGAVTIGQLHAQALGFGLPSQFLSALPYLATIVVLV
                     IISRNKRLTMMNTPASLGKPFVPDR"
     gene            671251..672318
                     /locus_tag="BAB_RS29545"
                     /old_locus_tag="BAB2_0673"
                     /db_xref="GeneID:3828257"
     CDS             671251..672318
                     /locus_tag="BAB_RS29545"
                     /old_locus_tag="BAB2_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_032449323.1"
                     /db_xref="GI:694106843"
                     /db_xref="GeneID:3828257"
                     /translation="MKKTLMVIATVAGFMLGGAAHAEEKLKVGFIYIGPPGDFGWTYQ
                     HDQARKELVEALGDKVETTFLENVAEGADAERSIKRIARAGNKLIFTTSFGYMDPTVK
                     VAKKFPDVKFEHATGYKTADNMSAYNARFYEGRYVQGVIAAKMSKKGIAGYIGSVPVP
                     EVVQGINSFMLGAQSVNPDFRVKVIWVNSWFDPGKEADAAKALIDQGVDIITQHTDST
                     AAIQVAHDRGIKAFGQASDMIKFAPDTQLTAVVDEWGPYYIDRAKAVLDGTWKSQNIW
                     WGMKEGLVKMAPFTNMPDDVKKLAEETEARIKSGELNPFTGPIKKQDGSEWLKAGEKA
                     DDQTLLGMNFYVAGVDDKLPQ"
     gene            complement(672458..673771)
                     /locus_tag="BAB_RS29550"
                     /old_locus_tag="BAB2_0674"
                     /db_xref="GeneID:3828258"
     CDS             complement(672458..673771)
                     /locus_tag="BAB_RS29550"
                     /old_locus_tag="BAB2_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q577W6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S12 methylthiotransferase
                     RimO"
                     /protein_id="WP_002966068.1"
                     /db_xref="GI:489055924"
                     /db_xref="GeneID:3828258"
                     /translation="MSAPRVSFVSLGCPKALVDSERIITGLRSEGYEISRKHDGADLV
                     IVNTCGFLDSARDESLEAIGLALNENGKVIVTGCLGAEPDVIRERHPNVLAITGPQAY
                     ESVMNAVHEVAPPAHDPFVDLVPPQGVKLTPRHYAYLKISEGCSNRCSFCIIPALRGD
                     LVSRPINEVLREAEKLVQAGVKEILVISQDTSAYGLDIKYQEAMWQDRTVRTKFLDLS
                     RELGEMGVWVRMHYVYPYPHVDEVIPLMAEGKILPYLDIPFQHASPAVLKNMRRPAHQ
                     EKTSRRIQAWRETCPDLAVRSTFIVGYPGETEEDFQMLLDWLDEAKIERAGCFKYEAV
                     KGAKANDLGLEQVPEEVKEARWHRFMAKQQQISTNLLKKKVGKRLPVIIDEANGTIGK
                     GRTRYDAPEIDGSVHISSRRPLRVGDIVTVKIEASDAYDLHGTAV"
     gene            complement(673935..674420)
                     /locus_tag="BAB_RS29555"
                     /old_locus_tag="BAB2_0675"
                     /db_xref="GeneID:3828133"
     CDS             complement(673935..674420)
                     /locus_tag="BAB_RS29555"
                     /old_locus_tag="BAB2_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019444232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_002966069.1"
                     /db_xref="GI:489055925"
                     /db_xref="GeneID:3828133"
                     /translation="MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKE
                     REESIEEMHHADKLIDRIIFLEGFPNLQTVSPLRIGQNVKEVLEADLKGEYDARASYK
                     ESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAPADEA
                     E"
     gene            complement(674386..674697)
                     /locus_tag="BAB_RS29560"
                     /old_locus_tag="BAB2_0676"
                     /db_xref="GeneID:3828259"
     CDS             complement(674386..674697)
                     /locus_tag="BAB_RS29560"
                     /old_locus_tag="BAB2_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966070.1"
                     /db_xref="GI:489055926"
                     /db_xref="GeneID:3828259"
                     /translation="MLVCSCNIITEKEIEDTIIELLDEDCWQLIVPGTVYNAMNQRGR
                     CCGCFPNVVETIIRVTEEYYLRRNQMDENVIQFMDRVRSLRDKFGSSWNERRTKGHRA
                     A"
     gene            complement(675153..675467)
                     /locus_tag="BAB_RS29565"
                     /old_locus_tag="BAB2_0677"
                     /db_xref="GeneID:3828260"
     CDS             complement(675153..675467)
                     /locus_tag="BAB_RS29565"
                     /old_locus_tag="BAB2_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_002966072.1"
                     /db_xref="GI:489055928"
                     /db_xref="GeneID:3828260"
                     /translation="MFIAMNRFKVRIGSETDFETVWKNRDSQLSDVPGFESFHLLRGA
                     TNEDEGYTLYASHTVWRSQEDFIGWTRSEQFRHAHRNAGENKPLYLGPPQFEGFTAVL
                     GQ"
     gene            complement(675584..676045)
                     /locus_tag="BAB_RS29570"
                     /old_locus_tag="BAB2_0678"
                     /db_xref="GeneID:3828261"
     CDS             complement(675584..676045)
                     /locus_tag="BAB_RS29570"
                     /old_locus_tag="BAB2_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_002966073.1"
                     /db_xref="GI:489055929"
                     /db_xref="GeneID:3828261"
                     /translation="MRLTRQTNYAIRMLMYCAANDGKLSRIPEIARAYNVSELFLFKI
                     LQPLVEHGLVETVRGRNGGVRLGRASQDISLFDVVRVTEENFSMAECFENDASECPLV
                     DSCGLNAALREALNAFFAVLMKYSIADLVKARPNVRLLLGLDEMEAPRIAR"
     gene            complement(676291..676749)
                     /locus_tag="BAB_RS29575"
                     /old_locus_tag="BAB2_0679"
                     /db_xref="GeneID:3828262"
     CDS             complement(676291..676749)
                     /locus_tag="BAB_RS29575"
                     /old_locus_tag="BAB2_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="WP_002966074.1"
                     /db_xref="GI:489055931"
                     /db_xref="GeneID:3828262"
                     /translation="MSLESVKAFFASKAPEVEVIELPTSTATVALAAEAHGVEPGQIA
                     KTLSFSTKDQTILIVTRGDARIDNRKFKDRFGTKPRMLDAQTVLAETSHPVGGVCPFG
                     LPGALPVFCDISLKTYDEVVPAAGATNSAVRIAPQKMADLVEAEWVDVCQ"
     gene            677008..677097
                     /locus_tag="BAB_RS29580"
                     /old_locus_tag="BAB2_1172"
                     /db_xref="GeneID:3827794"
     tRNA            677008..677097
                     /locus_tag="BAB_RS29580"
                     /old_locus_tag="BAB2_1172"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:677042..677044,aa:Ser,seq:tga)
                     /db_xref="GeneID:3827794"
     gene            complement(677222..677629)
                     /locus_tag="BAB_RS29585"
                     /old_locus_tag="BAB2_0680"
                     /db_xref="GeneID:3828263"
     CDS             complement(677222..677629)
                     /locus_tag="BAB_RS29585"
                     /old_locus_tag="BAB2_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972070.1"
                     /db_xref="GI:489062041"
                     /db_xref="GeneID:3828263"
                     /translation="MSNIETIFSSGLDQLMTFSIGASAGIVGLALAKRGVEYAKSFVG
                     FSDPFSYVHSIDGVESGDFDGFSLRYNGMYFEDESELNDYLLDQNDPDREANWQAYLR
                     DIGYYESSGVDSYIREALANDSASAYDDHEQSF"
     gene            677976..678299
                     /locus_tag="BAB_RS29590"
                     /db_xref="GeneID:23672562"
     CDS             677976..678299
                     /locus_tag="BAB_RS29590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002970678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002970678.1"
                     /db_xref="GI:489060624"
                     /db_xref="GeneID:23672562"
                     /translation="MKIKLKTSIFYSKTRRNNGGLMRKFIALALVAIAAAPLISAMFS
                     DMSNDVRTVNKLKQSKTLSEKAIIEERDKMYKNVCKIYFSQSYFGKMTTGRNQSWCEE
                     YKDRM"
     gene            678396..678758
                     /locus_tag="BAB_RS29595"
                     /old_locus_tag="BAB2_0681"
                     /db_xref="GeneID:3828264"
     CDS             678396..678758
                     /locus_tag="BAB_RS29595"
                     /old_locus_tag="BAB2_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006091779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002972068.1"
                     /db_xref="GI:489062039"
                     /db_xref="GeneID:3828264"
                     /translation="MTRRRYELTAHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFR
                     TGSPWAEVPERYGPPTACYNRFVRWRKAGVWDRLFETVPKAYDGDIVMIDSTCVRVHQ
                     HAATGKKGMETMVAWDVP"
     gene            678839..679306
                     /locus_tag="BAB_RS29600"
                     /old_locus_tag="BAB2_0682"
                     /db_xref="GeneID:3828265"
     CDS             678839..679306
                     /locus_tag="BAB_RS29600"
                     /old_locus_tag="BAB2_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006073679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002966076.1"
                     /db_xref="GI:489055933"
                     /db_xref="GeneID:3828265"
                     /translation="MDLGSVDVDEKASPHSADDRHQHYAVSKVVDDRPAPRRVEVLLG
                     KERRRRWSADEKAEITAASFVPGANISAVARQYGVSQGLLHYWRRCAREHMSDDEEMR
                     FVPVVRADEGLGVPAAVTALTIRVEINGTCAVIEGSIDEQALCMVFKALRASA"
     gene            679303..679656
                     /locus_tag="BAB_RS29605"
                     /old_locus_tag="BAB2_0683"
                     /db_xref="GeneID:3828266"
     CDS             679303..679656
                     /locus_tag="BAB_RS29605"
                     /old_locus_tag="BAB2_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004681878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966077.1"
                     /db_xref="GI:489055934"
                     /db_xref="GeneID:3828266"
                     /translation="MISLGSDLRIMIASKPVDFRKGINGLAALVSTALGANPYSGDIY
                     VFRSKRNDRLKMVVWDGSGMVLLTKVLEDRRFIWPAVHAGAVRLSASELALLLDGLDW
                     TRVEKKPVKRPAKTA"
     gene            679706..681277
                     /locus_tag="BAB_RS29610"
                     /old_locus_tag="BAB2_0684"
                     /db_xref="GeneID:3828267"
     CDS             679706..681277
                     /locus_tag="BAB_RS29610"
                     /old_locus_tag="BAB2_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002969340.1"
                     /db_xref="GI:489059269"
                     /db_xref="GeneID:3828267"
                     /translation="MLNRGQHLPRDPDILVGMILERDAEIERLKVLLKAANAKPFGQR
                     SEQLAHMVEKQIRFDLGDVVHEPEVASASEGAGLPKMPRQASAHSRPRRNIGALPEHL
                     ERVVEVIEPSSLECACCQGKLHCIGEDESEVLASRPATLYVLRTVRPKYACRACEAGI
                     VQAKAKPRLFDGGLATTSMISNVVVWRYAWYLPLNRQVQMLKGQGVRLDTSTLCSWVK
                     RSAWWLKSLYDKLLAYIHSHSRVFVDETRMPVLKRDRTRTKICQFWAHAVDDRPWNGP
                     AYPAVAYVFAQGRGKTEIQSQLVRYSGILQVDAYKAYKSLTRPDRRAGSIALAYCLAH
                     ARRKFVDVFKKYKSELAKVVIERLAEVYAIEASIRSTSAEHRLGVRQAKSKVLMADLK
                     MLLMDTLKDISAKDPVASAIKYTLGHWAGLTLFLEDGRLEVDSNTVERNMRSVALGRV
                     NSLFAGSDGGAETWAILGSLLTTAKLNGLDPYTWLNDVLERIVSGEIKSTSLWRCLPW
                     HWKQEHADMNMAVAA"
     gene            681274..681879
                     /locus_tag="BAB_RS29615"
                     /old_locus_tag="BAB2_0685"
                     /db_xref="GeneID:3827476"
     CDS             681274..681879
                     /locus_tag="BAB_RS29615"
                     /old_locus_tag="BAB2_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006260663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002966079.1"
                     /db_xref="GI:489055936"
                     /db_xref="GeneID:3827476"
                     /translation="MKAPKRAKLLTLDQLETWFDKAEPAPPCRGVSTLNGFLTGLAAG
                     PVFLLPNDWMFHVIGKHEEKAFVGNKTYAVIETIVDHYNLIAHQLTAPGRYAPMFMRT
                     DDEEVLPGDWADGFYGAIKLNLAAWAPLMAEKQTGDPIMAILMQATEPDLLEMVSAVY
                     PKPPEAILKDAWRAIPTAIETIYAHCKPMRFNPGAPANDIS"
     gene            complement(682018..682353)
                     /locus_tag="BAB_RS29620"
                     /db_xref="GeneID:23672563"
     CDS             complement(682018..682353)
                     /locus_tag="BAB_RS29620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016769612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016769612.1"
                     /db_xref="GI:515140883"
                     /db_xref="GeneID:23672563"
                     /translation="MAPYSCCDELYGCEVVFRALIISGCDASELLDPVEEALHEIALP
                     IDPARKHERALAIALRRDVGPGLSRGGLSPNGIRVIPLVGQQDVSLTKLIRQRVGFGT
                     IGDLSTSQT"
     gene            682822..684045
                     /locus_tag="BAB_RS29625"
                     /old_locus_tag="BAB2_0687"
                     /db_xref="GeneID:3827478"
     CDS             682822..684045
                     /locus_tag="BAB_RS29625"
                     /old_locus_tag="BAB2_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011265414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_002972062.1"
                     /db_xref="GI:489062033"
                     /db_xref="GeneID:3827478"
                     /translation="MAADDGSQFVERRRWPRVSQAPLGEGLTASPALVPLRFETSSLP
                     TDQQFAAWQAHMSVLLTTHLPESAQPDDGFSVTQHVWNLDGILIVQQDTSAFHFERSA
                     NEVRFSPIDHWMITIMRSGQSWTGMNGQVVENHPGLVEIRSLGQPFSGRTLAASSTSL
                     IIPADAFADRGGLPITCNNVALGGHRAQLLIGYLTSVEASLGKLAQGDLAGVKANLRE
                     LVFDAIAPLVEHIDEKDNVSQIALMTKARRFIQNNLASPDLTPDALGRELALSRTRLY
                     ELFETFGGVANYIRRRRMLAAHAMLADPADTRKVAEVGEVIGFDSAANFSRAFTHQFG
                     YSPSNIRKQTATGAPATRLIYHRRLRSKAYCSRLAFSDLFFPAFFFMSAEPPKSIEFT
                     ENFHDSSANCLNYEC"
     gene            684129..684311
                     /locus_tag="BAB_RS29630"
                     /db_xref="GeneID:23672564"
     CDS             684129..684311
                     /locus_tag="BAB_RS29630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966081.1"
                     /db_xref="GI:489055938"
                     /db_xref="GeneID:23672564"
                     /translation="MVYLAKYRVNGDVRYSKQPRGKLMRVSVSQNRTSNSYVCTPSGF
                     GQKSHCHTANQIKEYF"
     gene            complement(684428..684925)
                     /locus_tag="BAB_RS29635"
                     /old_locus_tag="BAB2_0689"
                     /db_xref="GeneID:3827480"
     CDS             complement(684428..684925)
                     /locus_tag="BAB_RS29635"
                     /old_locus_tag="BAB2_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002972060.1"
                     /db_xref="GI:489062031"
                     /db_xref="GeneID:3827480"
                     /translation="MMSSIRFSIAGAAFSVLLLTGAAGAAPGTEADIAVQKMALAAAP
                     MSAAALEQLYGGRTWRWNDGGGYFSTKKHRFTAVTRKGTARSFATGRWFATDGGKLCM
                     KAYWSNAGGGSGAITCFLHREQDGVVYQKPNLGGQWYVFRHNPVQKDDEARKLLRGDR
                     IRQGR"
     gene            complement(685042..685986)
                     /locus_tag="BAB_RS29640"
                     /old_locus_tag="BAB2_0690"
                     /db_xref="GeneID:3827481"
     CDS             complement(685042..685986)
                     /locus_tag="BAB_RS29640"
                     /old_locus_tag="BAB2_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002968418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannan endo-1,4-beta-mannosidase"
                     /protein_id="WP_002968418.1"
                     /db_xref="GI:489058320"
                     /db_xref="GeneID:3827481"
                     /translation="MKRLLKVSAALLCGTMVCGAVYAASGVSGANVDTRNIFQDKRPV
                     ITANSVTPGAYDPHGDYTNDPNSKIEHLFLPWEDVDLTSLHAADAYARERGRSLLITI
                     EPWSWARDWRVGPEDLLSGILNGRYDSNMAAVCSEAAKLKSPVTIRWAQEMEDDAGQF
                     TWAFWKPEGYVKAYRHVIDVCRKSLPSARYMWSPKGEEGLEAYYPGDNYVDIIGLSVF
                     GYQPFDQLEVGRDTTFVERTKPGYDRVARFNKPIAIAELGYEGDDDYVRAWAAEANKP
                     HAEFPAMIAVVYFNDREVYPWPRDVGRPDWRVANHPLD"
     gene            complement(686036..686581)
                     /locus_tag="BAB_RS29645"
                     /old_locus_tag="BAB2_0691"
                     /db_xref="GeneID:3827482"
     CDS             complement(686036..686581)
                     /locus_tag="BAB_RS29645"
                     /old_locus_tag="BAB2_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004686081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966084.1"
                     /db_xref="GI:489055941"
                     /db_xref="GeneID:3827482"
                     /translation="MTFKPEKAFHAFVALPTVTILLMATTAFAGPVASAPQASETPTG
                     TRVMTAMELYTLYRNKSWQWTDGAGYMTGKDRSFAAWVDGPNGKSWGEGRWVITDTGR
                     MCLKANWYTKKGVFPAETCFEHRIGDGSIYQRREPDGTWYVFRHDPMQDGDEAQKLVS
                     ADLVSAHREEMKAALAAIPVK"
     gene            complement(686571..687995)
                     /locus_tag="BAB_RS29650"
                     /old_locus_tag="BAB2_0692"
                     /db_xref="GeneID:3827692"
     CDS             complement(686571..687995)
                     /locus_tag="BAB_RS29650"
                     /old_locus_tag="BAB2_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_002967301.1"
                     /db_xref="GI:489057180"
                     /db_xref="GeneID:3827692"
                     /translation="MKIAVIGTGYVGLVSGTCFAAWGHEVVCVDKNARKIAVLERGIL
                     PIYEPGLDELVERNCAEGRLRFTCNLAEAVRGAEMVFIAVGTPPRAGHGDADLSFVYM
                     AARELAPLIDENAVVVVKSTVPVGTGDIVQKLIGSVRRAGTFSVASNPEFLREGVAIR
                     DFLYPDRVVIGVEDERARKALLDLYGTPLKEQKTPIVVTQRRTSELIKYAANAFLATK
                     ITFINELADLCEHVGSDVSQLALGIGLDKRIGESFLNAGPGYGGSCFPKDTLALLRTA
                     QDHGVALRIVEETVTANEARKRRMALKVLDALGGDVEGLTIAVMGLTFKPDTDDMRDA
                     PSVPLIETLQRFGARIRAYDPIGAENARNILSDVELCDDPYECVRAADAMVVITEWDS
                     IRRLDLSRVRQAMRQPVLIDLRNAYEPNVAENLGFRVSAVGRAATARHETSIKDALSL
                     LASRSRRADSAEELVPEGGGSNDL"
     gene            complement(688010..689854)
                     /locus_tag="BAB_RS29655"
                     /old_locus_tag="BAB2_0693"
                     /db_xref="GeneID:3827483"
     CDS             complement(688010..689854)
                     /locus_tag="BAB_RS29655"
                     /old_locus_tag="BAB2_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004688989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_002966086.1"
                     /db_xref="GI:489055943"
                     /db_xref="GeneID:3827483"
                     /translation="MKMRSTDSRADQVSAWAPVFGGWRRVEYLLGAGVWVAAIIYFWH
                     WWLQPANHTYLVGSILVTAILAWVTLLPAYFIFLFFRARRPVGPLNLPAGSRIAMVVT
                     KAPSEPFGVMAETLRAMLAQNVPHDTWLADEDPSPETLAWCREHGVFVSTRRGRADYH
                     LHTWPRRTRCKEGNLAFFYDHYGYERYDFVAQLDADHVPTEGYLFEMLRPFADPAIGY
                     VSAPSICDRNAHESWSARGRLYAEASMHGSLQAGYNNGLAPLCIGSHYAVRTVALREI
                     GGLGPELAEDHSTTLMMNAGGWRGAHALDAIAHGDGPRTFADLVTQEFQWSRSLVMIL
                     LQYSPRLVRTLPFRMKFQFLFSQFWYPLFSAFMALMFMLPIIALVAGQNFVAVTYPDF
                     LAHFVPQAVILILLAYRWRASGTFRPFDAKILSFEATLFLFARWPWALAGTLAALRDW
                     ATGSFVDFRVTPKGASEVDPLPLRVLAPYGVMAILSIMPVLLIRDASESSRGFYIFAI
                     MNALAYVVLLLVIIVQHARENTVRYRMRFYQPALAASLLALMALPAVATVERGRDGIV
                     ALSWGTRSFSLFDDRFSVAGAGIGGRDIHKVIFNPHWRVGATGNPDQK"
     gene            complement(689851..690837)
                     /locus_tag="BAB_RS29660"
                     /old_locus_tag="BAB2_0694"
                     /db_xref="GeneID:3828228"
     CDS             complement(689851..690837)
                     /locus_tag="BAB_RS29660"
                     /old_locus_tag="BAB2_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_002966087.1"
                     /db_xref="GI:489055944"
                     /db_xref="GeneID:3828228"
                     /translation="MSANNVLVVGGAGFIGSHTAKLLAGQGYAPVVYDNLSTGHQSAV
                     RWGDFVEGDILDQARLVETMEKYAPVAVIHFAASAYVGESVEDPAKYYRNNVGGTQSL
                     LDACRLTRTQNVIFSSSCATYGVPSRLPIGEGEAQNPINPYGRTKLIAEHMLADYAVA
                     YGLRYVALRYFNASGADIDGELGEKHDPETHLIPRAMMAAAGRLDVLEVYGDDYETPD
                     GTCIRDYIHVTDLARAHVLAVEHLKEAGGNLAVNLGTGRGTSIREIVQSIGRLTGRSV
                     PVAMRARRAGDPPALYADPALAAEKLGFHTVYSDLDTIIRTAAPHFGLEVRG"
     gene            complement(690837..691850)
                     /locus_tag="BAB_RS29665"
                     /old_locus_tag="BAB2_0695"
                     /db_xref="GeneID:3827484"
     CDS             complement(690837..691850)
                     /locus_tag="BAB_RS29665"
                     /old_locus_tag="BAB2_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006223432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_002968869.1"
                     /db_xref="GI:489058786"
                     /db_xref="GeneID:3827484"
                     /translation="MGAIFNSLTSNTIEKARRHVLVAGGAGFLGSHLCERLLNEGHSV
                     ICVDNFSTGRIENIRHLLNFDGFSFIRHDIVNTLDLRVDEIYNLACPASPPHYQADPV
                     HTMKTNVIGSLNLLELAAHYKARIFQASTSEVYGDPHVHPRPENYWGNVNSFGPRSCY
                     DEGKRSAETLFHDFHQQYGVDIRIVRIFNTYGPRMRPDDGRVVSNFIVQALKGEDITV
                     YGDGSQTRSFCYVDDLIEGFHRLMYSPHAIRVPVNIGNPGEFTVGALAEQIIAMTGSR
                     SRIVYYPLPVDDPRQRRPDITVAKRELGWEPTVALAQGLEPTIAYFEHQLRKPTGKLV
                     EAA"
     gene            692644..692991
                     /locus_tag="BAB_RS29670"
                     /old_locus_tag="BAB2_0697"
                     /db_xref="GeneID:3827486"
     CDS             692644..692991
                     /locus_tag="BAB_RS29670"
                     /old_locus_tag="BAB2_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002966091.1"
                     /db_xref="GI:489055948"
                     /db_xref="GeneID:3827486"
                     /translation="MFKKTLIAAIAFSFVGASFAQAQDWRPQHGQHKVEPRRPMPPHK
                     FERNDRRDYGKHNRWSKGQRYNDWRRHQEIRDYKRYGLRAPARGQRWIKVDDQFLLIT
                     AATGLIVGVLAGR"
     gene            693418..694995
                     /locus_tag="BAB_RS29675"
                     /old_locus_tag="BAB2_0699"
                     /db_xref="GeneID:3827488"
     CDS             693418..694995
                     /locus_tag="BAB_RS29675"
                     /old_locus_tag="BAB2_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019298781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002967303.1"
                     /db_xref="GI:489057182"
                     /db_xref="GeneID:3827488"
                     /translation="MYRKFLLMGVCLLALAGAASAEAVLNRGNDTDPATLDHHHTSTV
                     AEGNVLRDLYDGLTIQDADGKAIPGVAKSWDISEDGTVYTFHLRDNAKWSNGDPVTAG
                     DFQFTFRRLMDPKTAAGYASMLFIIKNAEDAAAGKKPVDQLGVEAVDDHTLKITLNSP
                     APYFLELLTHQTGFPLHQKSVEANGDKFTTPGKMVTNGAYMLESFTPNDKIVMKKNPY
                     YYEADQVKIDKVNWIPFEDRASCMRRFEAKEVQICSDVPAEQMDYVKKNLSKEFRMAP
                     YLGVYYLPVKGKTADSKLKDPRVRQAISMAIDRDFLADQVWQGTMIPGYSMVPPGIAN
                     YVKDAPKLDYSDDMLEREDKAKELLKEAGVEPNTLSIELLYNTSENNKNTMAAIADQL
                     GNIGIKARLNETEGASYFNFLREDGPFDIARASWIGDYNDPQNFLYISQGNVSFNYAK
                     WKNADYDALMAKAEKTQDLGERANILADAAKIQLNELGAIPILYYSSLALVSSDVDGW
                     NDNLMNSHKTRWLSLKK"
     gene            695105..696682
                     /locus_tag="BAB_RS29680"
                     /old_locus_tag="BAB2_0700"
                     /db_xref="GeneID:3827489"
     CDS             695105..696682
                     /locus_tag="BAB_RS29680"
                     /old_locus_tag="BAB2_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017403533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_002966094.1"
                     /db_xref="GI:489055951"
                     /db_xref="GeneID:3827489"
                     /translation="MVRGILMTGICLLALNSAASAQTVLNRGNDTDPATLDQHHTSTV
                     SENRVLRDLYEGLLAQNAKGEAIPGAASSWDISEDGKVYTFHMRDGAKWSNGDPVTAG
                     DFEFSFRRIMDPKTAAGYASVLYAIQNGEEVATGKMPVDQLGVKALDDKTLQITLKSP
                     APYFLELLTHQTGFPVNKKAVEKFGDKFTLPGNLVTNGPYQLVSFVPNDKIVMKKNPN
                     YWDAENVKIDTVNWMPFEDRSSCMRRFEAKEVDICSDVSAEQMDYVKKNLSKEFRLAP
                     YLGIYYVDIKGEPSSKLRDPRVRRAISLAADREFMADEVWRGVMLPAYSMVPPGIANY
                     VKDAPKLDFANEDILDREDKAKELLKEAGVEPNTLSVTLRYNTSENHKNTMAAFANML
                     KNIGINAKLDEVEGTTYFNYLQEKGMFDLTRDGWIGDYNDPNSFLELYTTGNYFNYAE
                     WSNKDYDALMDKSAVTTDLAERAKILAEAEEILLKEGAIVPLMYYSSTALVADRVQGY
                     DDNLMNSHGTRWLSVKN"
     STS             696554..698121
                     /standard_name="D1S3694"
                     /db_xref="UniSTS:474272"
     gene            696897..697820
                     /locus_tag="BAB_RS29685"
                     /old_locus_tag="BAB2_0701"
                     /db_xref="GeneID:3827490"
     CDS             696897..697820
                     /locus_tag="BAB_RS29685"
                     /old_locus_tag="BAB2_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008936843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_002966095.1"
                     /db_xref="GI:489055952"
                     /db_xref="GeneID:3827490"
                     /translation="MLGYTLRRLGSAIPTIFIIITLTFFLIRLAPGGPFDLERPIDPL
                     ILENLKKAYNMDAPLWQQYLIYLGNLLHGDLGPSFTRRDFTVNDLFASGLPVSIILGT
                     LGLTLAAIIGTFLGTLAALKQNSATDYFVVALATFGITTPNFVVAPLLSLLFGVILGW
                     VPAGGWSSANVAYWILPVLTLALPQVGVIARLVRGATIEALRANHVRTARAYGLPSRV
                     VVGIHALRAAMLPAVSYLGPTAAALLTGSVVVETIFGIPGIGRYFVQGALSRDYTLVM
                     GTVVVISIFVVVFNLIVDLLYAWLDPRVRYD"
     gene            697813..698946
                     /locus_tag="BAB_RS29690"
                     /old_locus_tag="BAB2_0702"
                     /db_xref="GeneID:3827491"
     CDS             697813..698946
                     /locus_tag="BAB_RS29690"
                     /old_locus_tag="BAB2_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_002966096.1"
                     /db_xref="GI:489055953"
                     /db_xref="GeneID:3827491"
                     /translation="MTDLTVPTETAELSMPSRSLWQDAFLRLRKNKAAVTSAIVLVLM
                     ALIGIFGPLLSPHPYDKIYPQFVRVAPSLEAYPRADTIMPGLEQVLARARLKAAGEPE
                     LTGNQLVLNVTAQRPTDERVLRYFQRSDLFSNPKIELAPDGLSGKLTMNVSRNYFLLG
                     TDNLGRDLMTRIFIGVRMSLAIGLLASAMALVLGVGYGTISGYLGGRVDNVMMRLVDI
                     LYSLPFIFFVILMLVFFGRSIFIIFIAIGATEWLDMARIVRGQTLSLKRQEFVQAAEA
                     LGATRSGVITRHIIPNALGPVIVFVTLLVPKAILLESLLSFLGLGVQDPLTSLGLLIS
                     EGAQNMRGASWQLIWPAATLTIILFALNFVGDGLRDSLDPKDR"
     gene            698948..700558
                     /locus_tag="BAB_RS29695"
                     /old_locus_tag="BAB2_0703"
                     /db_xref="GeneID:3827492"
     CDS             698948..700558
                     /locus_tag="BAB_RS29695"
                     /old_locus_tag="BAB2_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014315865.1"
                     /note="with YejAEF is involved in resistance to microcin
                     C; Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_002966097.1"
                     /db_xref="GI:489055954"
                     /db_xref="GeneID:3827492"
                     /translation="MTTENILSVRDLRVTFDTHDGPVQAVRGINLDVKAGETIAIVGE
                     SGSGKSQTTMAMMGLLAQNGKATGQALYRGQDLIGLSEKELNKIRGAKITMIFQEPMT
                     SLDPLYRIGDQLAEPLRYHRGLSKKDARPRILELLKLVGIPEPERRIDSYPYELSGGQ
                     RQRVMIAMALANEPDILIADEPTTALDVTIQAQILDLLADLQKRLGMAVVFITHDLGI
                     VRRFADRVYVMRSGEVVETGVTEKLFTAPEHPYTRMLLDAEPEGEKAPPPDDSPVLIR
                     ADNVKVNFLINKPWIGAANYLTAVNDVSLTLKEGQTIGIVGESGSGKSTLGRAILRLI
                     ESEGRIAYLGQELPRESQAMRAKRRELQLVFQDPFGSLSPRMTIGRIITEGLLIHEPQ
                     LSAKDRDRRAQEALREVGMDPAMRNRYPHEFSGGQRQRIAIARTMILKPRVIVLDEPT
                     SALDRSVQKQIVTLLRDLQKDHGLSYLFISHDMAVVRAVSDYVIVMKNGKIVEQGDTE
                     QVFDHPREEYTKALMAAALSEERFGTNG"
     gene            700640..701278
                     /locus_tag="BAB_RS29700"
                     /old_locus_tag="BAB2_0704"
                     /db_xref="GeneID:3828132"
     CDS             700640..701278
                     /locus_tag="BAB_RS29700"
                     /old_locus_tag="BAB2_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009363502.1"
                     /note="oxidative demethylase of N1-methyladenine or
                     N3-methylcytosine DNA lesions; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_002966098.1"
                     /db_xref="GI:489055955"
                     /db_xref="GeneID:3828132"
                     /translation="MKDLFDNLNTREIMAPGAVLLRGFALACEESILSAVARVCAAAP
                     FRHMTTPGGYRMSVAMTNCGPVGWVTDRTGYRYSPADPETGKPWPSMPDTFLALAQDA
                     ARQAGYPDFTPDACLINRYEPGARLSLHQDKDERNFSNPIVSVSLGLPATFQFGGMKR
                     TDPITKYILHHGDVVVWGGPSRLFYHGILPLKSGEHERLGPFRLNLTFRKAF"
     gene            complement(701292..701684)
                     /locus_tag="BAB_RS29705"
                     /old_locus_tag="BAB2_0705"
                     /db_xref="GeneID:3827493"
     CDS             complement(701292..701684)
                     /locus_tag="BAB_RS29705"
                     /old_locus_tag="BAB2_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006151814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002969695.1"
                     /db_xref="GI:489059632"
                     /db_xref="GeneID:3827493"
                     /translation="MTTKLHAVVDAIGLPLRIKPTPGHYGDCPQASSLLSGLKGVGHV
                     IADAAYDADHLRAFIASDLKATAQIKVNPTRSSAPTIDWRLYKERHQIECFFNKLKRY
                     RRIALRCEKTLTAFMGFVHLACAMIWLR"
     gene            complement(701681..702049)
                     /locus_tag="BAB_RS29710"
                     /old_locus_tag="BAB2_0706"
                     /db_xref="GeneID:3827494"
     CDS             complement(701681..702049)
                     /locus_tag="BAB_RS29710"
                     /old_locus_tag="BAB2_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006643279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002970690.1"
                     /db_xref="GI:489060636"
                     /db_xref="GeneID:3827494"
                     /translation="MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMPA
                     NAAHWRDLPATFGKWTAVHARFRRWSHAGVWERLFHALADTPDFEYVLIDSTISKVHA
                     DAAGAKGGLKLPASVARAVD"
     gene            complement(702281..703591)
                     /locus_tag="BAB_RS29715"
                     /old_locus_tag="BAB2_0707"
                     /db_xref="GeneID:3827223"
     CDS             complement(702281..703591)
                     /locus_tag="BAB_RS29715"
                     /old_locus_tag="BAB2_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004692290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_002966099.1"
                     /db_xref="GI:489055956"
                     /db_xref="GeneID:3827223"
                     /translation="MNITIEETLDQAGTGSFQRGLLGIFGLVWAADAMQVLAVGFTGA
                     AIAKTFGLTVPQALQTGTLFFLGMLVGAALFGRLADKYGRRRILLITVACDALFGLLS
                     AFAPDFGSLLALRFLTGLAVGGTLPVDYAMMAEFLPAKNRGRWLVMLEGFWAVGTVVI
                     AIAAWATSVAGVEDAWRYIFIVTAAPALIGIWLRFRVPESPMHLLKSGRVEEAKAVIN
                     LVLSRNGKPELPPGAKLLAPRLVTNERLLSPNLRQRTLTSLAIWFLVSVSYYGIFTWI
                     PAKLASDGFGFVRGYGFLVVVALAQLPGYALAAYGVEAWGRRKTLIGFLFVSAAACAL
                     FTVATSSSVVGASILIMSFALLGTWGALYAFTPELYPTALRASGMGAAGAMARLGGLL
                     APSAMAVVINQSFYTAVAMFAGLLALAGIIAFFINVETRQQALN"
     gene            703838..704860
                     /locus_tag="BAB_RS29720"
                     /old_locus_tag="BAB2_0708"
                     /db_xref="GeneID:3827224"
     CDS             703838..704860
                     /locus_tag="BAB_RS29720"
                     /old_locus_tag="BAB2_0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006179242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_002966100.1"
                     /db_xref="GI:489055957"
                     /db_xref="GeneID:3827224"
                     /translation="MTGNARDFGIVCGIMPTGERNAITDVPGVQVGHHTLRDGNINTG
                     VTAIIPHGGNLYRRKVLAACDIINGFGKSTGLVQIEELGSLETPILLTNTFGVGTCAN
                     ALIRDAIAANPDIGRATATVNPVVLECNDGPLNDIQAMAVTEEHARLALRSAQVNVPQ
                     GNVGAGTGMTCFGFKGGIGTSSRRFEFDGKLHHLGILALTNFGRAGDLVLPDGRRPSP
                     KAETQPEKGSVILVLATDVALEHRQLKRVTRRCGAGLARLGAFWGHGSGDIAIGFTTG
                     ITFDHDEPNDFIPMMILNENRIDTLFRAAAEATEEAVLNSMCRAQAMRGRAGNRRRSL
                     ADWLSH"
     gene            705155..707614
                     /locus_tag="BAB_RS29725"
                     /old_locus_tag="BAB2_0709"
                     /db_xref="GeneID:3827225"
     CDS             705155..707614
                     /locus_tag="BAB_RS29725"
                     /old_locus_tag="BAB2_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002966101.1"
                     /note="Derived by automated computational analysis using