GenomeNet

Database: RefSeq
Entry: NC_007907
LinkDB: NC_007907
Original site: NC_007907 
LOCUS       NC_007907            5727534 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Desulfitobacterium hafniense Y51 chromosome, complete genome.
ACCESSION   NC_007907
VERSION     NC_007907.1  GI:89892746
DBLINK      Project: 58605
            BioProject: PRJNA58605
KEYWORDS    RefSeq.
SOURCE      Desulfitobacterium hafniense Y51
  ORGANISM  Desulfitobacterium hafniense Y51
            Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae;
            Desulfitobacterium.
REFERENCE   1
  AUTHORS   Nonaka,H., Keresztes,G., Shinoda,Y., Ikenaga,Y., Abe,M., Naito,K.,
            Inatomi,K., Furukawa,K., Inui,M. and Yukawa,H.
  TITLE     Complete Genome Sequence of the Dehalorespiring Bacterium
            Desulfitobacterium hafniense Y51 and Comparison with
            Dehalococcoides ethenogenes 195
  JOURNAL   J. Bacteriol. 188 (6), 2262-2274 (2006)
   PUBMED   16513756
REFERENCE   2  (bases 1 to 5727534)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAR-2006) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5727534)
  AUTHORS   Nonaka,H., Shinoda,Y., Keresztes,G., Ikenaga,Y., Abe,M., Naito,K.,
            Inatomi,K., Furukawa,K., Inui,M. and Yukawa,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2004) Hiroshi Nonaka, Research Institute of
            Innovative Technology for the Earth (RITE), Microbiology research
            group; 9-2 Kizugawadai Kizu-cho, Soraku-gun, Kyoto 619-0292, Japan
            (E-mail:nonaka@rite.or.jp, Tel:81-774-75-2308, Fax:81-774-75-2321)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AP008230.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5727534
                     /organism="Desulfitobacterium hafniense Y51"
                     /mol_type="genomic DNA"
                     /strain="Y51"
                     /db_xref="taxon:138119"
     gene            1..1350
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /db_xref="GeneID:3958162"
     CDS             1..1350
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="similarity to COG0593 ATPase involved in DNA
                     replication initiation(Evalue: 1E-162)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication initiation ATPase"
                     /protein_id="YP_516234.1"
                     /db_xref="GI:89892747"
                     /db_xref="GeneID:3958162"
                     /translation="MPPRSLQVLWQETLSKLENELSKPSFETWLSSTYLLDIEGDTLI
                     VSVPNEFAKDWLESRYAPIIRSTVQSILGQSMNLRFLVTSIHETTQPGDNQNKASSNS
                     KAEPADNKTLNSKYTFDTFVIGNSNRFAHAAALAVAESPALAYNPLFIYGGVGLGKTH
                     LMHAIGNAVIQRSPSTRVLYVSSEKFTNELIESIRDQNPIEFRNHYRNVDILLIDDIQ
                     FLAGKEGTQEEFFHTFNALHDANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQP
                     PDLETRIAILRKKAKLENLQVANEVMVYIADKIHSNIRELEGALIRVMAVGSLTSNPI
                     TVETAAEALKDIIPVSTPKEITIEMIQQAVADFYHLSLGEFKAKKRTRAVAFPRQIAM
                     YLSRELTDNSLPRIGDEFGGRDHTTVLHAYDKISESRQNDPLLDRKINEIIQMIQSL"
     misc_feature    13..1344
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    19..210
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    433..810
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    454..477
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(457..480,643..645,745..747)
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    631..648
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    781..783
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1069..1338
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1138..1140,1162..1167,1186..1188,1204..1212,
                     1237..1251,1258..1260,1267..1272)
                     /gene="dnaA"
                     /locus_tag="DSY0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1552..2709
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /db_xref="GeneID:3958163"
     CDS             1552..2709
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /EC_number="2.7.7.7"
                     /note="similarity to COG0592 DNA polymerase sliding clamp
                     subunit (PCNA homolog)(Evalue: 1E-65)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_516235.1"
                     /db_xref="GI:89892748"
                     /db_xref="GeneID:3958163"
                     /translation="MFPAKYSTVDKFFEEAAFMKIYCSKDSLITGVNTVQKAVSNKNT
                     LPVLQGIMIRAEGQSLIFEATDLEIGIRCVVPAQVEKEGVVVLPSRLFSDLVRKLPDV
                     LIELELQNDVINIHYNESDLSLRGYDPEEFPLLPDLFDAETFNLPVSIFKTMIKQTIF
                     ACSAEESRPVFTGCLLQIEDGSLRLIATDTHRLAYRIAEISNPEQIKFQGIIPAKTLG
                     EIYRLLRDEDENLFIRFNQAQIVFQFGAVHLLSRLIEGQFPNYKQVIPQSCQTKVLLS
                     ARLFQDSVERASLLARDGSHTSIIKLSVDTERLSIDQTSELGKISEQMEVKKEGNDVK
                     IAFNSKFLLDVLKIIDSEEIVFELSGSYSPGIIRPVDDPNYLYLALPVRTS"
     misc_feature    1606..2703
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1606..2700
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1675..1677,1819..1821,1840..1842,2194..2196)
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1822..1824,1831..1833,1906..1908,1912..1914,
                     2416..2418,2512..2517)
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2113..2115,2119..2130,2563..2565,2689..2700)
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2113..2115,2119..2124,2341..2343,2452..2454,
                     2488..2493,2572..2574,2689..2700)
                     /gene="dnaN"
                     /locus_tag="DSY0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2724..3821
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /db_xref="GeneID:3958251"
     CDS             2724..3821
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="similarity to COG1195 Recombinational DNA repair
                     ATPase (RecF pathway)(Evalue: 5E-75)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_516236.1"
                     /db_xref="GI:89892749"
                     /db_xref="GeneID:3958251"
                     /translation="MEIKWLHLKSFRNYQDQEVDFRPGLTILQGENGQGKTNILEGIY
                     YLLTGKSYRVHREQELARWGENEFHLYGDFIVQRRKLRLESHYQDKRKIIKINQIPCR
                     KLSEYVGTINVVFFSPDDLVMVKGGPAERRRFLDLHIAQHHSKHIQLLNAYNKVLQQK
                     NALLKQGQGGSKSQIAQIELWNEQILRIGSEIIRNRWEFTGLLSRKGQEIYGQISSGK
                     EELTMDYHALGKNNLEEALAAFPKLLAEKMSLEMERKMVLIGPHRDDILFKLNERSAR
                     LYGSQGQQRSIVLSTKLAELEVIRQEKGDYPLLLLDDVLSELDRFRRDYLLDYTKSLQ
                     QTIMTMTSAETLTQRASLLLKVEKGQIGRIE"
     misc_feature    2724..3806
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    2730..3806
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="ATP-binding cassette domain of RecF; Region:
                     ABC_RecF; cd03242"
                     /db_xref="CDD:213209"
     misc_feature    2811..2834
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    order(2820..2825,2829..2837,3024..3026,3657..3662,
                     3744..3746)
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213209"
     misc_feature    3015..3026
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213209"
     misc_feature    3558..3587
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213209"
     misc_feature    3645..3662
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213209"
     misc_feature    3669..3680
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    3732..3752
                     /gene="recF"
                     /locus_tag="DSY0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213209"
     gene            3825..4082
                     /locus_tag="DSY0004"
                     /db_xref="GeneID:3953694"
     CDS             3825..4082
                     /locus_tag="DSY0004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516237.1"
                     /db_xref="GI:89892750"
                     /db_xref="GeneID:3953694"
                     /translation="MFLHLGGDILINQEKIIAILDLETAMRNSTSENFLNKIKEKQKI
                     NYISEKGKEKSLIIASDGNYFSPISSSTLLKRSSSAIIGEE"
     gene            4234..6168
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /db_xref="GeneID:3958176"
     CDS             4234..6168
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /EC_number="5.99.1.3"
                     /note="similarity to COG0187 DNA gyrase (topoisomerase II)
                     B subunit(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_516238.1"
                     /db_xref="GI:89892751"
                     /db_xref="GeneID:3958176"
                     /translation="MQEKAEIKETIPTNDYNAGQIEVLEGLEAVRKRPGMYIGSTSLR
                     GLHHLVYEIVDNSIDEALAGYCDTIEVTIHKDNSISVVDNGRGIPVDIHPKLGKPAVE
                     VALTVLHAGGKFSGSAYKVSGGLHGVGMSVVNALSTWLHVEVRKDGNIYHQEFMRGKT
                     KTELAVIGQVDPNQTGTTITFSPDPEIFEDTVFLFDTLAHRLRELSFLNKKVSITLID
                     AREDKKEVYYHTGGIYDFVKYINRSKESLHPEPIYFEAEKDGVQVEVSMQYNDGYVEN
                     LFSYANNIHTHEGGTHESGFKAALTRVANDYARKNNILKANEANLSGEDIREGLTAVI
                     SVKVPEPQFEGQTKTKLGNSEIRSIVDSITGEGLSAFFEENPAIGKKVIEKSIQASRA
                     REAARKARELTRRKSALEVSALPGKLADCSWKEAELCEMYIVEGDSAGGSAKQGRDRR
                     FQAILPLRGKILNVEKARLDRILGNAEIRAMITAMGTGISEDFDIEKARYHKLVIMTD
                     ADVDGAHIRILLLTFFFRYMKPLLENNYVYIAQPPLFKVKKGKDIHYVYSNEELAKLQ
                     DEIGRDRVEIQRYKGLGEMNAEQLWETTMDPAKRTILQVTMEDAIKADELFTILMGDV
                     VEPRREFIQDNAQYVRNLDV"
     misc_feature    4270..6165
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    4369..4677
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(4387..4389,4399..4401,4408..4410,4474..4476,
                     4480..4482,4486..4488,4492..4497,4612..4623,4657..4659,
                     4663..4665)
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    4399..4401
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4486..4488,4492..4494,4612..4614,4618..4620)
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4924..5400
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    5077..5079
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5251..5253,5260..5265,5269..5271)
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5269..5271,5275..5277)
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5518..5859
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5536..5541,5548..5550,5755..5757,5761..5763,
                     5767..5769)
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5536..5538,5755..5757)
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    5941..6132
                     /gene="gyrB"
                     /locus_tag="DSY0005"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            6182..8668
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /db_xref="GeneID:3958175"
     CDS             6182..8668
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /EC_number="5.99.1.3"
                     /note="similarity to COG0188 DNA gyrase (topoisomerase II)
                     A subunit(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="YP_516239.1"
                     /db_xref="GI:89892752"
                     /db_xref="GeneID:3958175"
                     /translation="MSTEIQGGKILPIEISEELKKSFIDYSMSVIVSRALPDVRDGLK
                     PVHRRIIYTLHELGMTPNKPYSKSARLVGDCMGKFHPHGDSSIYDAVVRLAQDFSTRY
                     PLIDGHGNFGSVDGDSAAAMRYTEARMSKITQYMLADIDKDTVDFQPNYDEREQEPKV
                     MPAKFPNLLVNGSAGIAVGMATNIPPHNLTEVIEGTIAQIDNPEIEIKELMTYIKGPD
                     FPTGASIMGTEGIISAYRTGKGSFRTRAKAHVEEMEKSGKMRIIVTEIPYMVNKARLV
                     EKIAELVREKRIEGITDLRDESDRTGMRIVMELRRDVNPQVLLNQLYKHTQMEESFGV
                     NILALVDGQPKVLNLKQIIHYFIEHQKDVIVRRTRFELNKAEAEAHILEGLRIALDYI
                     DEVISIIRTSADEQSAKDNLMSRFGLSDKQSQAIVDMRLKRLTGLEREKIEEQYQKIQ
                     ETIAYLKAVLNSEQMVLNIIKQELQEVKEKFGDERRTEISFDATHMNIEDLIDDEEVV
                     ITMSHRGYIKRMPLNTYKSQRRGGKGVHGMATREEDFVEKIFTTSTHQYILFFTTRGK
                     VYRLKAHEIPEAGRTGKGTALVNLLSINPSEEKITAVLSIRKYNEDFHLFMATRKGIV
                     KKTLLKEYDSPRKDGLIAISLSGDDELIDVRLTKPDEHIIIATKNGLCIRFLESDVRQ
                     MGRTAHGVKGISLEKEDLVVSMDVIYEEEAEILSMTELGFSKRTSLSEYRVQGRGGKG
                     IIATKLNAKTGKLVGLKVMRPENDMMIITEDGIIIRQEVSGISKQGRSAQGVMAMRTG
                     ESKVVAIAVVDNKEDAEESDLELVEIESEE"
     misc_feature    6197..8617
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase subunit A; Validated; Region: PRK05560"
                     /db_xref="CDD:235502"
     misc_feature    6275..7612
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    order(6275..6358,6371..6520,6524..6580,6584..6655,
                     6662..6664)
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    6551..6553
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    order(7349..7357,7364..7375,7406..7411,7451..7501)
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     misc_feature    7697..7840
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    7847..8002
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8021..8155
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8162..8302
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8318..8455
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    8468..8608
                     /gene="gyrA"
                     /locus_tag="DSY0006"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     gene            8783..9349
                     /locus_tag="DSY0007"
                     /db_xref="GeneID:3953695"
     CDS             8783..9349
                     /locus_tag="DSY0007"
                     /note="similarity to COG0311 Predicted glutamine
                     amidotransferase involved in pyridoxine
                     biosynthesis(Evalue: 2E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516240.1"
                     /db_xref="GI:89892753"
                     /db_xref="GeneID:3953695"
                     /translation="MNERIGVLSLEGTDHDPCRFLRQLGCEVIRVQQREDLIDIQGLI
                     MTGTGNKAKNLGQPGLGDRIKELAKADFPIFGLGAGMVLLSKESPGQGNDRLGLMDLT
                     VTKEPMAGRTEAYLSIPALGLTPLKAIFNEAPYIQEITPNVGILAEYNGKIVFVRQGN
                     MLAGAFHPQQTEDDRIYRYFLDIVNGQI"
     misc_feature    8795..9325
                     /locus_tag="DSY0007"
                     /note="Glutamine Amidotransferase (GATase_I) involved in
                     pyridoxine biosynthesis; Region: GATase1_PB; cd01749"
                     /db_xref="CDD:153220"
     misc_feature    order(8921..8923,9014..9016,9173..9178,9281..9283,
                     9287..9289)
                     /locus_tag="DSY0007"
                     /note="predicted active site [active]"
                     /db_xref="CDD:153220"
     misc_feature    order(9014..9016,9281..9283,9287..9289)
                     /locus_tag="DSY0007"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153220"
     gene            9380..10645
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /db_xref="GeneID:3958261"
     CDS             9380..10645
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /EC_number="6.1.1.11"
                     /note="catalyzes a two-step reaction, first charging a
                     serine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="YP_516241.1"
                     /db_xref="GI:89892754"
                     /db_xref="GeneID:3958261"
                     /translation="MLDLKFVRTNPEVVKEALKKRNSNVSLDAFLEQEEERRKLLFEV
                     ESLKAKRNTVSEEVGRRKKHGEDAEQLILEMREVGQKVKNLEDKLGEIEQSMEAVLYE
                     IPNIPHESVPVGADEEANVEVRTWGTPRSFDFEPLAHYEIGEKLDILDFARAGKVTGA
                     RFTFYKGLGAKLERALISFMLDRHSAKGYVEVLPPYMVHRNSMIGTGQLPKFEEDAFK
                     VAGTDYFLIPTAEVPVTNMYREEILEAEQLPIHHCAYSACFRAEAGSAGRDTRGLIRQ
                     HQFNKVELVKFAFPENSYEELESLTRDAESILQELELPYRVMALSTGDLGFTSAKTYD
                     LEVWLPSFNTYREISSCSNFEDFQARRANIRFRRAPKAKPEFLHTLNGSGLAIGRTVS
                     AILENYQEADGRVRVPKALQPYLGVEYIG"
     misc_feature    9380..10642
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="seryl-tRNA synthetase; Provisional; Region:
                     PRK05431"
                     /db_xref="CDD:235461"
     misc_feature    9380..9700
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:251274"
     misc_feature    9734..10624
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="Seryl-tRNA synthetase (SerRS) class II core
                     catalytic domain. SerRS is responsible for the attachment
                     of serine to the 3' OH group of ribose of the appropriate
                     tRNA. This domain It is primarily responsible for
                     ATP-dependent formation of the enzyme...; Region:
                     SerRS_core; cd00770"
                     /db_xref="CDD:238393"
     misc_feature    order(9836..9853,9860..9880,9890..9892,9896..9898,
                     9902..9904,9911..9913,9947..9958,9962..9970,9974..9976,
                     10028..10033,10037..10039,10049..10051,10076..10078,
                     10088..10090,10100..10102,10148..10150,10211..10213,
                     10619..10624)
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238393"
     misc_feature    order(9857..9859,10064..10066,10070..10072,10157..10159,
                     10163..10165,10181..10183,10190..10192,10199..10201,
                     10205..10207,10214..10216,10220..10222,10226..10228,
                     10418..10429,10520..10522,10526..10528,10544..10546)
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="active site"
                     /db_xref="CDD:238393"
     misc_feature    9947..9970
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="motif 1; other site"
                     /db_xref="CDD:238393"
     misc_feature    10154..10165
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="motif 2; other site"
                     /db_xref="CDD:238393"
     misc_feature    order(10529..10537,10544..10546)
                     /gene="serS"
                     /locus_tag="DSY0008"
                     /note="motif 3; other site"
                     /db_xref="CDD:238393"
     gene            10747..10835
                     /locus_tag="DSY_tRNA1-Ser"
                     /db_xref="GeneID:3958015"
     tRNA            10747..10835
                     /locus_tag="DSY_tRNA1-Ser"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3958015"
     gene            11032..11110
                     /locus_tag="DSY_tRNA2-Arg"
                     /db_xref="GeneID:3958026"
     tRNA            11032..11110
                     /locus_tag="DSY_tRNA2-Arg"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3958026"
     gene            11126..11572
                     /locus_tag="DSY0009"
                     /db_xref="GeneID:3953696"
     CDS             11126..11572
                     /locus_tag="DSY0009"
                     /note="similarity to COG0590 Cytosine/adenosine
                     deaminases(Evalue: 4E-43)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516242.1"
                     /db_xref="GI:89892755"
                     /db_xref="GeneID:3953696"
                     /translation="MNHQDYMRLALEEAEIAFAQGEVPIGAVVVHKGEIIARAHNEKE
                     LRQDPTAHAEVLAVQRATQALGIWRLSEATLYVTLEPCPMCAGSLVQARLKTLVFGAA
                     DLKGGAVGSVTNVLDVNRWNHRVEVVAGILEEECAQILKDFFRKLR"
     misc_feature    11144..11467
                     /locus_tag="DSY0009"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    order(11198..11200,11246..11248,11279..11287,11369..11371,
                     11378..11380)
                     /locus_tag="DSY0009"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    order(11273..11275,11288..11290,11300..11302,11372..11377,
                     11384..11389,11396..11401)
                     /locus_tag="DSY0009"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    order(11279..11287,11366..11371,11378..11380)
                     /locus_tag="DSY0009"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            11822..11910
                     /locus_tag="DSY_tRNA3-Ser"
                     /db_xref="GeneID:3958037"
     tRNA            11822..11910
                     /locus_tag="DSY_tRNA3-Ser"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3958037"
     gene            complement(12071..13258)
                     /locus_tag="DSY0010"
                     /db_xref="GeneID:3953697"
     CDS             complement(12071..13258)
                     /locus_tag="DSY0010"
                     /note="similarity to COG0582 Integrase(Evalue: 6E-23)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516243.1"
                     /db_xref="GI:89892756"
                     /db_xref="GeneID:3953697"
                     /translation="MDGKRKPKWVSTGLPVAGTSDRKAQKAFDQIRLEYEQEQEEKER
                     REAEERAREQIEGKRNPQADVLFTDYLQKWLTQAKPTIAKTTFKGYQTMLDGRISRYF
                     TELNITLGEVTPQHIQDFHQSIFDEGHTPNTVIHYHAVLRRALQNAVKKEIIDSNPAD
                     RVDRPKKNVYHAQFYSAEEMMALFDEISDDPLEICVKLAAYYGLRRSEVLGLKWDAIN
                     LEQKTISIKHKVIEDTVDGKSIAVGEDVLKTKSSFRTLPLLPSVEKLLLAEKEKQEMY
                     RKLFKRSYCRDYLDYICLDQAGKLMRPNYVTEHFSWALEKADLKKIRFHDLRHSCASL
                     LLANGISMKQIQIWLGHSTFSTTADIYSHLDFHAQIESGLVMDGMFERNRVAEPTGLA
                     AAN"
     misc_feature    complement(<12581..13075)
                     /locus_tag="DSY0010"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(12164..13012)
                     /locus_tag="DSY0010"
                     /note="tyrosine recombinase XerD; Region: recomb_XerD;
                     TIGR02225"
                     /db_xref="CDD:233789"
     misc_feature    complement(12167..12742)
                     /locus_tag="DSY0010"
                     /note="phiLC3 phage and phage-related integrases,
                     site-specific recombinases, DNA breaking-rejoining
                     enzymes, C-terminal catalytic domain. This CD includes
                     various bacterial (mainly gram positive) and phage
                     integrases, including those similar to Lactococcus...;
                     Region: INT_phiLC3_C; cd01189"
                     /db_xref="CDD:238594"
     misc_feature    complement(order(12176..12178,12206..12208,12275..12277,
                     12284..12286,12515..12517,12644..12646))
                     /locus_tag="DSY0010"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238594"
     gene            complement(13699..14067)
                     /locus_tag="DSY0011"
                     /db_xref="GeneID:3953698"
     CDS             complement(13699..14067)
                     /locus_tag="DSY0011"
                     /note="similarity to COG2337 Growth inhibitor(Evalue:
                     3E-29)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516244.1"
                     /db_xref="GI:89892757"
                     /db_xref="GeneID:3953698"
                     /translation="MDTIKQGVSRGDIYYADLNPVVGCEQGGIRPVLILQNDIGNRHS
                     PTIIVCAITGKPKKPLPTHTAIAGAGRLSRESFALLEQIRTIDRSRLRGWIGRLDEQK
                     MEEINQALSISVGLSPALLL"
     misc_feature    complement(13726..14040)
                     /locus_tag="DSY0011"
                     /note="PemK-like protein; Region: PemK; pfam02452"
                     /db_xref="CDD:251304"
     gene            14335..14592
                     /locus_tag="DSY0012"
                     /db_xref="GeneID:3953699"
     CDS             14335..14592
                     /locus_tag="DSY0012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516245.1"
                     /db_xref="GI:89892758"
                     /db_xref="GeneID:3953699"
                     /translation="MIPRSRGAVTGQKYQYRLTGSLRDRLPQPVFRSDGYRFAPYLAV
                     FDRSRKKRANRKVSDSAFLAACLQVVLAHPPGSLSLLGSVS"
     gene            14748..15323
                     /locus_tag="DSY0013"
                     /db_xref="GeneID:3953700"
     CDS             14748..15323
                     /locus_tag="DSY0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516246.1"
                     /db_xref="GI:89892759"
                     /db_xref="GeneID:3953700"
                     /translation="MDCHAWNTGFCRQLMLTFILKKQSVDEFLFLLDKLRKALVEFFC
                     DELVHNQILHTGRNKVGDYILTIGSLRIQGTVIKHAVCCIPFLQISFAALHAVIGQID
                     FLANRDELPLHLDLIFFFLCHMACPPFSEILMVSQNFRSGGERQRGFDTLKYETTLKS
                     PFFGTLGRSIRFLVERKKSALCPRQNTDFFS"
     gene            complement(15662..16903)
                     /locus_tag="DSY0014"
                     /db_xref="GeneID:3953701"
     CDS             complement(15662..16903)
                     /locus_tag="DSY0014"
                     /note="similarity to COG0477 Permeases of the major
                     facilitator superfamily(Evalue: 4E-33)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516247.1"
                     /db_xref="GI:89892760"
                     /db_xref="GeneID:3953701"
                     /translation="MQQWKKKTLIFLISQGITLFGSSVVQFAIVWDVTLKTSSGAWVS
                     AFTICSFLPQFLISFFSGVWADRYSRKFLIILSDTVIAATTLTLVLLMPFIGNGTSLY
                     TALLIASVIRSLGAGIQTPAVNSMIPQLVPDEHLMRLNGINATLQSVVQFAAPAAAGA
                     ILTFSTLRSTLFIDITTAIIGVVLLACIAIPKQVANEKTEAPSVFAEMKQGMKYTFAN
                     RFIGKLLITYGLFIFLAVPAGFLAALFVSRIYGDNYFYLTATELVGFAGMTAGGILIS
                     TWGGFSNRVKTLLVGMVVFGTLAIGMGAIRNFVVYLVLMAVYGIALTMVQTAVTTLIQ
                     EKTDDHMQGRIFGFLSAMYSGCLPLGMAVFGPLSDVVSIRILMIVTGGVLVILAGVLR
                     LDKSVYGKTKPLPALKRSHTK"
     misc_feature    complement(15731..16882)
                     /locus_tag="DSY0014"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(15788..16873)
                     /locus_tag="DSY0014"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(order(15833..15835,15842..15847,15854..15859,
                     15866..15871,15902..15904,15911..15916,15926..15928,
                     15935..15940,15947..15949,16076..16078,16088..16090,
                     16097..16099,16109..16111,16121..16123,16163..16165,
                     16172..16177,16184..16189,16196..16198,16451..16453,
                     16469..16474,16481..16486,16520..16522,16529..16534,
                     16541..16546,16553..16558,16718..16723,16727..16732,
                     16742..16744,16751..16756,16763..16765,16814..16819,
                     16823..16831,16838..16840))
                     /locus_tag="DSY0014"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(17246..17743)
                     /locus_tag="DSY0015"
                     /db_xref="GeneID:3953702"
     CDS             complement(17246..17743)
                     /locus_tag="DSY0015"
                     /note="similarity to COG0440 Acetolactate synthase, small
                     subunit(Evalue: 6E-24)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516248.1"
                     /db_xref="GI:89892761"
                     /db_xref="GeneID:3953702"
                     /translation="MKRWISLLVENEIGVLARVSSLFSGKSYNLDSLTVGATEDNSIS
                     RMTISLTSDDQTFEQIKKQLNRSVEVIKVVDFTDVAIHMKELMFIKISDCTQQEMIQL
                     THIISVFALKMIDYDADTAIIECVQTEDRNNNLIRLFEKTFPNRFSIVRGGGVAIEAI
                     NLSNG"
     misc_feature    complement(17270..17743)
                     /locus_tag="DSY0015"
                     /note="acetolactate synthase 3 regulatory subunit;
                     Reviewed; Region: ilvH; PRK11895"
                     /db_xref="CDD:183365"
     misc_feature    complement(17522..17737)
                     /locus_tag="DSY0015"
                     /note="N-terminal ACT domain of the Escherichia coli
                     IlvH-like regulatory subunit of acetohydroxyacid synthase
                     (AHAS); Region: ACT_AHAS; cd04878"
                     /db_xref="CDD:153150"
     misc_feature    complement(order(17612..17614,17639..17641,17654..17659,
                     17696..17698,17711..17713,17717..17719))
                     /locus_tag="DSY0015"
                     /note="putative valine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153150"
     misc_feature    complement(order(17609..17611,17639..17653,17663..17665,
                     17672..17674,17693..17695,17702..17707))
                     /locus_tag="DSY0015"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153150"
     misc_feature    complement(17270..17494)
                     /locus_tag="DSY0015"
                     /note="Small subunit of acetolactate synthase; Region:
                     ALS_ss_C; pfam10369"
                     /db_xref="CDD:255942"
     gene            complement(17743..19485)
                     /locus_tag="DSY0016"
                     /db_xref="GeneID:3953703"
     CDS             complement(17743..19485)
                     /locus_tag="DSY0016"
                     /note="similarity to COG0028 Thiamine
                     pyrophosphate-requiring enzymes acetolactate synthase,
                     pyruvate dehydrogenase (cytochrome), glyoxylate
                     carboligase, phosphonopyruvate decarboxylase(Evalue:
                     1E-157)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516249.1"
                     /db_xref="GI:89892762"
                     /db_xref="GeneID:3953703"
                     /translation="MRISGADLLVKALKEENVDTLFAYPGGQAIDLFNALYGVENINV
                     VLPRHEQGLIHAADGYARSTGKVGVCLVTSGPGATNLVTGIATANYDSVPLVCFTGQV
                     PTHLIGNDAFQEVDIVGITRSICKYAVTVRKREDLGTTIKKAFYIARSGKPGVVVVDL
                     PKDIQQQLGSALYPDNIELRGYKPNTTVHIGQINKALDCISHSKKPVFLIGGGVNISH
                     ANNEMTLLAEKTGIPVVTTIMGKGAIPTNHPLYVGNLGIHGSYAANSAISECDVLFSI
                     GVRFNDRITGKIGEFAKHATIIHIDIDPASISRNIVVDIPIVADAKNAISRLLEKAVC
                     LHTEEWIKQICNWKQLHPLNIPLQDANQVTPQAIIQEINTLFEHAVITTDVGQNQLWA
                     SQFIELTDNKVFLTSGGLGTMGYGFPAAIGAKLGNPDKDVIAICGDGGIQMNIQEIAT
                     AVVYELPVIICIMNNGYLGNVRQWQEMFYSKRYSKTCLLWRKGCSTICNTPDAVCPEY
                     TPDFIRLAESYGAQGIRVKKTEEIKSALLKAKNTDKVPTIIEFLIGREENVYPIIPPG
                     NSLNDMVMGGENIR"
     misc_feature    complement(17767..19479)
                     /locus_tag="DSY0016"
                     /note="acetolactate synthase, large subunit, biosynthetic
                     type; Region: acolac_lg; TIGR00118"
                     /db_xref="CDD:232833"
     misc_feature    complement(19000..19467)
                     /locus_tag="DSY0016"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(19213..19218,19225..19227,19237..19239,
                     19258..19260,19294..19302,19306..19311,19318..19323,
                     19330..19332,19339..19359,19384..19386,19396..19398,
                     19408..19413,19426..19428))
                     /locus_tag="DSY0016"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(19117..19119,19126..19128,19228..19230,
                     19237..19242,19246..19251,19258..19260,19333..19335,
                     19339..19350,19354..19356,19384..19386,19396..19398,
                     19405..19413))
                     /locus_tag="DSY0016"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(19246..19248,19258..19260,19336..19338,
                     19411..19413))
                     /locus_tag="DSY0016"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(18502..18909)
                     /locus_tag="DSY0016"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(17788..18399)
                     /locus_tag="DSY0016"
                     /note="Thiamine pyrophosphate (TPP) family,
                     Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
                     module; composed of proteins similar to the large
                     catalytic subunit of AHAS. AHAS catalyzes the condensation
                     of two molecules of pyruvate to give the...; Region:
                     TPP_AHAS; cd02015"
                     /db_xref="CDD:238973"
     misc_feature    complement(order(18091..18093,18157..18159,18166..18174,
                     18247..18249,18253..18255,18322..18333))
                     /locus_tag="DSY0016"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238973"
     misc_feature    complement(order(17932..17934,17941..17943,17953..17958,
                     18127..18129,18148..18153,18157..18162,18247..18249,
                     18253..18255,18262..18264))
                     /locus_tag="DSY0016"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238973"
     gene            complement(19630..20211)
                     /locus_tag="DSY0017"
                     /db_xref="GeneID:3953704"
     CDS             complement(19630..20211)
                     /locus_tag="DSY0017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516250.1"
                     /db_xref="GI:89892763"
                     /db_xref="GeneID:3953704"
                     /translation="MKKILVFLTATLCLTFAACTPIQIEQVEKNALSDNEQYRLAVHI
                     TDHDSAVIHLTDTLLKDEYEVNRSGSPEMQDEYGWYVQIGIYRAMLHYVKDSLEGEAK
                     KIGVKDMQLELYKCEYNQKGELFHMVELPSESISLKLEGNNLVFSIEIPNEYYFDLRS
                     QADIIELQTMDCTRELPYQALTVNAGDVVTKDS"
     gene            complement(20287..21129)
                     /locus_tag="DSY0018"
                     /db_xref="GeneID:3953705"
     CDS             complement(20287..21129)
                     /locus_tag="DSY0018"
                     /note="similarity to COG2207 AraC-type DNA-binding
                     domain-containing proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516251.1"
                     /db_xref="GI:89892764"
                     /db_xref="GeneID:3953705"
                     /translation="MRKLEAALAAIAYIEEHLSDEKVDLDTVSEAVHYSKYHLHRIFS
                     NTVQLTIHEYAQRRQLTEAAKLLVFSEKPILDIALLAGYDSQQAFSNVFKAMYKQSPL
                     EFRKGEVFYPLQLEYDFKDQSGIIGVCEANPKKEIRYATDIDIPTWMDLARLCVDGFP
                     YLDEDEHIVALKRYIEKDGALLMLEGSAVIGSMLINYETGSIDFLAVHPLYRKRGVAG
                     EFLDTALSELIENKEISITTFREGDKADTGYRKALKELGFAEAELLTEFGYPTQRMVL
                     ARDG"
     misc_feature    complement(20968..21090)
                     /locus_tag="DSY0018"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(20815..21066)
                     /locus_tag="DSY0018"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(20812..20922)
                     /locus_tag="DSY0018"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(20356..20700)
                     /locus_tag="DSY0018"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(20419..20607)
                     /locus_tag="DSY0018"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(20476..20481,20509..20517))
                     /locus_tag="DSY0018"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(21457..21771)
                     /locus_tag="DSY0019"
                     /db_xref="GeneID:3953706"
     CDS             complement(21457..21771)
                     /locus_tag="DSY0019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516252.1"
                     /db_xref="GI:89892765"
                     /db_xref="GeneID:3953706"
                     /translation="MWRRLSALSYWPLYPCAIRRAMVRNCWIQIIKWWKFYTMLHTIP
                     LSKPRKQHLFTQFPMTTLYMKRKQHRTLHGVSRVIYMLLITARRSLTVFLTRSITKRI
                     SG"
     gene            complement(21818..22399)
                     /locus_tag="DSY0020"
                     /db_xref="GeneID:3953707"
     CDS             complement(21818..22399)
                     /locus_tag="DSY0020"
                     /note="similarity to COG0655 Multimeric flavodoxin WrbA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516253.1"
                     /db_xref="GI:89892766"
                     /db_xref="GeneID:3953707"
                     /translation="MKVCIIMGSPRIKGNTAELLKPFISTLESNGCAVTYISLSDKNI
                     QPCKGCYACQQIDGRYGCVQEDDVGVIMETVIESDCVVLATPIYTWYCTAPMKALLDR
                     HYGLNKFYGKATGSLWAGKMIAIIATHGYDVKYGAEPFEMGIRRLCEHSDLKYMGMYS
                     VRDEEDIASFQTEEAIAGAKAFACSLCHYEIAR"
     misc_feature    complement(21854..22399)
                     /locus_tag="DSY0020"
                     /note="Multimeric flavodoxin WrbA [General function
                     prediction only]; Region: WrbA; COG0655"
                     /db_xref="CDD:223728"
     gene            complement(22459..22914)
                     /locus_tag="DSY0021"
                     /db_xref="GeneID:3953538"
     CDS             complement(22459..22914)
                     /locus_tag="DSY0021"
                     /note="similarity to COG0454 Histone acetyltransferase
                     HPA2 and related acetyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516254.1"
                     /db_xref="GI:89892767"
                     /db_xref="GeneID:3953538"
                     /translation="MNVHKIIRAEQADLPAILELQYLAYQSEAILLGNYSIPPLKQTL
                     QELETEYKNGVILKAVHENGDIVGSVRGYTCSGTFYIGKLIVHPAVQGRGIGTQLLNE
                     IESLYPQLRYELFTSSMSNKNLKLYERQGYSRFKEKQVANGLTFIYLEK"
     misc_feature    complement(<22618..22881)
                     /locus_tag="DSY0021"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3375"
                     /db_xref="CDD:225910"
     misc_feature    complement(22519..22878)
                     /locus_tag="DSY0021"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(22567..22740)
                     /locus_tag="DSY0021"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(22624..22629,22657..22665))
                     /locus_tag="DSY0021"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(22984..23565)
                     /locus_tag="DSY0022"
                     /db_xref="GeneID:3953539"
     CDS             complement(22984..23565)
                     /locus_tag="DSY0022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516255.1"
                     /db_xref="GI:89892768"
                     /db_xref="GeneID:3953539"
                     /translation="MIKGDKINLIPATLDDRRKIYEWCFQSETTKCHSGPPDYPNNPI
                     PTYEEFCSSDDGGYTEYYFTGVKPKDGRGFLIVNGKEAVGFISYYSFHLKSGISELDM
                     WIKDEANCGKGFGTDALVSLGNYLNEEMGIRELIIAPSERNTRAVRAYGKAGFVKTDK
                     AMSEFLADEYISVFGEGDYGTGDTAILVKRFNA"
     misc_feature    complement(23098..23550)
                     /locus_tag="DSY0022"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    complement(23095..23535)
                     /locus_tag="DSY0022"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            complement(23631..24596)
                     /locus_tag="DSY0023"
                     /db_xref="GeneID:3953540"
     CDS             complement(23631..24596)
                     /locus_tag="DSY0023"
                     /note="similarity to COG0596 Predicted hydrolases or
                     acyltransferases (alpha/beta hydrolase
                     superfamily)(Evalue: 2E-32)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516256.1"
                     /db_xref="GI:89892769"
                     /db_xref="GeneID:3953540"
                     /translation="MKKQNNFTSEYIKINGTLQYLLHYCTDPALPVLLFLHGGPGMAE
                     STFAYAFQEGMSQLFTVVHWDQRGAGKTLTKNKKNVGYPTVDELLVDTLEVVRYLKKK
                     YGKDKIVILGHSWGSMLGTLFVQKYPQEVLYYIGTGQFVDVVENERAGYDKLRELITE
                     AGNLKNLAQLEKIGDYPESNYEKPMIKKIQSIRILQGKYKIGMNFGPILKALLKSPVF
                     RLSDLSSLVKGMSNNKELWNYMFSSNLYSESRVYQMPVFYILGADDFQAPHTIATRYF
                     DTIEAPLKKLFIMNGAAHFMMLDQPKGFAQILSEIRRIEHTNGHI"
     misc_feature    complement(<24204..24578)
                     /locus_tag="DSY0023"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(23655..24572)
                     /locus_tag="DSY0023"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            complement(24659..25207)
                     /locus_tag="DSY0024"
                     /db_xref="GeneID:3953541"
     CDS             complement(24659..25207)
                     /locus_tag="DSY0024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516257.1"
                     /db_xref="GI:89892770"
                     /db_xref="GeneID:3953541"
                     /translation="MLAGCASGNVDPERILRDDFDRSTAIEMIQELEEPLMNFPLTGT
                     ITRTEFDTFQEQYTVFREDDGNWLKVFISANDEGNPMVSDLRIAEDNFVPTLFHQEID
                     IAEAYTEQLIYEEKNSERNHTNLYIIEEYSGTDEKMKGFSRTYHFSLTNGKEWKYEGF
                     SGAANLAGEGYFRDYLSLKQED"
     gene            complement(25255..25878)
                     /locus_tag="DSY0025"
                     /db_xref="GeneID:3953542"
     CDS             complement(25255..25878)
                     /locus_tag="DSY0025"
                     /note="similarity to COG1305 Transglutaminase-like
                     enzymes,  cysteine proteases(Evalue: 1E-37)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516258.1"
                     /db_xref="GI:89892771"
                     /db_xref="GeneID:3953542"
                     /translation="MRLSQQNENLADYLEETYLVNYNTATLQQKAAQLFAHSITDIDK
                     INTAYEFVRDSIRHSADINGHRITKTATEVLLYGEGMCYSKTILFTALLRSQGIHIGF
                     CYQRLTRDDQGNTEYDIHALNAVYIADKKAWVRIDPRGNTNGRNAQFYPGDPLREQLA
                     YTVRPDVGEIDYPGVYTRHPDRVLYPLLRCKDCLEMMAYHLPDRLEE"
     misc_feature    complement(25321..>25857)
                     /locus_tag="DSY0025"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    complement(25465..25797)
                     /locus_tag="DSY0025"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     gene            complement(25881..26465)
                     /locus_tag="DSY0026"
                     /db_xref="GeneID:3953543"
     CDS             complement(25881..26465)
                     /locus_tag="DSY0026"
                     /note="similarity to COG1309 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516259.1"
                     /db_xref="GI:89892772"
                     /db_xref="GeneID:3953543"
                     /translation="MPPKQKISKDTLLAHAFSIAEESGINSVTSRSVAKKAGCSIQPV
                     FSHFPTMEDLRQATFDYACEVFKEETMPYEQEPDFFSKLTMWVIDLARHRPNLYRLVY
                     LSDAFRNSQLSDAIMGFQINEKALQKMMERYELPFTACQDILQRTFLLLYGAATMVCV
                     NHADLSNEQIASMIRMSVSDMVQSAKKANGGSED"
     misc_feature    complement(25938..26465)
                     /locus_tag="DSY0026"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(26295..26432)
                     /locus_tag="DSY0026"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; cl19382"
                     /db_xref="CDD:267735"
     misc_feature    complement(25992..26204)
                     /locus_tag="DSY0026"
                     /note="WHG domain; Region: WHG; pfam13305"
                     /db_xref="CDD:257642"
     gene            complement(27044..27316)
                     /locus_tag="DSY0027"
                     /db_xref="GeneID:3953544"
     CDS             complement(27044..27316)
                     /locus_tag="DSY0027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516260.1"
                     /db_xref="GI:89892773"
                     /db_xref="GeneID:3953544"
                     /translation="MNMSYFNHIYTALPDELPHRARTVYIYLRDRAGKDSDCWPAVKT
                     IAADLQLSRSTVKRALHDLVRAGLIEKETRYRENGSNTSNRLILKK"
     misc_feature    complement(27110..27271)
                     /locus_tag="DSY0027"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:258026"
     gene            complement(27325..29148)
                     /locus_tag="DSY0028"
                     /db_xref="GeneID:3953545"
     CDS             complement(27325..29148)
                     /locus_tag="DSY0028"
                     /note="similarity to COG3505 Type IV secretory pathway,
                     VirD4 components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516261.1"
                     /db_xref="GI:89892774"
                     /db_xref="GeneID:3953545"
                     /translation="MPSQVYILIAAAAVMFFVIGGLSLLAHYYTLNGIKSRTVGDGQH
                     GTARFASKQEIKNTYQHIPFQPELWRQGQCLPTAAEQGIILGCVGAKNKVTAMVDSDD
                     VHCLMIGASGIGKTAYFLYPNLEYACASGMSFLTTDTKGDLYRNYGAIARDYYGYHVA
                     VIDLRNPTRSDGNNMLHLVNAYMDRYLADENNLVAKAKAEKYAKIIAKTIINASGENY
                     GQNQFFYDAAEGLLSSVILLVAEYLPPTKADGKKVDCRHIISVFKLVQDLLAPSKVKG
                     KSQFQLLMEKLPPDHKARWFAGAALNSAEQAMASVLSTVLSRLNAFLDSEMEQILCFD
                     TAIDAEKFCNKKSALFIVLSEEDLTKYFMVSLMIQQLYREILAVADENGGKLKNRVMF
                     YCDELGTLPAIQSLELIFSASRSRRLSIIPIIQSFGQLEKNYGKEGSEIIVDNCQDTI
                     FGGFAPNSQTAEVLSKALGSRTVMSGSISRGKNDPSQSLQMMERPLMTPDELKSIPKG
                     NFVVMKTGTHPMRTKLRLFLDWGIRFEKPYTVAEKAHRKVAYADKLLLEESIVRKHSA
                     YLMVDEETGEVLEPFEGTGALHTPVAEPAENAVKRRSHLKT"
     misc_feature    complement(27571..28839)
                     /locus_tag="DSY0028"
                     /note="Type IV secretion-system coupling protein
                     DNA-binding domain; Region: TrwB_AAD_bind; pfam10412"
                     /db_xref="CDD:255970"
     misc_feature    complement(27643..28839)
                     /locus_tag="DSY0028"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(28801..28809,28819..28824))
                     /locus_tag="DSY0028"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(27961..27966,28732..28737,28741..28743,
                     28801..28809,28819..28821))
                     /locus_tag="DSY0028"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(27628..27984)
                     /locus_tag="DSY0028"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; pfam12696"
                     /db_xref="CDD:257230"
     misc_feature    complement(27964..27978)
                     /locus_tag="DSY0028"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(29216..30622)
                     /locus_tag="DSY0029"
                     /db_xref="GeneID:3953546"
     CDS             complement(29216..30622)
                     /locus_tag="DSY0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516262.1"
                     /db_xref="GI:89892775"
                     /db_xref="GeneID:3953546"
                     /translation="MHFSDDQKYRANNVDLVDFLQRRGEKLIPSGRDKRLASDRSITV
                     RGNEWYDHSAESGGYAIDFVRQFYGLSFPEAVTILLGGEQGEVYRPASQKKQEPKQPF
                     ALPNPHSDMRRVYAYLTKTRLIDREVVSYFARAKLLYESCEKSKDGMKEYHNAVFVGY
                     DENGVPHHAHKRGLYTEGTGFKGNVDSCDPAYSFHHIGTSNRLFVFEAPIDLLSYITL
                     HPKDWQNHSYVALCGVSEYAMLKMLELHPNLNHVVLCLDHDEAGIEASEKYHDLLLEK
                     GVSCDRDLSVHKDWNEDIKANHGLPAIPAEEHPQHLIRDEICRELTETAMTVKSNCSA
                     NTLSALLMKALSYLHWGQFSEADECLREICRLSVAAAAREYRQMDHSRDISAVQSRLH
                     SGFRTYENRGHLKTRLDLLESDIMALRGFERVVAADEKEKLAECYEHIAAHGLKGVIL
                     LEKHRQKMEQTQEMKLSM"
     misc_feature    complement(30023..30277)
                     /locus_tag="DSY0029"
                     /note="Protein of unknown function (DUF3991); Region:
                     DUF3991; pfam13154"
                     /db_xref="CDD:257525"
     misc_feature    complement(29741..30013)
                     /locus_tag="DSY0029"
                     /note="Toprim-like; Region: Toprim_2; pfam13155"
                     /db_xref="CDD:257526"
     misc_feature    complement(order(29840..29842,29846..29848,29852..29854,
                     29990..29992,29999..30004))
                     /locus_tag="DSY0029"
                     /note="active site"
                     /db_xref="CDD:173773"
     misc_feature    complement(order(29852..29854,30002..30004))
                     /locus_tag="DSY0029"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173773"
     misc_feature    complement(<29234..29380)
                     /locus_tag="DSY0029"
                     /note="THUMP domain, predicted to bind RNA; Region: THUMP;
                     cl12076"
                     /db_xref="CDD:264537"
     gene            complement(30781..33660)
                     /locus_tag="DSY0030"
                     /db_xref="GeneID:3953547"
     CDS             complement(30781..33660)
                     /locus_tag="DSY0030"
                     /note="similarity to COG0790 TPR repeat proteins(Evalue:
                     7E-33)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516263.1"
                     /db_xref="GI:89892776"
                     /db_xref="GeneID:3953547"
                     /translation="MARIIVKNGYLKGGSEKTSAHLNNLVKYIATRDGVEKIKNGREL
                     WHATKKQQTLIGEILREFPDAKEMFEYEDYLANPNRENASEFITIALEQHLDKIGDRE
                     KYLDYIANRPRVEKFESHGLFTAGDAPLVLSQVAEEVAAHTGNVWTPIISLRREDAAR
                     LDYDNAAAWKALLSSKAMELAENLKIHPDHLKWYGAFHNESHHPHIHMVCYSTDPREG
                     YLTKQGIRKMKSSLANEIFRQELIPLYGEKTQRRDELKEQSAESLRELIRQIKGGVLV
                     SERMEQLLTHLAERLQTVSGKKQYGYLKPELKNVVDEIVDDLAQDSRVSEAYRMWWET
                     KGRIESIYTETPSEPPPLSHCDDFKPIRNMVIQEALLIGNMTFEEPASVETALPEPEN
                     DLEMSLSDIEDEEDQEPIDDSVGRPSSDEASAGKESSDSWWTEEYRQAKQYLCGDEDA
                     GVPQDFRKAHELFMAEADKNNPLALYDLGRMSADGLGCEADADAAYGWYEKALVVLHA
                     AEEAKPWKYTEYRIGKMYAAGLGAEQDYLQASDWLTLSADKKYKYAQYSLGGLYYHGK
                     GVEQDHVTAFALYTRSADQSFPYASFELGKMLRDGIGCAKNQQDSDRRFKEAFLGFVS
                     LEEQSHDDKLQYRLGWMLLNGIGTDKDEARAKEYFEKAASVGNPFACYQLAKFILSDE
                     KAQPQDVEKALGYLRKAVEAENPYAAYFLGKLYEKGQHVPQNTAEAMRLYTLSAEQDN
                     EFAAYRLGKLYLDGDGVLKDVESAIRWLTFAADRKNQFAEYALGVLYFKGEDIPKDVP
                     KALEYLKRSAGQGNQFAQYRLGKIYLMGEDVPKDIQTALQFLTAAAEQGNQYAQYTLG
                     KLYLIGKDVPKDKETAVRWFTLSAAQGNIYAQFFLDHIDNFKDPSVLLAGTRLLHHMS
                     RIFADNAPPLKLPGQRTDRKLLRKLREKKQAQGHARDDHEQTMSL"
     misc_feature    complement(31540..32340)
                     /locus_tag="DSY0030"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(32008..32106)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31906..32001)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31087..31845)
                     /locus_tag="DSY0030"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(31660..31758)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31441..31548)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31333..31434)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31225..31326)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31117..31218)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(31009..31110)
                     /locus_tag="DSY0030"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            complement(33660..34292)
                     /locus_tag="DSY0031"
                     /db_xref="GeneID:3953548"
     CDS             complement(33660..34292)
                     /locus_tag="DSY0031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516264.1"
                     /db_xref="GI:89892777"
                     /db_xref="GeneID:3953548"
                     /translation="MVEKRAGERRVVASDRPPTTSPSSAGRFSYLDMRWSDWGFVTVR
                     VVASCENTRKQRNLHGHLAGGHSRNGGFHMKNNKERTAVWLYPETMERLDGWLIQDNC
                     KSRSEFIEKALCFYMGYLGTEDTSSYLSKALLSSMEGTLQKTENRVAGNLFRLSVEIS
                     MMMHLLATTLDISDEELHRLRGRCVAEVKKTKGKIRLDDAVEFQSRADDE"
     gene            34384..35025
                     /locus_tag="DSY0032"
                     /db_xref="GeneID:3953549"
     CDS             34384..35025
                     /locus_tag="DSY0032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516265.1"
                     /db_xref="GI:89892778"
                     /db_xref="GeneID:3953549"
                     /translation="MPLRLLKWHTGADRGQRWGNGVLSHGRRLGEALFLHKRITILRQ
                     GDSIFLPAIRIHLGVKHRLFRIVHGIAACFLAAITPVQFDVQRIADLPRLHVKVGVYI
                     EPIIVPRRLHVGSEYRVHIKICVDIKVEPPVHFHDFIGEREVFFFEPGGCCQLRVMHL
                     CRRISAHWLTSRGSLAAAAVLFSLCFFGEAVVEASSSAPSSMYSRTVAGTYFS"
     gene            complement(35159..35494)
                     /locus_tag="DSY0033"
                     /db_xref="GeneID:3953550"
     CDS             complement(35159..35494)
                     /locus_tag="DSY0033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516266.1"
                     /db_xref="GI:89892779"
                     /db_xref="GeneID:3953550"
                     /translation="MSRGRHPKSRKSKTTLPACRRRWAAGLNASAFQTAVCNEEGKLN
                     GMPPNRRLGADIICGPFFVCDTTREGNFASLSKSKVAEYSQLFKEIPEFTGQEPELQP
                     GITFIGFEY"
     misc_feature    complement(35267..>35389)
                     /locus_tag="DSY0033"
                     /note="Domain of unknown function (DUF3846); Region:
                     DUF3846; pfam12957"
                     /db_xref="CDD:257431"
     gene            complement(35549..37057)
                     /locus_tag="DSY0034"
                     /db_xref="GeneID:3953551"
     CDS             complement(35549..37057)
                     /locus_tag="DSY0034"
                     /note="similarity to COG0739 Membrane proteins related to
                     metalloendopeptidases(Evalue: 8E-24)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516267.1"
                     /db_xref="GI:89892780"
                     /db_xref="GeneID:3953551"
                     /translation="MADPATIAAIAKAAVTALSDERTRKTIGWIIAAILSPLILVIVL
                     VCSLLSGTTNHNNTAVELCFHGGVIPGSMPADYREYIGDMRQSFTLIDNAIADVNAEI
                     EGGDSLDDYRVKAIFYSLFFGAESPSRLEHREYVDCFVTYEERTRTVENENGTTSEET
                     YTVAVPIDSLPTVYNNIRTLFDRAITYEDQANANEIYYRARYGTGAPMEGDGAESWED
                     WTPDQIDGFYSDLPVGEAGAEAVRLGLSRLGDPYSQELRGQGDYTDCSYLVQWVYKKL
                     GVNLPGTAAAQGKYCVDNGLTIPKSSLAPGDLVFWSHEPNGRFMNITHVGIYAGDGKV
                     VDASSSRGEVVYRDLFDSGKQVLYARPYAEAPEASASGFVSPLGKSWRSMVTSEFGGR
                     TDPITGQQAGHSGIDLGASKGTSIRSAKAGTVKTVVYGSTGYGYYLTIDHGGGLVTLY
                     GHCSVILVREGQTVKSGETVAKVGSTGRSTGNHLHFEVRVNGAKQNPRNYLP"
     misc_feature    complement(36011..>36367)
                     /locus_tag="DSY0034"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    complement(35999..36268)
                     /locus_tag="DSY0034"
                     /note="NlpC/P60 family; Region: NLPC_P60; cl17555"
                     /db_xref="CDD:266746"
     misc_feature    complement(35552..>35965)
                     /locus_tag="DSY0034"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(35567..35854)
                     /locus_tag="DSY0034"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(37062..37565)
                     /locus_tag="DSY0035"
                     /db_xref="GeneID:3953552"
     CDS             complement(37062..37565)
                     /locus_tag="DSY0035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516268.1"
                     /db_xref="GI:89892781"
                     /db_xref="GeneID:3953552"
                     /translation="MKNKLYIAYGSNLNLPQMAHRCPSAKVVGASEIKDYALLFRGGR
                     SGAVATVEPCEGSSVPVLLWNITPRDEQALDVYEGYPSFYEKQSMELPLDDRTVSAMV
                     YVMTPGHRLGYPSDYYYNTIREGYETAGFDTAVLEQAVDYTEQLMESEPEPEQQSLFG
                     FGGLKWW"
     misc_feature    complement(37251..37550)
                     /locus_tag="DSY0035"
                     /note="GGCT-like domains, also called AIG2-like family.
                     Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
                     formation of pyroglutamic acid (5-oxoproline) from
                     dipeptides containing gamma-glutamyl, and is a dimeric
                     protein. In Homo sapiens, the protein is...; Region:
                     GGCT_like; cd06661"
                     /db_xref="CDD:119400"
     misc_feature    complement(order(37251..37253,37314..37316,37332..37337,
                     37530..37535,37539..37541,37548..37550))
                     /locus_tag="DSY0035"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:119400"
     misc_feature    complement(order(37254..37256,37263..37265,37296..37298,
                     37302..37316,37401..37403,37407..37412))
                     /locus_tag="DSY0035"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119400"
     misc_feature    complement(37332..37334)
                     /locus_tag="DSY0035"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:119400"
     gene            complement(37578..38615)
                     /locus_tag="DSY0036"
                     /db_xref="GeneID:3953553"
     CDS             complement(37578..38615)
                     /locus_tag="DSY0036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516269.1"
                     /db_xref="GI:89892782"
                     /db_xref="GeneID:3953553"
                     /translation="MELQAQDFGIEIEMTGLTRSRAAEVIAEYFGTTKEYEGSFYDAY
                     FARDTSGRKWKVMSDGSLDCQRKEGRRKVSADRNYSVEVVSPICQYGDIETVQELIRK
                     LREAGAFVNSSCGIHIHINAAPFDAPHLRNLVNIMAAKEDMIYKALKVSRGRESHYCQ
                     KIDPAFLERLNRQKPATLDRLKSLWYNGGDGSREHYHHSRYHCLNLHSVFQKGTVEFR
                     AFNGDLHAGKIKAYIQFCLAITAQALNQRSASPTKTQSSNEKYTFRVWLLRLGMIGDE
                     FKTARGHLLDHLEGCIAWKDPEQAQRQKERLREKREAERQQTQAPPEEAVPETEMEAV
                     DEQSPAFTMSM"
     misc_feature    complement(37896..38600)
                     /locus_tag="DSY0036"
                     /note="Putative amidoligase enzyme; Region: Amidoligase_2;
                     pfam12224"
                     /db_xref="CDD:256909"
     gene            complement(38628..39107)
                     /locus_tag="DSY0037"
                     /db_xref="GeneID:3953554"
     CDS             complement(38628..39107)
                     /locus_tag="DSY0037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516270.1"
                     /db_xref="GI:89892783"
                     /db_xref="GeneID:3953554"
                     /translation="MNRLQQQKENKAGLLEDMLSFIRYTPNREADLLAFMEKYQKADC
                     DERPAVLEKLRCCMDGKEYPNPYAESYHYTPEDVSLMGQILDDYIDDLLLAQGDPAAV
                     SECVRDTVLKINALNEECGRYLIDTWRRERLCGFINSAAELAGLSQEKDLTLQHRMW"
     gene            complement(39128..41008)
                     /locus_tag="DSY0038"
                     /db_xref="GeneID:3953555"
     CDS             complement(39128..41008)
                     /locus_tag="DSY0038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516271.1"
                     /db_xref="GI:89892784"
                     /db_xref="GeneID:3953555"
                     /translation="MAAFPIPKIKIRKEETPMARKRTLPSPPQEDVKIKDFLDMIAPG
                     IIKFNTDHFLCGNTYRCVWVLREYPTATEEQAILRHLGEKDGVTLRIYTCQVTAAEEK
                     KIIHNAANKNRMDKSSTNDLQQTVTAESNLQDVVTLVSSMHRNREPLLHCAVFLELTA
                     HDSDGLKLLQTDVLTELVRSKLNVDRLILRQREGFLSVGPASRNVFGSQFERVLPASS
                     VANLYPFNYSGKTDPRGFYLGRDKFGSNIIADFDKRDDDKTNANVLILGNSGQGKSYL
                     LKLILCNILESGKSVLCLDPEHEYVELAENLGGCFIDLMSGRYRINPLEPKTWDEGGS
                     PEDTDAPQAFRQSTKLSQHISFLKDFFRCYKDFSDRHIDVIEIMLGKLYEQFGISDRT
                     DFRKLAATDYPILSDLYALIEAEYKGYDKTKYQLYPPELLQEILLGLHSMCMGAESQF
                     FNGHTNVTSDRFIVFGVKGLLQASRNVKNALLFNVLSFMSDKLLTEGNTASSIDELYL
                     FLTNLTAIEYIRNFMKRVRKKESAVILASQNLEDFNIEHIRELTKPLFSIPTHAFLFN
                     AGNIDKRFYIDSLQLEESEYNLIRFPQRGVCLYKCGIERYNLAVHAPAYKEKLFGTAG
                     GR"
     misc_feature    complement(39257..40231)
                     /locus_tag="DSY0038"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     misc_feature    complement(<40034..40222)
                     /locus_tag="DSY0038"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     gene            41100..41594
                     /locus_tag="DSY0039"
                     /db_xref="GeneID:3953556"
     CDS             41100..41594
                     /locus_tag="DSY0039"
                     /note="similarity to COG1670 Acetyltransferases, including
                     N-acetylases of ribosomal proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516272.1"
                     /db_xref="GI:89892785"
                     /db_xref="GeneID:3953556"
                     /translation="MTKIIDKNMLSLRPIKKEDFSVIEEWLNKDYIKKWYGEPEEWLS
                     EIRNDSGDFGWLNHYIVLYQDMPIGFCQYYDCSKTPPGFEWDSEPKGTFCIDYLIGQE
                     FFLKKGLGSVIVQQLCSLIFKQENPVQIIADPVPENIDSIKLLERNGFTLDPTSGLYK
                     MKIK"
     misc_feature    41127..41552
                     /locus_tag="DSY0039"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    41286..41552
                     /locus_tag="DSY0039"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            41679..41786
                     /locus_tag="DSY0040"
                     /db_xref="GeneID:3955772"
     CDS             41679..41786
                     /locus_tag="DSY0040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516273.1"
                     /db_xref="GI:89892786"
                     /db_xref="GeneID:3955772"
                     /translation="MPLAIQCHHAVCDGYHVGKFVEALRSMAANPKQWL"
     misc_feature    <41679..41750
                     /locus_tag="DSY0040"
                     /note="Chloramphenicol acetyltransferase; Region: CAT;
                     cl02008"
                     /db_xref="CDD:261147"
     gene            41802..42299
                     /locus_tag="DSY0041"
                     /db_xref="GeneID:3955773"
     CDS             41802..42299
                     /locus_tag="DSY0041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516274.1"
                     /db_xref="GI:89892787"
                     /db_xref="GeneID:3955773"
                     /translation="MKNLYLIGGTMGVGKTATCQILKQKLNNSAFLDGDWCWDMHPFQ
                     VTEETKRMVIQNICFLLNNFIRCSAYENIIFCWVMHQQAIIDDILSQLDTVNCTVHSI
                     SLICSEQALRTRLEKDVASGIRAEDVVKRSIERIPLYEKLNTCKVDVSDITPEQATEL
                     ILQHC"
     misc_feature    41817..42200
                     /locus_tag="DSY0041"
                     /note="AAA domain; Region: AAA_18; pfam13238"
                     /db_xref="CDD:257595"
     gene            complement(42350..42952)
                     /locus_tag="DSY0042"
                     /db_xref="GeneID:3955774"
     CDS             complement(42350..42952)
                     /locus_tag="DSY0042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516275.1"
                     /db_xref="GI:89892788"
                     /db_xref="GeneID:3955774"
                     /translation="MEGVNMNRKKKQEAREKASTRQLMGIEGITSHSLATPHGELVFF
                     MIKPTNISVLSDASIGARIYALMNVLKGISDIEMLCLNSRENFEDNKSYLKARMDAEQ
                     NPVIRKLLAQDQTALDRMQVQMATAREFLIIIRLKNEKESDVQPYLSRIEKSLKDQGF
                     TVRKAGESDIKRLLGVYYEQNVTTEVYEDYDGERWVILNE"
     gene            complement(42940..43197)
                     /locus_tag="DSY0043"
                     /db_xref="GeneID:3955775"
     CDS             complement(42940..43197)
                     /locus_tag="DSY0043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516276.1"
                     /db_xref="GI:89892789"
                     /db_xref="GeneID:3955775"
                     /translation="MYLYPDNLRSKATLWLWELRDIGIIGVGLLISVFALSRLGWLPP
                     IVLTAVYAFLSIRFEDVSILDFIRYAAAFFFGKQQTYEWRA"
     gene            complement(43201..45366)
                     /locus_tag="DSY0044"
                     /db_xref="GeneID:3955776"
     CDS             complement(43201..45366)
                     /locus_tag="DSY0044"
                     /note="similarity to COG0270 Site-specific DNA
                     methylase(Evalue: 2E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516277.1"
                     /db_xref="GI:89892790"
                     /db_xref="GeneID:3955776"
                     /translation="MTMGSLFDGIGGFPLAAVRNGIAPVWASEIEAFPIEVTKIRFPE
                     MLHVGDITKLNGAKLPPVDVICGGSPCQDLSVAGQRAGLAGARSGLFMEQTRITKEMR
                     KADEQRNVPAHLVRPRYLVWENVPGAFSSADGEDFRAVIEEIIRIKYSACDVPRPESG
                     RWESAGAALLGDEFSLAWRVMDAQFWGVAQRRRRIFLVADFGGTTAPEILFKQDGLFG
                     DTPESGGPRQGTAAPAEGSADAAGGACLTPWDVQSRRIFEETGTWPALYSGEGGGHGY
                     IQTEEKTAIAFAANQRDEVRDLHDVAGAIQAQPGMKQQTFVAQPLICLNDQGGNRMDI
                     TEEVTSTLRAGMGGHPPLVSQPNCLNGWDTQQSRVFTPEGMAPTLAGADGGGGRNPAG
                     LLFAAGVVSKGDGDCFLMPEVHTAITGGGGQAGQGYPCVLTAGFCGNASAEARGIGYQ
                     AECSPTIKTGTAPSVLCLNDQGGSQMHCTEDITGTLRAQEHGHQPLVFENHGIDSRYS
                     GPHAVAPTMSARMGTGGNNVPLVGTPVAFSLDSKESNSMKSANPYSGCRETDVARTID
                     TGSPDPSKNQGGIAILQETICIAGNTIDREPENGGNGLGCQPDISYTITTSDRHAVCE
                     PYQEVVGALCRGDEKGIGSQYVSQNKCIVERRNLIRRLTPLECERLQGFPDGWTLIPG
                     ASDSARYKALGNSVAIPCVDFVLRGIAYFLQKIYEEQEE"
     misc_feature    complement(<44770..45366)
                     /locus_tag="DSY0044"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cl19095"
                     /db_xref="CDD:267448"
     misc_feature    complement(order(45157..45159,45163..45165,45211..45222,
                     45274..45285,45331..45348))
                     /locus_tag="DSY0044"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(44785..44787,44791..44793,44989..44994,
                     44998..45000,45106..45108,45124..45126,45133..45144,
                     45151..45156,45163..45165))
                     /locus_tag="DSY0044"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(44785..44787,44791..44793,44992..44994,
                     44998..45000,45142..45144,45154..45156,45163..45165))
                     /locus_tag="DSY0044"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(43240..>43431)
                     /locus_tag="DSY0044"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cl19095"
                     /db_xref="CDD:267448"
     gene            complement(45771..46724)
                     /locus_tag="DSY0045"
                     /db_xref="GeneID:3955777"
     CDS             complement(45771..46724)
                     /locus_tag="DSY0045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516278.1"
                     /db_xref="GI:89892791"
                     /db_xref="GeneID:3955777"
                     /translation="MHGVPFLCSQKGGENPMFIWDFVLGTVMDQIIEWLYGQVVGFLA
                     DFFAQMGNMGVELFEMSWVQSIVLFFSYLAWALYGTGLVVSAFETGIEYQHGRGSVKD
                     TALNAIKGFMAVSLFTIVPVELFKLSVNLQSSLTAGITGYGSSFGDLAGNIISELGSS
                     SDIGGAMGSGVFGGLSVITSPILLLFMIIMMGYAVIKVFFANLKRGGILLIQIAVGSL
                     YMFSVPRGYIDGFTQWCKQIIGLCLTTFLQATILAAGLMVLRTHALLGLGLMLSAGEV
                     PRIAGAFGLDTSTKANLMSAVYTAQAAVNTTKTVVQAVAPK"
     gene            47293..48165
                     /locus_tag="DSY0046"
                     /db_xref="GeneID:3955778"
     CDS             47293..48165
                     /locus_tag="DSY0046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516279.1"
                     /db_xref="GI:89892792"
                     /db_xref="GeneID:3955778"
                     /translation="MDTALTLRVACEEGKCLENDQISSLLSQSALVRKLTTDFVDHPL
                     FAVFRIMGLSEIPYMERLPYTQKMVDYINRNIATAQGFSCLGGMEEIVPCYNAMLLEA
                     YCRLGLADSKEAQAALSWIEQYQLFERNQTTSWPHKGVCKHGGCLGKTPCYIGISKTV
                     RALTTYSEFVKHENWNVEKLLVQGTGYMLRHKMFQRLSDGKPISAHITDIMFPQSYAL
                     SLTDLTYIVGKRQLMTSEDSSELLHLLQEKQIAENQWKIDYLYSYKGYVGFESKRKAS
                     EWVSALFPIWLSKS"
     gene            48443..49285
                     /locus_tag="DSY0047"
                     /db_xref="GeneID:3955779"
     CDS             48443..49285
                     /locus_tag="DSY0047"
                     /note="similarity to COG2207 AraC-type DNA-binding
                     domain-containing proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516280.1"
                     /db_xref="GI:89892793"
                     /db_xref="GeneID:3955779"
                     /translation="MKMRGNDLITQNDKQFNMFPSHIGLRKYILYYNIVFPENDTFMA
                     QYTLMPNACGTLSLAFDGTAVIAELWGASLTPVLLGMEPNNYHVLLLIQLSPYGLYQI
                     THQSQAEFAGKRLSLVDIDNELFHSLYQAFIMSKTTIELVNTCEKILYRRMENPLISD
                     ALLLATTVISDSCGQVQVKEVARQCGYSERQLNRLFLTQIGINIKNYARLTRFNYVLK
                     HIQTSPCFFAALSQQAGYFDQAHFDKDFKAISGVSPQDYLKTMSDFYYDGMGIYDTIS
                     SKED"
     misc_feature    48944..49069
                     /locus_tag="DSY0047"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    48974..49216
                     /locus_tag="DSY0047"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            49289..49759
                     /locus_tag="DSY0048"
                     /db_xref="GeneID:3955780"
     CDS             49289..49759
                     /locus_tag="DSY0048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516281.1"
                     /db_xref="GI:89892794"
                     /db_xref="GeneID:3955780"
                     /translation="MKYQGCLLAVKNIAASKQFYEKVLHQNVVMDIGVHVTFEGFSLQ
                     QGYAELVGLADDSVKEQSHNFQVYFEVEDLDKVYAEMKSISDLQWVHEIKEYPWGQRD
                     IRVYDSDKHIVEIAEDMNTVIKRFLKQGMPVEEVAKRTMFPLEVVKQYSLCFDK"
     misc_feature    49289..49645
                     /locus_tag="DSY0048"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_23; cd09011"
                     /db_xref="CDD:176713"
     gene            49756..50541
                     /locus_tag="DSY0049"
                     /db_xref="GeneID:3955781"
     CDS             49756..50541
                     /locus_tag="DSY0049"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516282.1"
                     /db_xref="GI:89892795"
                     /db_xref="GeneID:3955781"
                     /translation="MTNSGFGKSKPLFYSKRRRVSMNWEPWTGCYKISDGCTNCYFYG
                     PHAKRYGQNTIQKTDKFDWPIRKTAKGEYNIKGNKILATCFATDFFLPEADEWRKEVW
                     SIIKERTDIDFLILTKRIDRFLISLPSDWGAGYDNVNIGCTVENQRLADERLPLFLSY
                     PIKRRFIACAPLLERIDLTPYLHGIDHVTVGGETGREARVCDYDWVLNIREQCVKANV
                     TFWFKNTGSLFKCDGVVEKINPFKQTSIAKDFDINILDGKRLF"
     misc_feature    49819..50448
                     /locus_tag="DSY0049"
                     /note="Phage protein Gp37/Gp68; Region: Gp37_Gp68;
                     cl15384"
                     /db_xref="CDD:265684"
     gene            complement(51538..53325)
                     /locus_tag="DSY0050"
                     /db_xref="GeneID:3955782"
     CDS             complement(51538..53325)
                     /locus_tag="DSY0050"
                     /note="similarity to COG3344 Retron-type reverse
                     transcriptase(Evalue: 1E-46)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516283.1"
                     /db_xref="GI:89892796"
                     /db_xref="GeneID:3955782"
                     /translation="MQNHSSDRSYTFERLYRNLYNRELFLLAYQNIYASQGNMTKGTD
                     GKTIDAMSLNRIDGIIASLKDESYQPQPSRRTYIPKKNGKLRPLGIPSFDDKLVQECV
                     RLLLEAVYEGSFAKTSHGFRPNHSCHTALSQVQVCFTGVKWFVEGDIKGFFDNINHEV
                     MIGILAEHIKDERFLRLIRKFLKAGYLEDWQYHNTYSGTPQGGIISPILANIYLDKLD
                     RYMEELKKRFDKGKARAVYPETYELEKKRGVLAKKLRNTNSEEEKQVLTEKIREIDRK
                     KLTIPYSDPFDTSFKRLQYVRYADDFLIGVIGSKEDAIAIKEQVKAFVADMLILELSD
                     EKTLITHSEKRARFLGYDIYVRRSAATKKDKTGRLCRHLNGTVCLEMPTELMRKKLLE
                     YGAMTIEKTVYGKDNWKAKARYYLKDNDDLEILDQYNSEIRGFRNYYRIANNAAHASS
                     FGYIMQYSMFKTFATKYRTTMRRMIGKLRTGKNFGVRFTDKKGKTKTRLFYNEGFARK
                     PLQKNAVVDVIPKTVMYSSKTSLMARLSAGQCELCGKTDCEIEIHHVRKLKDLKGKSY
                     WERFMIARNRKTLALCLDCHEKLHSGKLN"
     misc_feature    complement(52267..53106)
                     /locus_tag="DSY0050"
                     /note="RT_G2_intron: Reverse transcriptases (RTs) with
                     group II intron origin. RT transcribes DNA using RNA as
                     template. Proteins in this subfamily are found in
                     bacterial and mitochondrial group II introns. Their most
                     probable ancestor was a retrotransposable...; Region:
                     RT_G2_intron; cd01651"
                     /db_xref="CDD:238828"
     misc_feature    complement(52267..53094)
                     /locus_tag="DSY0050"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:249567"
     misc_feature    complement(order(52276..52281,52423..52428,52432..52434,
                     52720..52725,52867..52884))
                     /locus_tag="DSY0050"
                     /note="putative active site [active]"
                     /db_xref="CDD:238828"
     misc_feature    complement(order(52426..52428,52723..52725,52867..52884))
                     /locus_tag="DSY0050"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238828"
     misc_feature    complement(52720..52722)
                     /locus_tag="DSY0050"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238828"
     misc_feature    complement(51832..52206)
                     /locus_tag="DSY0050"
                     /note="Type II intron maturase; Region: Intron_maturas2;
                     pfam01348"
                     /db_xref="CDD:250552"
     gene            complement(54255..54572)
                     /locus_tag="DSY0051"
                     /db_xref="GeneID:3955783"
     CDS             complement(54255..54572)
                     /locus_tag="DSY0051"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516284.1"
                     /db_xref="GI:89892797"
                     /db_xref="GeneID:3955783"
                     /translation="MEMTVMKEGHPYVDTRGFLQRYSAFVPDDYIILKLEQRHQNGEW
                     VRWNQEMPRGCSAELLAQAEEFSALKKGFRGDLKFYQNPQVLAVAPLLEEQTPGMDMT
                     MQL"
     gene            complement(54739..56364)
                     /locus_tag="DSY0052"
                     /db_xref="GeneID:3955784"
     CDS             complement(54739..56364)
                     /locus_tag="DSY0052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516285.1"
                     /db_xref="GI:89892798"
                     /db_xref="GeneID:3955784"
                     /translation="MTAFADTGGSGNIDGGGGGMGQGTSTNSWNGGNEGVRVTVVRAS
                     DHAVVTTPFDFTNKAPSAGIYHFGKVSKLQYNNGVSLSPVKGGYVYKNPGQTMPRIIS
                     TNGSNNIEIIKKYFCSEYVVKRIAEITGMNYDVLIGGEYKILLEPLAYYKFEGNMFAT
                     TATEAALYDEQTSGLLRRRMVSLTHKNLPLAMFLEVSDLGYPAWGGSKTSAATNADIK
                     SSLGLGIVRFEEKPEAPQIEAYDYEYRVNTDVITAVRISGGQSDPDNPTRISFNIGGK
                     NYNVGNVYYPDGDSQLAWVKWTTPDTEQNMTIDVTVSGPGSTAKTTLNVKIVDLDKNP
                     PPNPVADDRNDSFSHTPVPSRAVKSTASWSVWSPWWQEYWVWHGDDEDGYWCDHGWWE
                     FDLDRYSASLTANMSIQCDSKNPTASGRTMKSGYGINQTVAGSVSSNQSSAVTQPQNA
                     VSYFPEFGYETYWRLLERMGSGRFEFQVNSYSTYKNRTHFSPIWMPDGAYTINTWLID
                     AWTPDGMLSANLTNSLTIRGNLWQDWHAGPIQP"
     gene            complement(56495..57049)
                     /locus_tag="DSY0053"
                     /db_xref="GeneID:3955785"
     CDS             complement(56495..57049)
                     /locus_tag="DSY0053"
                     /note="similarity to COG0810 Periplasmic protein TonB,
                     links inner and outer membranes"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516286.1"
                     /db_xref="GI:89892799"
                     /db_xref="GeneID:3955785"
                     /translation="MKNMNPKIKKWLAVAGGLALCAVLVVLIGQRFHTEKPVDDPLPS
                     QSSEVSDVTVDPNEPDSTKEKEVSVTLPDTSQPTSTDNGAVSGGTEQTIQSDAIKPEY
                     TENQLKDPTQKPNGEKVPEPPTAVDHDKVEQPKETPKSESTSKPSGGGNSIPGFDNVP
                     DGGANHGEVVDGDGDINKQVGIMD"
     gene            complement(57160..57708)
                     /locus_tag="DSY0054"
                     /db_xref="GeneID:3955786"
     CDS             complement(57160..57708)
                     /locus_tag="DSY0054"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516287.1"
                     /db_xref="GI:89892800"
                     /db_xref="GeneID:3955786"
                     /translation="MTDIIKKILRGKGGAGFPLIIAITLSLVIIFTGISEYFRLMIIA
                     QGVRDAVQAAVISTVVENYDDVYHGVREGYSGAYQPYAGDFEESLDYGDIYDRLDGIL
                     GLSNSSGYHEKRTPDGKLEFKVWNLDVDIRNAPLASGDQASARFEADSTILLEVPVSF
                     GGKLLPPMTIKVKTSAGYIPRF"
     gene            complement(58094..58801)
                     /locus_tag="DSY0055"
                     /db_xref="GeneID:3955787"
     CDS             complement(58094..58801)
                     /locus_tag="DSY0055"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516288.1"
                     /db_xref="GI:89892801"
                     /db_xref="GeneID:3955787"
                     /translation="MKSLHPSAGCSKGGANQVTEQEMMTLLRKKLDSGMALYQKEWQK
                     RSASELVDMASEIAAAKFVYGELSGGSYSSEYMEYLLRFENPLEVVKDQWISEQTVDF
                     SEELTHALWTLWDKGESESEYTLDPEYAPVSAEEARITLWEFIEAHPNAAFDMMTPGG
                     YVYLTPETAQLLLSGHSVKGNPDSAEFARDIPAEELLEQEICTADFSKGAWRILSDRN
                     PEPRQAQEPFEQGVTMC"
     gene            complement(58767..59537)
                     /locus_tag="DSY0056"
                     /db_xref="GeneID:3955788"
     CDS             complement(58767..59537)
                     /locus_tag="DSY0056"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516289.1"
                     /db_xref="GI:89892802"
                     /db_xref="GeneID:3955788"
                     /translation="MLSAGKQAKAKPKTTDVLLRNAAVRLARYIRMDEYKKSRMANVL
                     SAAGLSDSPELFTAMAIVKAAAIALCILPCLIVLPLLAPIVLFAAILVYFKEIRKADE
                     ALAAKRGKIEQELPRFVATITQELKASRDVLSMLENFKRNAGEDFAAELDILTADMRS
                     SSYEAALTRFEARFNSPMLSDITRGLIGVLRGDDGGMYFQMLAHDMKQLELQRLKAQA
                     MKIPPKIRVFSFAMLMCFLMTYMAIIVYEIVTSLGGMF"
     gene            complement(59650..60579)
                     /locus_tag="DSY0057"
                     /db_xref="GeneID:3955789"
     CDS             complement(59650..60579)
                     /locus_tag="DSY0057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516290.1"
                     /db_xref="GI:89892803"
                     /db_xref="GeneID:3955789"
                     /translation="MTTVLLIACIGMIAGSFILLGLTPIEFTTAVFGKLTDRPKSLRD
                     EVGEFTHRKKQSYLRRQIAEVQSILKVTGRTARFPMLCALSLLFFAVGASIAVMLSNF
                     FLVPVMAMGCMLLPFWWVKLTASHFKKDIAAELETALSIITTAYLRNEDILTAVEENL
                     PYLNPPVLSVFKGFVSRVRLVDPNVTAALHDVKMRIDNAVFHEWCDALISCQHDRSLK
                     TTLTPIVSKLSDMRVVNGELENMVFEPRKEFIIMVVLVVGNIPLMYFLNQDWYHTLMH
                     TPLGQIVLTICAAVIFVSTAFVIKFTQPIEYRR"
     gene            complement(60576..62183)
                     /locus_tag="DSY0058"
                     /db_xref="GeneID:3955790"
     CDS             complement(60576..62183)
                     /locus_tag="DSY0058"
                     /note="similarity to COG0630 Type IV secretory pathway,
                     VirB11 components, and related ATPases involved in
                     archaeal flagella biosynthesis(Evalue: 6E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516291.1"
                     /db_xref="GI:89892804"
                     /db_xref="GeneID:3955790"
                     /translation="MLGKKRNPSLFSSDKKSSQAVPQEPKTFENMDISPDANTIQVVV
                     LNETTELTIPENLTQYSSYDGTIPPEMQEPPKRTVLAEVTVGHRAQSLFFTPEAEGKD
                     FSSVLADVQEYISEHYSTLITTGGEDAKAQLKRYITKYVQDHRISVNGMSGGKLADTL
                     YTEMAEFGFLTKYIYGTGIEEIDINSWRDIEVQYSDGRTVKLEERFESPQHAVNVIRR
                     MLHISGMVLDNASPIVLGHLSKNIRIAVLKSPIVDEDVGVAASIRIVNPQSMKKEDFV
                     KSGTATDPMLDFLSLCVRYGISVCVAGATSSGKTTVAGWVLTTVPDNKRIYTIENGSR
                     ELALVREKDGKVVNSIIHTLTRDSDNERQRIDQTNLLDYALRFNPDIIVVGEMRGAEA
                     NAAQEAARTGVAVLTTIHSNSCEATYRRMVSLCKRAVDMSDATLMDYVTEAYPIVVFC
                     KQLENKQRRMMEIQECEILPDGTRCYRPLFQYVITENRMEDGKFIIEGHHEQINSISD
                     SLAKRLLENGMPQPVIESLRGKEAQSA"
     misc_feature    complement(60912..61697)
                     /locus_tag="DSY0058"
                     /note="Type IV secretory pathway, VirB11 components, and
                     related ATPases involved in archaeal flagella biosynthesis
                     [Cell motility and secretion / Intracellular trafficking
                     and secretion]; Region: VirB11; COG0630"
                     /db_xref="CDD:223703"
     misc_feature    complement(order(61254..61262,61272..61277))
                     /locus_tag="DSY0058"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(61026..61031,61191..61196,61200..61202,
                     61254..61262,61272..61274))
                     /locus_tag="DSY0058"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(61029..61043)
                     /locus_tag="DSY0058"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(62177..62644)
                     /locus_tag="DSY0059"
                     /db_xref="GeneID:3955791"
     CDS             complement(62177..62644)
                     /locus_tag="DSY0059"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516292.1"
                     /db_xref="GI:89892805"
                     /db_xref="GeneID:3955791"
                     /translation="MRKGENEYTYPPYEQLQAQELMDGLREIAPFVVVDCGSYIANDI
                     LSAVALMEADSVLRLAGADLKSVSYLSSQLPLLRDSKWDAEKQYKVASNVKPQQAGEQ
                     IGQALGSVAFTLIHSQELEEQYLAGNLLADLSLKDSRLFRREIEKIAKEVFGC"
     gene            complement(62992..63816)
                     /locus_tag="DSY0060"
                     /db_xref="GeneID:3956047"
     CDS             complement(62992..63816)
                     /locus_tag="DSY0060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516293.1"
                     /db_xref="GI:89892806"
                     /db_xref="GeneID:3956047"
                     /translation="MSLFKNRTVVGVICILLSLLICFGVTPLFNKSVSQKTEIVRVVK
                     EIKAGDEITKDTVQTVEVGGFGLPDNVIRQSETVIGKYAKSDLSIGDYILNTKLSDTP
                     AAENAYLYNLDGTKQAMSVTIKSFANGLSGKLQSGDIVSVIAADYKKQGTTVIPAELK
                     YVEVISVTASSGYDANTGEAKSEDDDRELPSTVTLLVSPEQSKVLAELESDGKLHLSL
                     VYRGTPTNTAKFTEAQDKVIAALYPVEVSQDSSSEPKSQESEESTASETPAESEVQ"
     misc_feature    complement(63523..63705)
                     /locus_tag="DSY0060"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     gene            complement(63977..64429)
                     /locus_tag="DSY0061"
                     /db_xref="GeneID:3956048"
     CDS             complement(63977..64429)
                     /locus_tag="DSY0061"
                     /note="similarity to COG1989 Signal peptidase, cleaves
                     prepilin-like proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516294.1"
                     /db_xref="GI:89892807"
                     /db_xref="GeneID:3956048"
                     /translation="MQDNGIAQAVLFFCLLLVASVWDLRKRIIPDSICLLIVLTGLID
                     FSPVRLWGVLAALPLLIAALYKPDGIGGGDIKLTAAAGIVLGFWGCTAGLTLGLMASL
                     FFYFWTQAIRRLRKLEPLKTSQASLPMAPFLSLGFLAVIILRIGGNIL"
     misc_feature    complement(64169..64402)
                     /locus_tag="DSY0061"
                     /note="Type IV leader peptidase family; Region:
                     Peptidase_A24; pfam01478"
                     /db_xref="CDD:250649"
     gene            complement(64662..68657)
                     /locus_tag="DSY0062"
                     /db_xref="GeneID:3956049"
     CDS             complement(64662..68657)
                     /locus_tag="DSY0062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516295.1"
                     /db_xref="GI:89892808"
                     /db_xref="GeneID:3956049"
                     /translation="MKKKMKRPLGIILAACLVVSLFAGSAYGVNRYFEDAKGHWAEEA
                     IQILTEKGVISGYPDGLAHPDEIITRGEFAALIARTMELPEPDESEVTIHFVDIAGHW
                     SEQNVEALIIAGIIQKDDFGTKFLPDEPITRMEMIRMLVRAIGKGDHDASCPCVTGFS
                     DDSALSDADKSSICTGKEYGIVNGYPDGTVKPDGKATRAEAFEMLVDTEKAKEQIKKE
                     EPPKPPVVTPTPPVTPKPGDKPSGGGGSSGGSSDGGGSGGGGSSYVHAPQFSFTLPKT
                     AYTADEIEIKPESRYVSGVTWSALKNGLPAELSELTEGTLTANGGKVKFTQTGSITLI
                     ATAENSRGATVTHEQTVSIYPVVTATFTLPETAHTDTAVPVELATENLGINSVVWSLQ
                     KNGAIANIDEALTGELTATGGTVLFKEKGSYTLTASITDELGKTVTVENSITVYPVAE
                     VNLILPAVSHTDKTVALKTETKETDGLTLTYTLTRNSESADISTWIEGNPSAGSIRFK
                     EKGVYALTASVTDATGRVFAGTADITVYPVGSAGFYLPEVFHTDKEVVVEAVFDEIGS
                     HTAKWSLMHDGKEVSLTDAAEGALGNSGGKLKFRSKGSYVLKAEFTDDGGRSYRYEQS
                     FVAYPVPTVTYSLPKYAHTDTDIVVKTEAADLDGLTIEWLVDNTFGFQDWPTYVDGKL
                     SNDGGTIRFKRAGIYELVARITDDTGRVFLYESKDRCEVLPVLTIGFELPAFAYTDTA
                     IDLRTHGNNNVLPVEWSVSKNGKSIRLSEAFNGNLTPQGGKITFKGDGEYVLTAAMTD
                     YLKRSYSHSESIRILPVVQYAFTMPQTVHYGAEFTVAAKDVQHIGSYAAVWTLQKDGN
                     TAPYQGTLGNDGGKIAIRDTGAFTLTASVTDREGRVTTHSERITVTNTAPNAPVVKAE
                     PTRTAKDGKFLVTITANATDPDGDAVTLEYADTAADSYYALGTHTIRVRAKDIAGAYS
                     AWTEKTFTVTNAAPTVTLTAVPSRTVKDGKFHVDISATAADADGDATTLEWENKAADG
                     YYSPGTHTVKVRAKDIAGVYSPWAEKTFTITSSAPTVTLTAAPTRTASGGKFLVNITA
                     KATDVDDDATTLEWENKADDNYYAVGTHTVRVRAKDATGLYSQWVSKTFTIANSAPTA
                     PVITRTPGGNSVAPGTPVTITATSSDPDGDAVTLIWEGRNTETQTYPRGKNVVRVKAV
                     DSAGAESPWAAIVFFVADSNGGGGMTLTGPDSVIMENGIEGATITEYTFTVPPVSGHS
                     GSDFGRVRGYNKLTGQWDQLDYGTTSNGITFTRSFGAGVYTQLEMYYYTNHDCMYNKS
                     NITYSVTYHFE"
     misc_feature    complement(68436..68561)
                     /locus_tag="DSY0062"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(68247..68375)
                     /locus_tag="DSY0062"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(68055..68183)
                     /locus_tag="DSY0062"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(68668..69027)
                     /locus_tag="DSY0063"
                     /db_xref="GeneID:3956050"
     CDS             complement(68668..69027)
                     /locus_tag="DSY0063"
                     /note="similarity to COG2088 Uncharacterized protein,
                     involved in the regulation of septum location"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516296.1"
                     /db_xref="GI:89892809"
                     /db_xref="GeneID:3956050"
                     /translation="MPKNTTPAVPKYDVKIHSIRPEGSCKATASVNIYGDFAVRGIKI
                     MDGSKGLFVSMPSYKAGNGEYRDICFPCTKDAKAEFDKAVLGAYQQALTQGQATAQKQ
                     EFPEPQQAQSQPVMGGM"
     misc_feature    complement(68752..68991)
                     /locus_tag="DSY0063"
                     /note="SpoVG; Region: SpoVG; pfam04026"
                     /db_xref="CDD:146585"
     gene            complement(69381..69950)
                     /locus_tag="DSY0064"
                     /db_xref="GeneID:3956051"
     CDS             complement(69381..69950)
                     /locus_tag="DSY0064"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516297.1"
                     /db_xref="GI:89892810"
                     /db_xref="GeneID:3956051"
                     /translation="MGGENMPGITLKNGLISYYGNPAGYTEKEKAVVDSIFQNDELST
                     WLKNRSLTPQWTDGVMERLLAGEHPGCIETAAPLKNVRIWQLKPDVDIHMKFIPYEEM
                     VRQFGNPSPEHYRIAYDGQLNTNDLETIYARCNVNHPPGYDGHSLSMSDIVELYDDSG
                     SEFHYCDRFGFQKISFGEPEQTQTMGMSM"
     misc_feature    complement(69423..69719)
                     /locus_tag="DSY0064"
                     /note="YodL-like; Region: YodL; pfam14191"
                     /db_xref="CDD:258387"
     gene            complement(69977..70357)
                     /locus_tag="DSY0065"
                     /db_xref="GeneID:3956052"
     CDS             complement(69977..70357)
                     /locus_tag="DSY0065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516298.1"
                     /db_xref="GI:89892811"
                     /db_xref="GeneID:3956052"
                     /translation="MTIHLAKACGLCNNCSDEKSEAGAECDCGNNPSEWVANCSLCHD
                     LLDESQSIHIPDYLLEEAGIPKGAKLEAYTDGNSGEITVVEADIQQDLGDVPPCILSV
                     LAQSGICLAALDELIMQESIIYGK"
     misc_feature    complement(<70073..>70186)
                     /locus_tag="DSY0065"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cl01709"
                     /db_xref="CDD:261038"
     gene            complement(70565..71563)
                     /locus_tag="DSY0066"
                     /db_xref="GeneID:3956053"
     CDS             complement(70565..71563)
                     /locus_tag="DSY0066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516299.1"
                     /db_xref="GI:89892812"
                     /db_xref="GeneID:3956053"
                     /translation="MKMDKNTFWQIIDSVNSEVSGSDLEGVLRVTQEKLEDYNPQEIA
                     AWANFLGQYRDFADTSGVFAASCILNDYMSDDGFMDFRAWLISRGKEVYLAALKNPDT
                     LAGIDIPEDTRFESYGYVAYDAYREICEDDVYAEMDANPLTKAQKDDIRAEIEYYPHE
                     VDGTHIKDHLPNLCAKHLESLEEFHFTYREGPERMLHMTDLEKLKSAAKLIESMTGSR
                     FKSYGGGSFIYPESSSDSYLAINMRRETDFDANLYRIHFDVNIQTTGSHPMDSTELMR
                     LQREVGVAHALLTALEMQTYSLTPEEMQAFDDFIREQEELRETQEQTGAPIMGQTF"
     misc_feature    complement(71180..71557)
                     /locus_tag="DSY0066"
                     /note="Protein of unknown function (DUF4240); Region:
                     DUF4240; pfam14024"
                     /db_xref="CDD:258259"
     gene            complement(71560..72390)
                     /locus_tag="DSY0067"
                     /db_xref="GeneID:3956054"
     CDS             complement(71560..72390)
                     /locus_tag="DSY0067"
                     /note="similarity to COG0338 Site-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516300.1"
                     /db_xref="GI:89892813"
                     /db_xref="GeneID:3956054"
                     /translation="MSWIGGKKALRELIVTLFPLYYERYIEVFGGGGWILFHKFPGND
                     FEVYNDFNGLLVNLYRCVREKPEELMDALRYVLNSRADFELVRNALARDSPASDVQRA
                     AWFYQLIRYSYASGLTSYGSQPHDMRSNFPLIEQAHRRLAKVVVENKDFERLIGQYDR
                     PVSFFYCDPPYFETESYYKNVGEDGFTEKDHIRLRDALMRAQGKFLLSYNDCGFIRDL
                     YDAPGIQIDSYTRINNIKQRYDNGAQFPEILIANYDMQERMRDGPMQLNLFGEGGFLE
                     "
     misc_feature    complement(71626..72384)
                     /locus_tag="DSY0067"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dam; COG0338"
                     /db_xref="CDD:223415"
     gene            complement(72399..72734)
                     /locus_tag="DSY0068"
                     /db_xref="GeneID:3956055"
     CDS             complement(72399..72734)
                     /locus_tag="DSY0068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516301.1"
                     /db_xref="GI:89892814"
                     /db_xref="GeneID:3956055"
                     /translation="MMPQEQLAEYLHRYHHGAENAVTSKTMEYAFRISGKELRDLVNA
                     LRREGIPIASDQSGYFYAKTEAEVRLTIRHMKSRISGINAAITGLKRSLAAFDDTQIR
                     LPLEGGDDF"
     gene            complement(72935..74191)
                     /locus_tag="DSY0069"
                     /db_xref="GeneID:3956056"
     CDS             complement(72935..74191)
                     /locus_tag="DSY0069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516302.1"
                     /db_xref="GI:89892815"
                     /db_xref="GeneID:3956056"
                     /translation="MDKQLENMPPEQCLFMKVEISRPGSFGAETSSTLTLPAAPYEIL
                     DALDKARITDERVIYSAEVIGCELDYLPQFIGTNANLYELNHLAERLSSLSAGELDCF
                     EGMVMMDTIQTQYSPIAIDRLINMTHSMKDCHVVYEAHDDSTLGKFYADNDFVQKLEN
                     VPDEIYECLDFGKIGKEMREGEGGVFTPHGYVIQNGEIAAEYHSGDAVPLEKLDYTML
                     LRVTKGDFNDPQYDNDLVAFLKLPADDKMLSQAVEVVEAASPEECVFSAVDCMIPSLT
                     EKINDALYESDGDCYGLVNELAEQLQRINNKGNISTYKAMMEVVQTEISLEDALDLSQ
                     EIEKFSVIREAASPADYARSMLSKYCIEYESELFSRTDLYGYGSKLMEEKEVALTEYG
                     VLWSLTGQTVEQCLNRPSQSHGMEMK"
     misc_feature    complement(73616..>73978)
                     /locus_tag="DSY0069"
                     /note="Antirestriction protein (ArdA); Region: ArdA;
                     cl01953"
                     /db_xref="CDD:242798"
     gene            complement(74184..74912)
                     /locus_tag="DSY0070"
                     /db_xref="GeneID:3956057"
     CDS             complement(74184..74912)
                     /locus_tag="DSY0070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516303.1"
                     /db_xref="GI:89892816"
                     /db_xref="GeneID:3956057"
                     /translation="MRDYQGLLKFVKEQYPPGTRIRLIEMQDPYAPVPPGTEGEVDFI
                     DDAAQIHMKWSNGRSLALIPGVDRFTVIPQHLQTLKLYMPLAVMQYERDELGSLEEYP
                     SELDQGTVLSYHDQILAAILKERTPEKTERGLMKYYHEDDGVGQKVKSLFFTVEQVGS
                     KLMGVAECRVQGDLGDAELEQLKDYVSGQASDGFGEGFEQHPIKVGSDELYVSLWTAS
                     KGWSISTKDELEATGQQMGGMQLG"
     misc_feature    complement(74268..74534)
                     /locus_tag="DSY0070"
                     /note="Domain of unknown function (DUF4314); Region:
                     DUF4314; pfam14192"
                     /db_xref="CDD:258388"
     gene            75494..76615
                     /locus_tag="DSY0071"
                     /db_xref="GeneID:3956058"
     CDS             75494..76615
                     /locus_tag="DSY0071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516304.1"
                     /db_xref="GI:89892817"
                     /db_xref="GeneID:3956058"
                     /translation="MCQFVLRCPSGPGAFILRSRFMKPKIYKTYRQLISILRSRGLNI
                     KQGSAGSRTMRILEKENYYNVINGYKDLFIQTPATDMTDEVYKTTATFDEIFALYSFD
                     REIRIIYLKYILKLENHFKTVVSHCFSQKYGHDNYLKLSSFQHEASSDSYELSHIAKR
                     NHLDMTADIDKIRQISAEDNVSNVTRLLGDIQQEIARQLNKHHQVVTHYMTQHGYIPL
                     WVLVNVLTFGKVTTFYRNLKEDDKIEIAKQFGINYKELHKYMTMMGFARNVCAHDERF
                     FDIRFSQRLHTKSIKNFSSLKLPRDKSGSYTKGTCDAYAIAIIFTQLLSKPDLKEFVS
                     SMNSEIKKLSKSLVTISADEVLSRMGYTTDWKEILNIVK"
     misc_feature    75656..76327
                     /locus_tag="DSY0071"
                     /note="Abi-like protein; Region: Abi_2; pfam07751"
                     /db_xref="CDD:254405"
     gene            complement(76679..77248)
                     /locus_tag="DSY0072"
                     /db_xref="GeneID:3956059"
     CDS             complement(76679..77248)
                     /locus_tag="DSY0072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516305.1"
                     /db_xref="GI:89892818"
                     /db_xref="GeneID:3956059"
                     /translation="MDMATDYSHLLAEYPEKICQDQFYKICRMSKRKATWLLENGYIP
                     CEDTGKKTRRFKIRITDVIEYLTRLEDSPESLLTPPGIFSSGIKYRPKRQTDIQIDAD
                     EFMEMLKKRWSSSPDALTVDDAVKLTGYCKTTVSEWITKKKLFGVWYYNKYLIPKDCL
                     IEYMATQAHRITQKSEKHMNLIAQYFDGR"
     misc_feature    complement(76748..76894)
                     /locus_tag="DSY0072"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:257254"
     gene            complement(78083..79327)
                     /locus_tag="DSY0073"
                     /db_xref="GeneID:3956060"
     CDS             complement(78083..79327)
                     /locus_tag="DSY0073"
                     /note="similarity to COG3385 Predicted transposase(Evalue:
                     1E-61)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516306.1"
                     /db_xref="GI:89892819"
                     /db_xref="GeneID:3956060"
                     /translation="MQDKDTTQSTFMQAFQPFFSKDLWETIHREVPGLDLRSQKLTTN
                     QLTLLISHAQLQEYRALRKISTSVHHDSLGQAIGLESISHSQISRRLKTLPTQVPEML
                     FKGTLHNVAQKQGYGKIRQQLGKLYMIDASTMSLCLSRYPWAVFRKSKAGVKMHLRLS
                     FDAMAVPDEVLVTPAKTADRKKLDELIVQDQEALNIFDRGYVDYKLFDDYCEKGIRFV
                     TRLKNNAVIEFTGVERPVKEDGLIEEDVDVILGAGSRKMKHTLREVTIDDNVHEPFTI
                     LTNDFNLSAEELGEIYRYRWQIELFFKWLKQHAQIKHFYGTSETAVINQILLALMMYC
                     LLVLLKLEAGYPRDLLTLQRLLIACLFERYEEFLEKLRRRRRKGSKRIRYEEIYRMTE
                     HSILKEEETQWLDDLTYDPVIL"
     misc_feature    complement(78323..78943)
                     /locus_tag="DSY0073"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(78224..>78742)
                     /locus_tag="DSY0073"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     gene            79713..79979
                     /locus_tag="DSY0074"
                     /db_xref="GeneID:3956061"
     CDS             79713..79979
                     /locus_tag="DSY0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516307.1"
                     /db_xref="GI:89892820"
                     /db_xref="GeneID:3956061"
                     /translation="MYIIPIICYNLLEKHGILMRFIGMEYMKVKEAVEKWGLTDRRVR
                     ILCEQERINGVIKKGRSYLIPADAEKPIDGRKLRVKRPVYAMNL"
     misc_feature    79788..79916
                     /locus_tag="DSY0074"
                     /note="Helix-turn-helix domain; Region: HTH_17; cl17695"
                     /db_xref="CDD:248249"
     gene            79976..80383
                     /locus_tag="DSY0075"
                     /db_xref="GeneID:3956062"
     CDS             79976..80383
                     /locus_tag="DSY0075"
                     /note="similarity to COG3177 Uncharacterized BCR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516308.1"
                     /db_xref="GI:89892821"
                     /db_xref="GeneID:3956062"
                     /translation="MIEFTYNSNAIEGNTLTLQETALVLEGITIDQKPLKDHLEAVGH
                     RDAFVYVQQLVSNKVPLEERTIKEVHSLVLMDRPEDKGLYRRIPVRIMGAALEPQQPY
                     SVPKKMKQLINKKRGTMHPLERIAWFHLNAYFF"
     misc_feature    79976..>80362
                     /locus_tag="DSY0075"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    80153..>80368
                     /locus_tag="DSY0075"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            complement(80371..81228)
                     /locus_tag="DSY0076"
                     /db_xref="GeneID:3956063"
     CDS             complement(80371..81228)
                     /locus_tag="DSY0076"
                     /note="similarity to COG2207 AraC-type DNA-binding
                     domain-containing proteins(Evalue: 3E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516309.1"
                     /db_xref="GI:89892822"
                     /db_xref="GeneID:3956063"
                     /translation="MGWIEGISDAINYIEDNITEELTIENISKQAFVSSFYFQKGFAM
                     LCGFTVGEYIRQRRLTLAGSELVSTDRKIIDIALKYGYDSPDSFTKAFLRFHGVTPTA
                     VRKDGAMLKSFAPLKIKFSLEGGFIMDYRIIEKEAFTVMGAAKVFKYDTAGTEIPKFW
                     TEHYQTGKDKIVCGMYGVCVDESMGSDEFEYLIADNYTTSSEIPDGFVTKVIPKHSWA
                     VFACKGAMPTSLQNTNQKIFSEWLPNCKDYEIAAGYNIEMYTNVADYPKGNQDENYYS
                     EIWIPVQKK"
     misc_feature    complement(81064..81189)
                     /locus_tag="DSY0076"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(80917..81168)
                     /locus_tag="DSY0076"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(80914..81027)
                     /locus_tag="DSY0076"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(80380..80844)
                     /locus_tag="DSY0076"
                     /note="Bacterial transcription activator, effector binding
                     domain; Region: AraC_E_bind; smart00871"
                     /db_xref="CDD:214874"
     gene            81434..82000
                     /locus_tag="DSY0077"
                     /db_xref="GeneID:3956064"
     CDS             81434..82000
                     /locus_tag="DSY0077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516310.1"
                     /db_xref="GI:89892823"
                     /db_xref="GeneID:3956064"
                     /translation="MEYKQRDYPLFSACGLNCGLCPRYQMNGASQCPGCAGKDFLAKH
                     PKCGVLSCSQRKEFTYCYQCDEFPCPKYDGADQSDSFITHLHQFRDMEKAKRWGIEAY
                     RQELNEKVSMLEQLLANYDDGRRKSLFCLAVNLLETEDIKHVLEQLTSEVQSDAPLKE
                     KAASAVCLLQAMAEQRKITLKLRKKSKL"
     misc_feature    81461..81655
                     /locus_tag="DSY0077"
                     /note="Protein of unknown function (DUF3795); Region:
                     DUF3795; pfam12675"
                     /db_xref="CDD:257213"
     gene            82587..82928
                     /locus_tag="DSY0078"
                     /db_xref="GeneID:3956065"
     CDS             82587..82928
                     /locus_tag="DSY0078"
                     /note="similarity to COG1733 Predicted transcriptional
                     regulators(Evalue: 7E-22)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516311.1"
                     /db_xref="GI:89892824"
                     /db_xref="GeneID:3956065"
                     /translation="MVSCPTKCPCMEYCPLGSALKIIGGKWKLPILCALHQDGTTRYN
                     TLKRKIAGITNTMLVSSLKELEEDGLIVRRQYMEMPVRVEYTLTDVCDDLMPILKQLA
                     QWGVKVHTKES"
     misc_feature    82626..82907
                     /locus_tag="DSY0078"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     misc_feature    order(82644..82649,82653..82655,82662..82664,82671..82676,
                     82683..82688,82695..82697,82791..82793,82863..82868,
                     82872..82880,82884..82892)
                     /locus_tag="DSY0078"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(82647..82652,82662..82670,82707..82709,82716..82721,
                     82746..82757,82761..82766,82773..82778,82782..82787,
                     82803..82811,82833..82841)
                     /locus_tag="DSY0078"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(82707..82709,82722..82724,82863..82865)
                     /locus_tag="DSY0078"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            83293..83541
                     /locus_tag="DSY0079"
                     /db_xref="GeneID:3954212"
     CDS             83293..83541
                     /locus_tag="DSY0079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516312.1"
                     /db_xref="GI:89892825"
                     /db_xref="GeneID:3954212"
                     /translation="MIDEKVMVNDVLSSVKSSLTFYANTISECANPELRSTIQQIRNN
                     DEASQYQLFQMAQAKGYYKPALMAKDDEIQQTKSQVSS"
     misc_feature    83299..83487
                     /locus_tag="DSY0079"
                     /note="Coat F domain; Region: Coat_F; pfam07875"
                     /db_xref="CDD:254480"
     gene            complement(84171..84443)
                     /locus_tag="DSY0080"
                     /db_xref="GeneID:3954213"
     CDS             complement(84171..84443)
                     /locus_tag="DSY0080"
                     /note="similarity to COG0488 ATPase components of ABC
                     transporters with duplicated ATPase domains"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516313.1"
                     /db_xref="GI:89892826"
                     /db_xref="GeneID:3954213"
                     /translation="MLLGRYNILLMDEPSNFLDLPGIEALEVLMKSYAGTILFISHDQ
                     RLLENVADRIYAISVKILATDKTKLIKTGRSMGNNTLVKRSLLLWR"
     misc_feature    complement(84270..>84443)
                     /locus_tag="DSY0080"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(84405..84422)
                     /locus_tag="DSY0080"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(84387..84398)
                     /locus_tag="DSY0080"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(84312..84332)
                     /locus_tag="DSY0080"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(84445..85908)
                     /locus_tag="DSY0081"
                     /db_xref="GeneID:3954214"
     CDS             complement(84445..85908)
                     /locus_tag="DSY0081"
                     /note="similarity to COG0488 ATPase components of ABC
                     transporters with duplicated ATPase domains(Evalue:
                     2E-70)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516314.1"
                     /db_xref="GI:89892827"
                     /db_xref="GeneID:3954214"
                     /translation="MGFFVVFIFAGKDMENRRGIAISGYPCCCLSFFVDMQIESPSRG
                     WRSAFFIAISNYELCNKKREEPTMELLLKATDIYVEYKGREILSINELELYNYDRIGL
                     VGSNGAGKSTLIKVLLGELALPGCIVKGIGNFAYIPQLTEAAWQESIDHALLGKLGVS
                     RLDTQTMSGGEETRLKVAQALSGQVHGIFADEPTSHLDREGIDFLIGQLQYFSGALLI
                     ISHDRYFLDKVVNKIWELKDGKITEYWGNYSDYLGQKEEERQRQTAQYEQHVMERARL
                     ERAAEEKRKQAQKVDQKTKGAAKKGATESGGRLGHQKTIGSKQKTLYKAAKSMEHRIE
                     SMGDISAPEKARTVRFRQSQALALHNPYPITGTEINKIFDNKVLFEKASFQIPLGAKV
                     AFTGGNGTGKTTLFQMILHREAGIAISPKAEIGYFAQNSYKFNRDQGVMTFMEDHCDY
                     GQSEIRSVLASMGFSPNDIKKNLSVLSGGRAHQIIAG"
     misc_feature    complement(85186..85698)
                     /locus_tag="DSY0081"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    complement(85189..85695)
                     /locus_tag="DSY0081"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    complement(84859..85209)
                     /locus_tag="DSY0081"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    complement(<84622..84819)
                     /locus_tag="DSY0081"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(84700..84723)
                     /locus_tag="DSY0081"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(84622..84624,84697..84705,84709..84714))
                     /locus_tag="DSY0081"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(84622..84633)
                     /locus_tag="DSY0081"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     gene            86162..86368
                     /locus_tag="DSY0082"
                     /db_xref="GeneID:3954215"
     CDS             86162..86368
                     /locus_tag="DSY0082"
                     /note="similarity to COG1476 Predicted transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516315.1"
                     /db_xref="GI:89892828"
                     /db_xref="GeneID:3954215"
                     /translation="MHNKVRILREEWGLTQKELGEKVGVSRQAINAIETGKFDPSLWL
                     AYDLAKLFKVSIEELFLFIEEDRK"
     misc_feature    86168..86338
                     /locus_tag="DSY0082"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(86177..86179,86189..86191,86264..86266)
                     /locus_tag="DSY0082"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(86186..86188,86261..86263)
                     /locus_tag="DSY0082"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(86207..86212,86243..86245,86252..86254,86264..86269)
                     /locus_tag="DSY0082"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            86870..88207
                     /locus_tag="DSY0083"
                     /db_xref="GeneID:3954216"
     CDS             86870..88207
                     /locus_tag="DSY0083"
                     /note="similarity to COG1032 Fe-S oxidoreductases family
                     2(Evalue: 2E-47)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516316.1"
                     /db_xref="GI:89892829"
                     /db_xref="GeneID:3954216"
                     /translation="MKIVLIQPKMNKRPMDTDLKTRMAPPLSLLTLMGLTPEGHEVIM
                     VNENVEKIDYACGAELVGITITLDVMPRAVEIAEEFHRLGIPVVAGGIHVTSSPDECR
                     GYFDAICIGAAERIWARMIEDAEEGRLQQVYHDMTDFRGEEIASPAYHRIDKNRYLYT
                     NIITTSRGCPNRCGFCYNSCRNRMYIRRPVANVLRDIEGLGTRHILFIDDNFIGVPAY
                     TRELLNHLRGRELKWSAAVTTKIADYPDVLDLMAETGCQSLFIGFESINNSSLHGVNK
                     DNQFEKYERIVTAIHSRGIMINASMVFGLDGDEPDVFQRTLDWLVKNKIETLTSHILT
                     PYPGTELHGRMKEEGRILDHELSRYNTAHVVFQPKGMTAEELYKGYLWIYREFYSFPN
                     IWRRRPEHKAQRKSYFLFNIFYRKFGGFTSALARVIPMRAVGRLAARISYRVK"
     misc_feature    86942..88165
                     /locus_tag="DSY0083"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: COG1032"
                     /db_xref="CDD:223963"
     misc_feature    86942..87253
                     /locus_tag="DSY0083"
                     /note="B12 binding domain (B12-BD). Most of the members
                     bind different cobalamid derivates, like B12
                     (adenosylcobamide) or methylcobalamin or methyl-Co(III)
                     5-hydroxybenzimidazolylcobamide. This domain is found in
                     several enzymes, such as glutamate mutase; Region:
                     B12-binding_like; cl00293"
                     /db_xref="CDD:260332"
     misc_feature    order(87053..87061,87065..87073,87143..87145,87215..87217,
                     87224..87226)
                     /locus_tag="DSY0083"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239016"
     misc_feature    87356..87910
                     /locus_tag="DSY0083"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(87374..87376,87380..87382,87386..87388,87392..87400,
                     87491..87493,87494..87496,87578..87586,87653..87655,
                     87773..87775,87863..87868)
                     /locus_tag="DSY0083"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            88300..88704
                     /locus_tag="DSY0084"
                     /db_xref="GeneID:3954217"
     CDS             88300..88704
                     /locus_tag="DSY0084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516317.1"
                     /db_xref="GI:89892830"
                     /db_xref="GeneID:3954217"
                     /translation="MGQYDGNRPAVYRRRSRCFLKSPKRGGGLKVKRLVLSVLLLIIS
                     FFLSIIALKFEMKIMGPEEGYNVPFPAYLMACLLYLLVFCGIYSALNPLFQNYRDNEK
                     YVLTGVFSVLLFVVFRFPLSYLGLIWLNPILY"
     gene            88924..89379
                     /locus_tag="DSY0085"
                     /db_xref="GeneID:3954218"
     CDS             88924..89379
                     /locus_tag="DSY0085"
                     /note="similarity to COG1846 Transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516318.1"
                     /db_xref="GI:89892831"
                     /db_xref="GeneID:3954218"
                     /translation="MNERIDKRKSLIKAISAIDRYSQTYIGRNVKDYNIGQGQWAFLT
                     QLLFNYDGITQEELSELLNIDKANTARALKKLEEEGYVYREEDPKDGRKKIVYVTAKA
                     RDFEQEFHEVFKGLNRILAKDFTEDERETARRILYKMLDNIADYERRHR"
     misc_feature    88972..89358
                     /locus_tag="DSY0085"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    <89074..89232
                     /locus_tag="DSY0085"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(89083..89085,89092..89094,89230..89232)
                     /locus_tag="DSY0085"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(89083..89091,89116..89127,89131..89136,89143..89148,
                     89152..89157,89173..89178,89188..89190,89203..89211)
                     /locus_tag="DSY0085"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            89404..89811
                     /locus_tag="DSY0086"
                     /db_xref="GeneID:3954219"
     CDS             89404..89811
                     /locus_tag="DSY0086"
                     /note="similarity to COG1720 Uncharacterized ACR(Evalue:
                     1E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516319.1"
                     /db_xref="GI:89892832"
                     /db_xref="GeneID:3954219"
                     /translation="MEILMKPIGYIKSPYKEKGEAPRQSTLSGETTAVIEILEEYQEG
                     IADIQEGEYGVILFYFHKSEGYKLTTLSRRNNQVMGVFSTRSPNRPNGIGLSTVRFVK
                     REGNRLFFEGVDMLDNTPVLDIKPYIDPAAVAD"
     misc_feature    89422..89784
                     /locus_tag="DSY0086"
                     /note="Escherichia coli YaeB and related proteins; Region:
                     UPF0066; cd09281"
                     /db_xref="CDD:187753"
     misc_feature    order(89422..89427,89533..89541,89545..89547,89566..89568,
                     89578..89580,89641..89658,89668..89670,89674..89676,
                     89680..89682,89767..89784)
                     /locus_tag="DSY0086"
                     /note="homodimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:187753"
     misc_feature    order(89575..89577,89581..89586,89656..89658,89680..89682,
                     89686..89688,89743..89745,89758..89760)
                     /locus_tag="DSY0086"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:187753"
     gene            90212..91717
                     /locus_tag="DSY0087"
                     /db_xref="GeneID:3954220"
     CDS             90212..91717
                     /locus_tag="DSY0087"
                     /note="similarity to COG0614 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, periplasmic
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516320.1"
                     /db_xref="GI:89892833"
                     /db_xref="GeneID:3954220"
                     /translation="MIILLGGCNSSATNQPAENPPAEKAVAAGTYTAKAAGYHGDLEV
                     TTEVDQEGKITKITIGENTETEDVGGIAMEKIPQRIIEAQSLDVDVIAGATLTSKGII
                     NGVAAALKEAGADPVHYGYVAPEEESEAIMSPLNKSALPVKKETTGSITIKDVKGREV
                     TLDLPISSYAISTMDVIDYIIPLKGEEAFAMLVASGQDGGGGIQKYAQLYKPIVGDYT
                     QHLGQISDHNAPFDLEMVLSMNPDVLIVNSAMAAHKYALEIEEQLTAAGISIVLIDVP
                     GKTLDKSVQETMKLLGKIFQEEEKAAEVAAFIDKQYELLAAKNLAQRQNKPKVYYEKS
                     GYSEVYGSTGTSVSGWGLPIAIAGGDNIADAVLLDKASAGGSSNTLDPEYVIKADPDY
                     IILSGVNDGWLDSLKQKKEPPQYDIINRTGWSNLQAVKNNNVYEFAHSTSRSIYAFYP
                     CLKMAKLFYPEEFKDLNPEAVLDEFFDQFMLVGSDISTWFTGLEDRISLKK"
     misc_feature    <90272..90547
                     /locus_tag="DSY0087"
                     /note="FMN-binding domain; Region: FMN_bind; cl01081"
                     /db_xref="CDD:260782"
     misc_feature    90623..91606
                     /locus_tag="DSY0087"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    90659..91678
                     /locus_tag="DSY0087"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(90992..90997,91004..91006,91088..91090)
                     /locus_tag="DSY0087"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            91876..92895
                     /locus_tag="DSY0088"
                     /db_xref="GeneID:3954221"
     CDS             91876..92895
                     /locus_tag="DSY0088"
                     /note="similarity to COG0609 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, permease
                     components(Evalue: 3E-66)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516321.1"
                     /db_xref="GI:89892834"
                     /db_xref="GeneID:3954221"
                     /translation="MLIRRRIFLIIGLSVGMAALVILNISIGSSSIAIHDILRVLFTG
                     EGDGHNSMIIKDIRLPMALMAVVVGASLGISGCELQTILRNPIASPYTLGISAAASFG
                     AAMGLILNANVLKSLKVPETLAVTVNAFIFALMVAVAIYIFSRQRQINKTAIILFGVA
                     LNFLFNSLTMVLQYIADENQLQSLIFWNFGSLLKTTWSKFFIVALVLVICFLVLFKNA
                     WKLTAMTLDDTKARSIGVDTAKVRRMVIFVSSLLAAVSVCFVGTIGFVGLIAPHIARQ
                     LVGEDQRFFMPLSGLLGAFVMCLAFVISKLIIRGVILPIGLVTSIIGIPFFIAIIFSK
                     KMRSM"
     misc_feature    92062..92868
                     /locus_tag="DSY0088"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(92113..92115,92125..92133,92518..92523,92527..92535,
                     92539..92544,92548..92565,92569..92577,92698..92700,
                     92719..92721)
                     /locus_tag="DSY0088"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(92128..92130,92134..92136,92149..92151,92332..92334,
                     92338..92343,92350..92355,92362..92367,92374..92376,
                     92383..92388,92392..92394,92428..92433,92440..92442,
                     92668..92670,92824..92826,92833..92838,92845..92847,
                     92854..92859,92866..92868)
                     /locus_tag="DSY0088"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(92392..92394,92470..92472,92644..92646,92656..92658,
                     92788..92790,92815..92817)
                     /locus_tag="DSY0088"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            92892..93689
                     /locus_tag="DSY0089"
                     /db_xref="GeneID:3954222"
     CDS             92892..93689
                     /locus_tag="DSY0089"
                     /note="similarity to COG1120 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, ATPase
                     components(Evalue: 1E-40)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516322.1"
                     /db_xref="GI:89892835"
                     /db_xref="GeneID:3954222"
                     /translation="MMLKVNNLNFSYKGYKKSKGSHKVFSGFSLEFAKGFNVILGPNG
                     AGKSTLIKAIFGLLDYEGEIFYGQESLTAMCTEDKIKLMSYLPQMDVDLSTLTVLEMV
                     ILGRLPELSHKVSDEDLDIVMDTLRSLNIEHLAPRNFSELSGGQKKLVFIAQTLVRNP
                     KVLLLDEPVNSLDLQKQLELCQLLQRVVAEQNVDLIVVLHDINLAARYAQHIVVVDGK
                     GSLYSAGEPREVITAAMLQEVYGVIANITYDEQGVPIIAPVCSVRGI"
     misc_feature    92892..93665
                     /locus_tag="DSY0089"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    92901..93566
                     /locus_tag="DSY0089"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    93012..93035
                     /locus_tag="DSY0089"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(93021..93026,93030..93038,93153..93155,93387..93392,
                     93489..93491)
                     /locus_tag="DSY0089"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    93144..93155
                     /locus_tag="DSY0089"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    93315..93344
                     /locus_tag="DSY0089"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    93375..93392
                     /locus_tag="DSY0089"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    93399..93410
                     /locus_tag="DSY0089"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    93477..93497
                     /locus_tag="DSY0089"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(93745..94560)
                     /locus_tag="DSY0090"
                     /db_xref="GeneID:3954223"
     CDS             complement(93745..94560)
                     /locus_tag="DSY0090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516323.1"
                     /db_xref="GI:89892836"
                     /db_xref="GeneID:3954223"
                     /translation="MEFKRVTLDNLASEHICCALTDQKGESSVASKKAWLSQRLGEGL
                     VFDKLDVRGKVFIEYIPAEKAWCPITADHYLFINCFWVSGQYKGQGYANLLLERCLAD
                     AKAKGKQGLVVLSAEKKMPFLSDPKYLKYKGFQIADQAPPYYELLYLPFSPQANVPQF
                     KACVKSGRTDEEGWVVYYTNQCPHTDKYVPILVDHLKSKKLAIKAIKIETTEQAQKAP
                     NPFTTYALFYNGQFITNEILTAKSFDKLLIKTNLYPPTVPPSPSEYPAPLQRG"
     misc_feature    complement(94126..>94413)
                     /locus_tag="DSY0090"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(94222..>94347)
                     /locus_tag="DSY0090"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(94282..94287,94315..94323))
                     /locus_tag="DSY0090"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    complement(93826..93954)
                     /locus_tag="DSY0090"
                     /note="YoaP-like; Region: YoaP; pfam14268"
                     /db_xref="CDD:258452"
     gene            complement(94733..95236)
                     /locus_tag="DSY0091"
                     /db_xref="GeneID:3954224"
     CDS             complement(94733..95236)
                     /locus_tag="DSY0091"
                     /note="similarity to COG1321 Mn-dependent transcriptional
                     regulator(Evalue: 2E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516324.1"
                     /db_xref="GI:89892837"
                     /db_xref="GeneID:3954224"
                     /translation="MDNKSGSEYRTVRGYQIANYQENKLTPAMEDYMEMACRLCLENG
                     YTRINKLAELLNVRPSSASKMIAKLSELGYLQYDLYESILLTEKGKETGTYLLSRHDT
                     VEQFLRLIGNMNPLEETELIEHSLNVSTVLQLHTLLDFFAQNVAVQESFETFKKAAKE
                     NPASPSL"
     misc_feature    complement(94757..95164)
                     /locus_tag="DSY0091"
                     /note="manganese transport transcriptional regulator;
                     Provisional; Region: PRK03902"
                     /db_xref="CDD:179669"
     misc_feature    complement(94997..95161)
                     /locus_tag="DSY0091"
                     /note="Iron dependent repressor, N-terminal DNA binding
                     domain; Region: Fe_dep_repress; pfam01325"
                     /db_xref="CDD:110335"
     misc_feature    complement(94814..94981)
                     /locus_tag="DSY0091"
                     /note="Iron dependent repressor, metal binding and
                     dimerization domain; Region: Fe_dep_repr_C; pfam02742"
                     /db_xref="CDD:251507"
     gene            95381..96322
                     /locus_tag="DSY0092"
                     /db_xref="GeneID:3954225"
     CDS             95381..96322
                     /locus_tag="DSY0092"
                     /note="similarity to COG0803 ABC-type Mn/Zn transport
                     system, periplasmic Mn/Zn-binding (lipo)protein (surface
                     adhesin A)(Evalue: 2E-73)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516325.1"
                     /db_xref="GI:89892838"
                     /db_xref="GeneID:3954225"
                     /translation="MSRKLKRMLGIVLSLILLTAGCSQTAGKKESGEGSLNVVATTTM
                     LADLAGVIGGEHVSVNGLMGPGIDPHLYQASAGDVERMQKADVVVYNGLHLEGKMSEL
                     FENLSAQGIFTICIEKSMDRSRLLISEDDGGVYDPHIWFDVTLWKQAAQGVAEGFAQA
                     DPEHGNSYIANLERYLAELDELNAYIQKRAAQLPKGQRVLITAHDAFQYFGNAYGFEV
                     RGLQGISTDSEAGTSDVSALASFIVERRIKAIFVESSVPPKTIQALQAAVKAQGFDVA
                     IGGELYSDSLGGEGSGDETYIKTFRSNIDTIVDALKA"
     misc_feature    95390..96316
                     /locus_tag="DSY0092"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    95486..96316
                     /locus_tag="DSY0092"
                     /note="Metal binding protein TroA. These proteins have
                     been shown to function as initial receptors in ABC
                     transport of Zn2+ and possibly Fe3+ in many eubacterial
                     species.  The TroA proteins belong to the TroA superfamily
                     of periplasmic metal binding proteins...; Region: TroA;
                     cd01016"
                     /db_xref="CDD:238498"
     misc_feature    order(95588..95590,95792..95794,95990..95992,96230..96232)
                     /locus_tag="DSY0092"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238498"
     misc_feature    order(95678..95683,95690..95692,95732..95734,95780..95782,
                     95843..95845,95855..95860)
                     /locus_tag="DSY0092"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238498"
     gene            96338..97093
                     /locus_tag="DSY0093"
                     /db_xref="GeneID:3954226"
     CDS             96338..97093
                     /locus_tag="DSY0093"
                     /note="similarity to COG1121 ABC-type Mn/Zn transport
                     systems, ATPase component(Evalue: 4E-79)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516326.1"
                     /db_xref="GI:89892839"
                     /db_xref="GeneID:3954226"
                     /translation="MDMKGMEHAVEVETLTVAYDAKPVLWDVNLKVPKGTLMAVVGPN
                     GAGKTTLIKAMLGLLTPVTGAICFSGGKGDGHALKNRIGYVPQSGSVDWDFPATVQDV
                     VLMGCYGKLGWFRRPRKADYELTAQMLKKVGMEQYASRQISQLSGGQQQRVFLARALA
                     QEAEIYFMDEPFKGVDAQTEKAIVLLLKELKEQGKTVMVVHHDLQTVADYFDWVTLIN
                     LRVIASGPVEEVFHEENLKMAYRSTGALLRSVV"
     misc_feature    96353..97081
                     /locus_tag="DSY0093"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    96368..97012
                     /locus_tag="DSY0093"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            97095..98018
                     /locus_tag="DSY0094"
                     /db_xref="GeneID:3954227"
     CDS             97095..98018
                     /locus_tag="DSY0094"
                     /note="similarity to COG1108 ABC-type Mn2+/Zn2+ transport
                     systems, permease components(Evalue: 2E-84)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516327.1"
                     /db_xref="GI:89892840"
                     /db_xref="GeneID:3954227"
                     /translation="MNTWLALLNDYTFQTVSLGSALLGMISGVLGSFAVLRKQSLLGD
                     GVSHSALPGVVIAFILLGSKNTEILLLGALLSGLTATALILGIVRHTRIKFDSALALV
                     MSFFFGLGMVLLTYVQKIPNSNQAGLKRFIFGQASTLLQRDIILMSVCGVVLLTLVLV
                     FWKEFKLFVFDSDFAHNLGFSPKKLNLLLSFMIVLTIIIGLQTVGVILMSALLISPAV
                     AARQWTNKLGVMVLLAAAFGALSGVVGTAASSAVPKLPTGPAIVVCASLLVVLSVLFA
                     PGRGILHRVYRHRKNKLMLKLEGSGPDVPTI"
     misc_feature    97146..97913
                     /locus_tag="DSY0094"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(97185..97187,97197..97205,97569..97574,97578..97586,
                     97590..97595,97599..97616,97620..97628,97752..97754,
                     97773..97775)
                     /locus_tag="DSY0094"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(97200..97202,97206..97208,97221..97223,97377..97379,
                     97383..97388,97395..97400,97407..97412,97419..97421,
                     97428..97433,97437..97439,97479..97484,97491..97493,
                     97719..97721,97869..97871,97878..97883,97890..97892,
                     97899..97904,97911..97913)
                     /locus_tag="DSY0094"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(97437..97439,97521..97523,97695..97697,97707..97709,
                     97842..97844,97860..97862)
                     /locus_tag="DSY0094"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            98002..99105
                     /locus_tag="DSY0095"
                     /db_xref="GeneID:3954228"
     CDS             98002..99105
                     /locus_tag="DSY0095"
                     /note="similarity to COG1108 ABC-type Mn2+/Zn2+ transport
                     systems, permease components(Evalue: 3E-76)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516328.1"
                     /db_xref="GI:89892841"
                     /db_xref="GeneID:3954228"
                     /translation="MSPQFEIQLIAVIVAVACALPGVFLVLRKMAMMSDSITHTILLG
                     IVLAFFVTHDLSSSFLIAGAALMGVVTVWLTEILGRTRLLAEDAAIGIVFPLLFSIAI
                     ILITRYAGSVHLDTDSVLLGELAFAPFDRMIVERVDLGAKAIHTTGILLLINLAVIII
                     FFKELKLATFDPMLASVLGFAPTLVHYGLMTLVSLTTVGAFQAVGSILVVAFMIGPPV
                     TAYLLTDDLKRMLILSGAIGAINGLLGYLAAALLDVSIAGCMAMMTGISFLLVFIFAP
                     GRGLVSTLSRRRNQKIGFAKMILLLHLYHHEESEANLAEIQNYLRLDGELTKNLIALL
                     QKEGCIELNNSVIKLTEQGRLTSLRSYETLLSG"
     misc_feature    98026..98721
                     /locus_tag="DSY0095"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(98065..98067,98077..98085,98476..98481,98485..98493,
                     98497..98502,98506..98523,98527..98535,98659..98661,
                     98680..98682)
                     /locus_tag="DSY0095"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(98080..98082,98086..98088,98101..98103,98257..98259,
                     98263..98268,98275..98280,98287..98292,98299..98301,
                     98308..98313,98317..98319,98350..98355,98362..98364,
                     98626..98628)
                     /locus_tag="DSY0095"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(98317..98319,98392..98394,98602..98604,98614..98616)
                     /locus_tag="DSY0095"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            99386..101008
                     /locus_tag="DSY0096"
                     /db_xref="GeneID:3954229"
     CDS             99386..101008
                     /locus_tag="DSY0096"
                     /note="similarity to COG0747 ABC-type
                     dipeptide/oligopeptide/nickel transport systems,
                     periplasmic components(Evalue: 1E-136)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516329.1"
                     /db_xref="GI:89892842"
                     /db_xref="GeneID:3954229"
                     /translation="MLRKRFAPLLILLVVVLLVGLPGCSPSPTTSKAPEEGKKEELVL
                     AVGMADYGMFDPKKTWGAIGQIRLTHSSLLKATKDLTFVGDLAKSFETSKDGYTWTFK
                     IRNDAKFSNGDPVTIEDVLFTYEMLKEDGIAFDLSFVDKMEISGKDTIVFTLQEPRST
                     FVSQLSEIGIVPKHIYDDNYSKNPIGSGPYQVTQYNDGEQIIMDYNPYWYGEEPQFKK
                     LTFLLLGEDAAFAAAKAGQVDICYIPPKFAGQTLPGMTLHVLESVDSRGISLPVLPSG
                     GTGYINANEVKVGNDITSHLAIRQALNIGLSRQGIIDVTMDGYGKAAYSIVDGTPWFN
                     EKTVIEDGRVEEAKQLLADAGWADTNKDGIVEKDGLKAEFDLYFPSSDQLRGDIALAV
                     ADQALGLGIKINIIGATWDEIFIQGKANACLWGGGRLHPHQLYTMYSSQVINTGYNNM
                     PSYINPTSDDYIKKALYASTQEEANQYWKLAQWDGKTGFSPLGDAPIVWLARVDHLYL
                     VNDQVNIGNQLMHSHGYEFGLFGNITEWSINP"
     misc_feature    99452..100831
                     /locus_tag="DSY0096"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    99503..100933
                     /locus_tag="DSY0096"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_19; cd08518"
                     /db_xref="CDD:173883"
     gene            101128..102105
                     /locus_tag="DSY0097"
                     /db_xref="GeneID:3954230"
     CDS             101128..102105
                     /locus_tag="DSY0097"
                     /note="similarity to COG0601 ABC-type
                     dipeptide/oligopeptide/nickel transport systems, permease
                     components(Evalue: 1E-107)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516330.1"
                     /db_xref="GI:89892843"
                     /db_xref="GeneID:3954230"
                     /translation="MSQKILRRFLRMITLMLGLSILTFWLIHLSPIDPVNAYAISDTS
                     MSQEQLEKLKEYWGVNKSPVEQYFSWAGALLQGDFGMSKLYRVPVMDIIKSRAMTSFA
                     LMGTAWLLSGVFGYLLGAVAAMRRGKLLDRFIKWYSYILVSIPTFLLALILLLVFAVW
                     LGMFPIGLTKPIGLADADVTLADRLRHFILPALTLSLLGVANIAMHTREKMIDILNTE
                     YVTFARARGETAWQIFKNHGFRNSIIPAISIQFAYFSELFGGSVLAEQVFAYPGLGST
                     LTTAGLKGDLPLLLGIILIASLFVFIGNFIADILNTIVDPRIKRGELRC"
     misc_feature    101128..102093
                     /locus_tag="DSY0097"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    101416..101949
                     /locus_tag="DSY0097"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(101464..101469,101476..101481,101494..101496,
                     101527..101538,101542..101571,101578..101583,
                     101587..101589,101719..101724,101728..101730,
                     101734..101736,101743..101748,101752..101754,
                     101764..101769,101776..101778,101827..101829,
                     101869..101874,101881..101883,101902..101913,
                     101920..101925)
                     /locus_tag="DSY0097"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(101545..101589,101902..101919)
                     /locus_tag="DSY0097"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(101587..101589,101704..101706,101920..101922)
                     /locus_tag="DSY0097"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(101779..101817,101833..101838,101848..101850)
                     /locus_tag="DSY0097"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            102099..102968
                     /locus_tag="DSY0098"
                     /db_xref="GeneID:3954231"
     CDS             102099..102968
                     /locus_tag="DSY0098"
                     /note="similarity to COG1173 ABC-type
                     dipeptide/oligopeptide/nickel transport systems, permease
                     components(Evalue: 8E-83)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516331.1"
                     /db_xref="GI:89892844"
                     /db_xref="GeneID:3954231"
                     /translation="MLEQLGRKEEVLLDPGKTGNVRKKIIWMIGFSTCLIGLILILSF
                     ILSNDNLRVNNASKNLMPSLQHLFGTDWLGRDMFTRTMKGLRLSLAVGIFATVISVTV
                     ATLLGTAAALFGKKVDELISWLIDLFIGMPHLIFMILICYIVGGGIRGIVIGVAMTHW
                     TSLARVVRAEVLQIKSAEYIQLSRSYGKSPWYIARRHVMPSVFPQIMIGAFLMFPHVI
                     LHEAALTFLGFGLSPQTPAVGIILSEAMSHLSTGQWWLILFPGILLILVAKSFDNIGE
                     QLRILLDPTSSNE"
     misc_feature    102156..102950
                     /locus_tag="DSY0098"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    102168..>102506
                     /locus_tag="DSY0098"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     misc_feature    102351..102893
                     /locus_tag="DSY0098"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(102399..102404,102411..102416,102429..102431,
                     102459..102470,102474..102503,102510..102515,
                     102519..102521,102570..102575,102579..102581,
                     102585..102587,102594..102599,102603..102605,
                     102615..102620,102627..102629,102678..102680,
                     102720..102725,102732..102734,102753..102764,
                     102771..102776,102816..102821,102849..102854,
                     102861..102866,102870..102875,102882..102887)
                     /locus_tag="DSY0098"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(102477..102521,102753..102770)
                     /locus_tag="DSY0098"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(102519..102521,102771..102773,102810..102812,
                     102819..102821,102849..102851)
                     /locus_tag="DSY0098"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(102630..102668,102684..102689,102699..102701)
                     /locus_tag="DSY0098"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            103005..103793
                     /locus_tag="DSY0099"
                     /db_xref="GeneID:3957060"
     CDS             103005..103793
                     /locus_tag="DSY0099"
                     /note="similarity to COG0444 ABC-type
                     dipeptide/oligopeptide/nickel transport system, ATPase
                     component(Evalue: 5E-79)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516332.1"
                     /db_xref="GI:89892845"
                     /db_xref="GeneID:3957060"
                     /translation="MKVENLSIGFSQYFRGTQKRVIQPIANLHVEIEEGEIVAVVGAS
                     GSGKSLLAHAILGILPTNAICSGSMMYRGEELTKKRKEELRGREISFIPQSVNYLDPL
                     MPVGKQVQIGLAKQRAQERQNRLFAHYGLKESDGRLYPHELSGGMLRRVLFATSVREG
                     VKLVIADEPTPGIHPQALAEILKQLQQFAREGAGVMLITHDIMSALAIADRVAVIKDG
                     QTIELSPVSAFSGTGEQLQTDYARELWRALPQNDFACQELRWEA"
     misc_feature    103008..103751
                     /locus_tag="DSY0099"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    103008..103670
                     /locus_tag="DSY0099"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    103128..103151
                     /locus_tag="DSY0099"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(103137..103142,103146..103154,103284..103286,
                     103503..103508,103602..103604)
                     /locus_tag="DSY0099"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    103275..103286
                     /locus_tag="DSY0099"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    103431..103460
                     /locus_tag="DSY0099"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    103491..103508
                     /locus_tag="DSY0099"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    103515..103526
                     /locus_tag="DSY0099"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    103590..103610
                     /locus_tag="DSY0099"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            103781..104401
                     /locus_tag="DSY0100"
                     /db_xref="GeneID:3957061"
     CDS             103781..104401
                     /locus_tag="DSY0100"
                     /note="similarity to COG1124 ABC-type
                     dipeptide/oligopeptide/nickel transport system, ATPase
                     component(Evalue: 8E-67)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516333.1"
                     /db_xref="GI:89892846"
                     /db_xref="GeneID:3957061"
                     /translation="MGSIMALLGENLGVYYKKDQWIFKNMNIKVLPGQVLGLSGYSGC
                     GKTTLARVLAGYILPQTGRVSVDSKPLAPKSFRPVQLIYQHPEKAINPRWKMEDVLTE
                     TYTPSQDILDAFGIREDWRKRWPIELSGGELQRFCIVRALNPQTRYIIADEMTTMLDA
                     ITQARIWHSFLHICQSRKIGVIVVSHELSLLNRLCDKVIQVGNTWE"
     misc_feature    103790..104389
                     /locus_tag="DSY0100"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    103808..104377
                     /locus_tag="DSY0100"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    103898..103921
                     /locus_tag="DSY0100"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(103907..103912,103916..103924,104030..104032,
                     104234..104239,104336..104338)
                     /locus_tag="DSY0100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    104021..104032
                     /locus_tag="DSY0100"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    104162..104191
                     /locus_tag="DSY0100"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    104222..104239
                     /locus_tag="DSY0100"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    104246..104257
                     /locus_tag="DSY0100"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    104324..104344
                     /locus_tag="DSY0100"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(104452..105762)
                     /locus_tag="DSY0101"
                     /db_xref="GeneID:3957062"
     CDS             complement(104452..105762)
                     /locus_tag="DSY0101"
                     /note="similarity to COG0642 Signal transduction histidine
                     kinase(Evalue: 4E-58)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516334.1"
                     /db_xref="GI:89892847"
                     /db_xref="GeneID:3957062"
                     /translation="MNKAKREYKLSQTLMITAVLACLASALLFLGLQYLSRGIIYDYC
                     KKPEVISAHIEKKITSLRQYIKDNQISLSDLSELDNWMRGKELTEIVIYHDNTLIYSS
                     HTLSPSFSFPSQPKFPDFYLWHNKYILTFQEGTAEVFIKDFFEHRYIDYITYFNLLVF
                     FLCFITIMVFFIHKKVSYINTLEKEIRILEGGDLHYSITIKGNDELASLAQEIDEMRK
                     AFIAREDYAERVRAATNTLMAGVSHDLRTPLTALIGYLEVLEGEDIPAKESSFLGKCK
                     NRALQIKDLINHLFDYFFISTNDYKEIDLKHYPAQEVLREMIHEHIYLMEQSGFMVSS
                     TVDLPEGRIKVDAGMIQRIFDNMLSNVQKYADPAHPVRLYSTIDSGELVLVFENHSRH
                     SLEPTPKAGLGLNNCQKIMLLHQGRFMYRQNDHVFTIQLAFPLI"
     misc_feature    complement(104470..105336)
                     /locus_tag="DSY0101"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(105106..105228)
                     /locus_tag="DSY0101"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(105106..105108,105115..105120,
                     105124..105129,105136..105141,105145..105150,
                     105196..105198,105202..105207,105214..105219,
                     105223..105228))
                     /locus_tag="DSY0101"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(104887..105069)
                     /locus_tag="DSY0101"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(104896..104898,104908..104910,
                     104917..104919,104929..104931,104938..104940,
                     104950..104952,104998..105000,105007..105009,
                     105019..105021,105028..105030,105040..105042,
                     105052..105054))
                     /locus_tag="DSY0101"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(105034..105036)
                     /locus_tag="DSY0101"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(104470..104715)
                     /locus_tag="DSY0101"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(104482..104484,104497..104499,
                     104503..104505,104551..104562,104674..104676,
                     104683..104685,104695..104697))
                     /locus_tag="DSY0101"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(104683..104685)
                     /locus_tag="DSY0101"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(104554..104556,104560..104562))
                     /locus_tag="DSY0101"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(105755..106525)
                     /locus_tag="DSY0102"
                     /db_xref="GeneID:3957063"
     CDS             complement(105755..106525)
                     /locus_tag="DSY0102"
                     /note="similarity to COG0745 Response regulators
                     consisting of a CheY-like receiver domain and a
                     winged-helix DNA-binding domain(Evalue: 6E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516335.1"
                     /db_xref="GI:89892848"
                     /db_xref="GeneID:3957063"
                     /translation="MSSPEFSQRIFHAIVRNIACRGGVNMPENSTILVVDDDPEIREI
                     IHILLQREGFAVQVAADADTALATLTPGVDLAILDIMMPGKSGFELCSEIRKTTTIPI
                     LFLTAKNQDADKAEGFSCGGDDYLVKPFSSIELISRVKALLRRYLIYQKQEPASKKEV
                     RLGDLYIDLDTGTVARSGEKIALTSMEYQVFRLLLLNRRKVFSAKEIYEHIWQEPFLP
                     LSNNTIMVHIKNLRRKLEKDVGRPQYIRTVWGKGYYIE"
     misc_feature    complement(105758..106432)
                     /locus_tag="DSY0102"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(106097..106429)
                     /locus_tag="DSY0102"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(106139..106144,106151..106153,
                     106208..106210,106265..106267,106289..106291,
                     106415..106420))
                     /locus_tag="DSY0102"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(106289..106291)
                     /locus_tag="DSY0102"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(106265..106273,106277..106282))
                     /locus_tag="DSY0102"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(106136..106144)
                     /locus_tag="DSY0102"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(105767..106048)
                     /locus_tag="DSY0102"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(105770..105772,105785..105787,
                     105821..105826,105848..105850,105857..105859,
                     105914..105919,105974..105976))
                     /locus_tag="DSY0102"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            106631..107629
                     /locus_tag="DSY0103"
                     /db_xref="GeneID:3957064"
     CDS             106631..107629
                     /locus_tag="DSY0103"
                     /note="similarity to COG0803 ABC-type Mn/Zn transport
                     system, periplasmic Mn/Zn-binding (lipo)protein (surface
                     adhesin A)(Evalue: 2E-74)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516336.1"
                     /db_xref="GI:89892849"
                     /db_xref="GeneID:3957064"
                     /translation="MKKLWSKILVGGLVLFLMAGCSQTQNSSSPNTNDKQTQSEKLSV
                     YTSFYPMYDFAAKIGGDKITPVNMVPAGMEPHDWEPSAADITGLEKADVFVYNGAGME
                     HWVEDVLESLQNKALIAVEASKDITLREGHHKHDHEDEHEDEGKEHEEEEEHGHEGAE
                     YDPHTWLSPLNAKKQMETIKDAFVQADPDNKDYYEANYVKYAADLDGLDKEFKDTLAP
                     LPKKDIIVSHEAFGYLCGAYGLNQIGIEGLAPDSEPDPARMAEVIEFAKEHEVKVIFF
                     EELVSPKVAETIAKATGAKTAVLSPIEGLSDEQQAAGDDYLAVMRQNLEALKAALQ"
     misc_feature    106631..107623
                     /locus_tag="DSY0103"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    106745..107626
                     /locus_tag="DSY0103"
                     /note="Metal binding protein AcdA.  These proteins have
                     been shown to function in the ABC uptake of Zn2+ and Mn2+
                     and in competence for genetic transformation and adhesion.
                     The AcdA proteins belong to the TroA superfamily of
                     helical backbone metal receptor...; Region: AdcA; cd01017"
                     /db_xref="CDD:238499"
     misc_feature    order(106856..106858,107120..107122,107312..107314,
                     107537..107539)
                     /locus_tag="DSY0103"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238499"
     gene            107634..108383
                     /locus_tag="DSY0104"
                     /db_xref="GeneID:3957065"
     CDS             107634..108383
                     /locus_tag="DSY0104"
                     /note="similarity to COG1121 ABC-type Mn/Zn transport
                     systems, ATPase component(Evalue: 1E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516337.1"
                     /db_xref="GI:89892850"
                     /db_xref="GeneID:3957065"
                     /translation="MCMSNIIEVDDLGFSYGNEPVFSKIGFSVYKGDFAAIIGANGAG
                     KSTLLRLILGELVPNAGSVRLFGQDSRRFRNWPKIGYVPQAGQHSNANFPATAEEIVR
                     ANLFSQIGLLRFPGKEHRDKVQRALELVGMEGYAKRMIGELSGGQQQRIMLARVLAGD
                     PEIMILDEPTTGVDAQTVQSLYELLARLNQENGLTIVMVTHDISRAAKYVSRILCLEE
                     GSLVEHKHKHPGQELAKEGKGNDECDCHSGI"
     misc_feature    107643..108299
                     /locus_tag="DSY0104"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    107655..108281
                     /locus_tag="DSY0104"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            108355..109188
                     /locus_tag="DSY0105"
                     /db_xref="GeneID:3957066"
     CDS             108355..109188
                     /locus_tag="DSY0105"
                     /note="similarity to COG1108 ABC-type Mn2+/Zn2+ transport
                     systems, permease components(Evalue: 1E-48)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516338.1"
                     /db_xref="GI:89892851"
                     /db_xref="GeneID:3957066"
                     /translation="MSVIAILEYDFMRRAFIVGILLAVIIPCIGIIVVLKRLSMIGDA
                     LSHTSLAGVAAGLIMGINPILGAVTACIAAALGIEFIRKKIPKFSEMSIAIVMSAGIG
                     LAGVLSGHVKNAANFNSFLFGSIVSISDFEMILVAGISCIVMLAFILLYKELFYIALD
                     ERAARLSGVPVGVINFIFTILTAVTVSVAARTVGALIVSSMMVVPVACAMQVGKSYRQ
                     TVIYGIIFAVVFTVTGLFLSYYLKLKPGGTIVLLGVLCLVVMLLIKQINSMLRRTVFK
                     M"
     misc_feature    108364..109101
                     /locus_tag="DSY0105"
                     /note="ABC-type Mn2+/Zn2+ transport systems, permease
                     components [Inorganic ion transport and metabolism];
                     Region: ZnuB; COG1108"
                     /db_xref="CDD:224033"
     misc_feature    order(108442..108444,108454..108462,108796..108801,
                     108805..108813,108817..108822,108826..108843,
                     108847..108855,108979..108981,109000..109002)
                     /locus_tag="DSY0105"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(108457..108459,108463..108465,108478..108480,
                     108637..108642,108649..108654,108661..108663,
                     108670..108675,108679..108681,108706..108711,
                     108718..108720,108946..108948)
                     /locus_tag="DSY0105"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(108679..108681,108748..108750,108922..108924,
                     108934..108936,109069..109071)
                     /locus_tag="DSY0105"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            109217..109648
                     /locus_tag="DSY0106"
                     /db_xref="GeneID:3957067"
     CDS             109217..109648
                     /locus_tag="DSY0106"
                     /note="similarity to COG0735 Fe2+/Zn2+ uptake regulation
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516339.1"
                     /db_xref="GI:89892852"
                     /db_xref="GeneID:3957067"
                     /translation="MKEVTIVKEVNNNWPAGIKRTKPRESVLSVLEHAPKPLSAAEIC
                     SEIEKEGESPWLSTIYRILELFVKKGVVVKLAVLNNEMALYELNRFQHKHYAICLGCH
                     KIVTMNNCPMEKFIPKIEDDDFRVLGHNLEVYGYCRECSVK"
     misc_feature    109280..109627
                     /locus_tag="DSY0106"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(109325..109327,109472..109474,109493..109495,
                     109499..109501,109532..109534)
                     /locus_tag="DSY0106"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    109379..109423
                     /locus_tag="DSY0106"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(109490..109492,109496..109498,109553..109555,
                     109601..109603)
                     /locus_tag="DSY0106"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(109505..109513,109559..109564,109586..109594,
                     109598..109624)
                     /locus_tag="DSY0106"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(109508..109510,109517..109519,109625..109627)
                     /locus_tag="DSY0106"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            109735..110772
                     /locus_tag="DSY0107"
                     /db_xref="GeneID:3957068"
     CDS             109735..110772
                     /locus_tag="DSY0107"
                     /note="similarity to COG0523  GTPases (G3E family)(Evalue:
                     2E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516340.1"
                     /db_xref="GI:89892853"
                     /db_xref="GeneID:3957068"
                     /translation="MGTEIYIISGFLGVGKTTLIQKMLKEAFQGEKVVLIENDFGEIS
                     VDAALLKSGGVEVKEISAGCICCSLSGDFVKALKDLLLRFHPDKIIIEPSGVGKLSDV
                     MKACSDPRIVLHAKVKGKITVVDVKRCQMHLDNFGEFFEDQIRNADVVVFSRSESFPA
                     KLGDGEKIVKKLNPQGRVLTKPWAQINTAELLNPQRQQHRLPGRCRHGHDEHNHDHRD
                     HHSHDHNHHDHDHDHAHHSHDHAADCSHQEGCEHNSRAEDVFDTVTIRTKRVFDTEEL
                     KAKVVKMEDSAKGTILRAKGIVRGPKGYLNLQYLPGDIRITGCHARGDMLCIIGRNLN
                     RQELCAIFSGE"
     misc_feature    109747..110748
                     /locus_tag="DSY0107"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    109747..110271
                     /locus_tag="DSY0107"
                     /note="CobW/HypB/UreG, nucleotide-binding domain; Region:
                     cobW; pfam02492"
                     /db_xref="CDD:251330"
     misc_feature    110512..110760
                     /locus_tag="DSY0107"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; smart00833"
                     /db_xref="CDD:214844"
     gene            111407..112351
                     /locus_tag="DSY0108"
                     /db_xref="GeneID:3957069"
     CDS             111407..112351
                     /locus_tag="DSY0108"
                     /note="similarity to COG0701 Predicted permeases(Evalue:
                     1E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516341.1"
                     /db_xref="GI:89892854"
                     /db_xref="GeneID:3957069"
                     /translation="MAKPVLEGAQIPVNTIVNVFLGIILQAVPFLLIGVLLSSAIQVF
                     IPQSFIERRFPKSIGMGMLVAILGGFCLPVCDCASIPVFRSLVRRGIPLPVAVTFMTA
                     TPVINPVVIVSTYYAFSGNTGIVVGRIFFGIVAAVLIGLTMGFWPPKGSVLAGGAFDR
                     LLCSCGCYDDVESITTFKGKAGLFIRHSQAEFFGVGKYLVMGSFIAALFQVMGTGLFT
                     KAQDGAGLAVSILIMMVMAFVLSLCSSSDAIIARSLANQFPMGAIMGFLVFGPMMDIK
                     NVLMLSSGFSKAFIVRLLLTSLSICFVLVFLFFNWGGM"
     misc_feature    111443..112339
                     /locus_tag="DSY0108"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0701"
                     /db_xref="CDD:223773"
     gene            112311..113216
                     /locus_tag="DSY0109"
                     /db_xref="GeneID:3957070"
     CDS             112311..113216
                     /locus_tag="DSY0109"
                     /note="similarity to COG3689 Predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516342.1"
                     /db_xref="GI:89892855"
                     /db_xref="GeneID:3957070"
                     /translation="MFWSFCFLIGEGCNMPAKAFNPQIFLEFLCYCVFGGLIFYLVSS
                     EKYLTYVTPRLKPYLYFTSIVMGVWALTALGRLFRPQHKLRSAHCFVLVIPIVLLLLP
                     HAPVSASNLSGNYIGGSAFSNRSGQSALSMQNDLSITIEDASSPEDKVQAEIIQEPLA
                     GLPAGAYVSELPGLDMGNKRITVAHEDFSMWLTEMYTNIEKYQGYTVVMTGFVFNDPE
                     FLKEDEFVPARLMMSCCVGDLAPAGILCKYDQADQLQAESWVTVEGTLTLGQHEYDGV
                     LSDEPQIRVTKITPAEAVEGYIYPY"
     misc_feature    112440..113195
                     /locus_tag="DSY0109"
                     /note="TIGR03943 family protein; Region: TIGR03943"
                     /db_xref="CDD:234408"
     gene            113324..113494
                     /locus_tag="DSY0110"
                     /db_xref="GeneID:3957071"
     CDS             113324..113494
                     /locus_tag="DSY0110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516343.1"
                     /db_xref="GI:89892856"
                     /db_xref="GeneID:3957071"
                     /translation="MEKRLLKKIEVLRKKLYRYATTRSLVDARVVELSQELDYLLNQY
                     QRLNKYTQLSFW"
     misc_feature    113333..113467
                     /locus_tag="DSY0110"
                     /note="Spo0E like sporulation regulatory protein; Region:
                     SpoOE-like; pfam09388"
                     /db_xref="CDD:255336"
     gene            113585..113674
                     /locus_tag="DSY_tRNA4-Ser"
                     /db_xref="GeneID:3958048"
     tRNA            113585..113674
                     /locus_tag="DSY_tRNA4-Ser"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3958048"
     gene            114134..115807
                     /locus_tag="DSY0111"
                     /db_xref="GeneID:3957072"
     CDS             114134..115807
                     /locus_tag="DSY0111"
                     /note="similarity to COG2812 DNA polymerase III, gamma/tau
                     subunits(Evalue: 1E-107)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516344.1"
                     /db_xref="GI:89892857"
                     /db_xref="GeneID:3957072"
                     /translation="MAYLALYREWRPKNFKDMVGQDHVTKTLTNALMQSKVAHAYLFS
                     GPRGTGKTTTAKVLAKALNCEHREGVEPCNQCAFCLSIDQGSAMEVFEIDAASNRGID
                     EIRDLRDKVRLSAGESKYKVYIIDEVHMLTTEAFNALLKTLEEPPERVVFILATTEVH
                     KIPLTILSRVQRFEFHRIPLEQIHSHLDKVCQTIGRDVEPEALQIIAQKSEGGLRDAL
                     SILDQCLLLDGKLGVEQVYQVLGMVGEEFSAQLVDHLLTGDYAKALGCLGEGINQGMD
                     PRQIIRELLDYMRQALLYASTQAFPQVAPHLREHLAYQCQMLGLKTLLQWIGILLQGE
                     SQLKYAANARLAAELLLVQVIYNSQPGYSKESPQVLERLQELEEEIKNLSSGKSRQES
                     KAEPVKKVKESREGGSEPPGHKKPELPSLQDKPVISQGGETSALSIEQVQGRWGDILE
                     QVRKRKKSTHAFLMEGKPVELDGDSLVIVFKEGLSFHRDKVNQKENRETIEEVLQSSL
                     GKAYRLQSLLENEYGKDPKDSEQVEKAKENPMIKKAADLFGADLLIVEE"
     misc_feature    114134..115804
                     /locus_tag="DSY0111"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK05563"
                     /db_xref="CDD:235505"
     misc_feature    114188..114661
                     /locus_tag="DSY0111"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    114266..114289
                     /locus_tag="DSY0111"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(114269..114292,114509..114511,114602..114604)
                     /locus_tag="DSY0111"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    114497..114514
                     /locus_tag="DSY0111"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    114647..114649
                     /locus_tag="DSY0111"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    114824..115210
                     /locus_tag="DSY0111"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:256887"
     gene            115830..116162
                     /locus_tag="DSY0112"
                     /db_xref="GeneID:3957073"
     CDS             115830..116162
                     /locus_tag="DSY0112"
                     /note="similarity to COG0718 Uncharacterized BCR(Evalue:
                     5E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516345.1"
                     /db_xref="GI:89892858"
                     /db_xref="GeneID:3957073"
                     /translation="MAFKGGGMGNMGNMLKQAQKLQEEMAKAQEELKTRTVEASVGGG
                     AVQVVVNGKNELVELKIKPEAVDPDDVEMLEDLVKAAVNEGLRKVEELVSSEMGKLTN
                     GLKIPGLF"
     misc_feature    115872..116159
                     /locus_tag="DSY0112"
                     /note="hypothetical protein; Validated; Region: PRK00153"
                     /db_xref="CDD:234669"
     gene            116173..116769
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /db_xref="GeneID:3957074"
     CDS             116173..116769
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="involved in a recombinational process of DNA
                     repair, independent of the recBC complex"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="YP_516346.1"
                     /db_xref="GI:89892859"
                     /db_xref="GeneID:3957074"
                     /translation="MDFLNYPEPLADLITGLSRLPGIGPKTAGRLAFYLLQQPQVAEN
                     LAETMIRAQREIRQCSLCCNYTDHDPCPICTGEKRERTLLCIVEQPRDVVSLEKTREF
                     KGLYHVLHGVISPLEGVGPEQLTISKLLGRLEGVQEVVMAMNPTVEGEATALYLSRLL
                     KPLGIKVTRIAHGLPVGGDLEYADEITIARALEGRRQI"
     misc_feature    <116185..116277
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="Helix-hairpin-helix domain; Region: HHH_8;
                     pfam14716"
                     /db_xref="CDD:258853"
     misc_feature    116188..116766
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="recombination protein RecR; Reviewed; Region: recR;
                     PRK00076"
                     /db_xref="CDD:234616"
     misc_feature    116290..116409
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="RecR protein; Region: RecR; pfam02132"
                     /db_xref="CDD:251108"
     misc_feature    116416..116745
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="TOPRIM_recR: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in Escherichia coli RecR.  RecR participates in the RecFOR
                     pathway of homologous recombinational repair in
                     prokaryotes. This pathway provides a...; Region:
                     TOPRIM_recR; cd01025"
                     /db_xref="CDD:173775"
     misc_feature    order(116434..116439,116446..116448,116602..116604,
                     116608..116610,116614..116616)
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="putative active site [active]"
                     /db_xref="CDD:173775"
     misc_feature    order(116434..116436,116602..116604)
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173775"
     misc_feature    order(116452..116460,116464..116469,116584..116586,
                     116590..116592,116596..116598,116605..116607,
                     116641..116643,116671..116706,116710..116712,
                     116725..116727,116731..116733,116737..116745)
                     /gene="recR"
                     /locus_tag="DSY0113"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173775"
     gene            116808..117113
                     /locus_tag="DSY0114"
                     /db_xref="GeneID:3957075"
     CDS             116808..117113
                     /locus_tag="DSY0114"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516347.1"
                     /db_xref="GI:89892860"
                     /db_xref="GeneID:3957075"
                     /translation="MSTFCIIWTSSGKGGLIMTLIFLALFVLLIGLVVKSSLGQPNTF
                     LKAGIHILGGIVGLWIFDLILSVVGFGIPINVFTITLVGLLGFPGVVALVGLQVLGI"
     misc_feature    116868..117104
                     /locus_tag="DSY0114"
                     /note="SigmaK-factor processing regulatory protein BofA;
                     Region: BofA; pfam07441"
                     /db_xref="CDD:203635"
     gene            117490..121020
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /db_xref="GeneID:3958244"
     CDS             117490..121020
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /EC_number="1.2.7.-"
                     /note="similarity to COG0674 Pyruvate:ferredoxin
                     oxidoreductase and related 2-oxoacid:ferredoxin
                     oxidoreductases, alpha subunit(Evalue: 1E-165)"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate ferredoxin oxidoreductase"
                     /protein_id="YP_516348.1"
                     /db_xref="GI:89892861"
                     /db_xref="GeneID:3958244"
                     /translation="MAKMKTMDGNEAAALASYAFTEVATIFPITPSSTMAELVDEWAA
                     HNKKNIFGQPVKVVEMQSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGE
                     LLPSVFHVSARALATHALSIFGDHQDVMSVRATGFAQLSSHNVQEALDLGFIAHLATI
                     KAKVPFVHFFDGFRTSHEIQKIEVTDYDDVAKLLDRDALQAFRDNALNPERPVLRGTA
                     QNPDVYFQGREVSNRYYDAVPDIVAHYMDEYAKITGREYQPFQYYGAEDAERVIIAMG
                     SVCDTIEETVDYLVAKGEKVGVVKVHLFRPFSTKYLFKVLPKTVKAIAVLDRTKEPGS
                     TGEPLYLDVKDSFFNHEIKPVIVGGRYGLGSKDTTPSQVLAVYKNLAQAEPKNDFTIG
                     IVDDVTFKSLPEDEVVSTAPEGTIACKFWGLGSDGTVGANKQAIKIIGDHTTMYAQAY
                     FQYDSKKSGGITISHVRFGKKPIKSPYYVSDANYVACHNQAYVGQYDLTKGLKKGGTF
                     VLNCQWQPEELADKLPASMKQFIAKNDIKLYIIDAVSIAREIGLGSRINMVMQSAFFK
                     LANVIPVEEALGYLKESVVKTYGKKGQNIVDMNNAAIDRGADSLVKVEVPASWADAAP
                     AQAEAAAAADLPEYVAKIQNVMNAQEGDSLPVSAFVGREDGTVPVGTTAYEKRGIAVI
                     VPEWDVEKCIQCNQCSYVCPHAAIRPFLLNEEEVANAPEGFVTKKALGKEADGLQLRV
                     QVSPLDCTGCGNCAEVCPAKGKALVMKDAAEQTAAQAGNWEYALTVTNKAERFDITTV
                     KGSQFAQPLLEFNGACPGCGETAYVKLLTQLYGDRMMIANATGCSSIWGGSAPSVPYT
                     VNAKGQGPTWANSLFEDNAEFGYGMYLGVRQQREKLALLMEEACATEISADMKEAFQE
                     WIAGMDDADASKAAAAKVRAALDVYEGDSALIADIKGRKDHLVKKSQWIVGGDGWAYD
                     IGYGGLDHVLASGDDVNILVMDTEVYSNTGGQSSKATPRAAVAKFAAAGKKIRKKDLG
                     MMAMSYGYIYVAQVALGANMAQTIKAMKEAEAYKGPSIIIAYAPCINHGLKSGMSKSV
                     TEAKKAVEAGYWHLYRFNPDLEDQGKNPFTLDSKEPTASFRDFLMGEVRYTSLINTFP
                     ESAEELFEGAEKYAKVRLDSYKRLASYKYE"
     misc_feature    117499..121002
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
                     homodimeric; Region: pyruv_ox_red; TIGR02176"
                     /db_xref="CDD:131231"
     misc_feature    117514..118005
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    order(117556..117561,117577..117579,117589..117591,
                     117598..117600,117661..117672,117691..117696,
                     117700..117708,117715..117717,117721..117723,
                     117772..117774,117781..117783,117793..117795,
                     117832..117837,117886..117891)
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(117556..117561,117568..117573,117577..117579,
                     117595..117600,117661..117672,117691..117696,
                     117700..117708,117715..117717,117721..117723,
                     117772..117774,117781..117783)
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(117571..117573,117676..117678)
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(117577..117579,117826..117828)
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     misc_feature    118732..119346
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="Pyruvate:ferredoxin oxidoreductase and related
                     2-oxoacid:ferredoxin oxidoreductases, gamma subunit
                     [Energy production and conversion]; Region: PorG; COG1014"
                     /db_xref="CDD:223946"
     misc_feature    <119389..119532
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="Domain of unknown function; Region: EKR; pfam10371"
                     /db_xref="CDD:255944"
     misc_feature    119548..119769
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    119728..119943
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     misc_feature    119905..121005
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="Thiamine pyrophosphate (TPP family), PFOR_PNO
                     subfamily, TPP-binding module; composed of proteins
                     similar to the single subunit pyruvate ferredoxin
                     oxidoreductase (PFOR) of Desulfovibrio Africanus, present
                     in bacteria and amitochondriate eukaryotes. This...;
                     Region: TPP_PFOR_PNO; cd03377"
                     /db_xref="CDD:239472"
     misc_feature    order(119944..119946,120013..120015,120100..120105,
                     120385..120396,120472..120474,120478..120480,
                     120484..120492)
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239472"
     misc_feature    order(119983..119991,120031..120033,120046..120048,
                     120070..120078,120082..120099,120106..120108,
                     120115..120120,120127..120132,120136..120141,
                     120148..120153,120160..120162,120169..120171,
                     120349..120351,120364..120366,120412..120414,
                     120424..120429,120445..120447,120490..120495,
                     120508..120510,120529..120531,120535..120537,
                     120544..120546,120556..120558,120568..120570,
                     120580..120585,120592..120594,120715..120720,
                     120736..120747,120895..120897,120907..120909,
                     120916..120918,120922..120924,120931..120933,
                     120985..120987)
                     /gene="porA"
                     /locus_tag="DSY0115"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239472"
     gene            121180..122547
                     /locus_tag="DSY0116"
                     /db_xref="GeneID:3957076"
     CDS             121180..122547
                     /locus_tag="DSY0116"
                     /note="similarity to COG1373 Uncharacterized ATPases of
                     the AAA superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516349.1"
                     /db_xref="GI:89892862"
                     /db_xref="GeneID:3957076"
                     /translation="MGGSLVERIIMQDLLRWKNSKHRKPLILKGVRQVGKTWLLKEFA
                     RRYYNNLAYFNFDEHPEYKQFFENTKDVERILQNLMMAGGQIINPKEPGTTLIVFDEI
                     QECPNALNTLKYFCENTPHYHVACAGSLLGIALSKPASFPVGKVDFLEIGPMTFTEFL
                     LANGDGNFVSYLDNLDRIEPIPDAFFNPLYEKLKMYFVTGGMPESVRSWTEERDVELV
                     QQVLANILGAYERDFAKHPDPKDFPKISLIWKSLPSQLARENKKFIYKVVKEGARARE
                     YEEALQWLCDASLAYKIYRSSAPGLPFSAYDDLAAFKLYLVDVGLLRRLSLLAPSAFG
                     EGNRLFVEFKGALSENYVLQALRNQLEAMPRYWTMDNPRHEVDFLIQRENEIIPVEVK
                     SETNVESRSLKKFKEKYGDKVKLRVRFSLNNLRLDGDLLNIPLFITDYADKLIGMALT
                     GQPKE"
     misc_feature    121192..122406
                     /locus_tag="DSY0116"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    121198..121566
                     /locus_tag="DSY0116"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    121267..121290
                     /locus_tag="DSY0116"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(121270..121293,121477..121479,121564..121566)
                     /locus_tag="DSY0116"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    121465..121482
                     /locus_tag="DSY0116"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    121864..122361
                     /locus_tag="DSY0116"
                     /note="Domain of unknown function (DUF4143); Region:
                     DUF4143; pfam13635"
                     /db_xref="CDD:257945"
     gene            122613..123095
                     /locus_tag="DSY0117"
                     /db_xref="GeneID:3957077"
     CDS             122613..123095
                     /locus_tag="DSY0117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516350.1"
                     /db_xref="GI:89892863"
                     /db_xref="GeneID:3957077"
                     /translation="MDMDQEDLIRRLNWFYSLEMNQVELYKVQSKQFKDHYAGQVFER
                     VAAIEQSHVDNVAARITSLGAKPTLLGEVVSPILGMSLGNLMSLTGLERALQLNMELE
                     RKAMSDYKKLIEDLVAGGEDPGGDLCSQLKDNFVDEHLHTALFDTLRENLMEDKIETL
                     "
     misc_feature    122637..123068
                     /locus_tag="DSY0117"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    122646..>122954
                     /locus_tag="DSY0117"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cd00657"
                     /db_xref="CDD:153097"
     misc_feature    order(122667..122669,122757..122759,122766..122768,
                     122916..122918)
                     /locus_tag="DSY0117"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153097"
     gene            123284..124864
                     /locus_tag="DSY0118"
                     /db_xref="GeneID:3957078"
     CDS             123284..124864
                     /locus_tag="DSY0118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516351.1"
                     /db_xref="GI:89892864"
                     /db_xref="GeneID:3957078"
                     /translation="MVVLAKRFFTMIKELTQRPYRKRIRVVHKVPIDQEWDKPVSFAR
                     IKEELSKSSDIIFRDFILRGKEDIPCSLGMVDGLVDKDLLDAYILRVIMVEAVDDPVF
                     QEMTLKNVNDRLLDLFTPANEVKKIGRLGEAIDGMLSGDAVLFIKESQEALVISARGW
                     SDRGVGVPQNESSIRGPKEGFNETLRTNTSLLRRKIKHPSLRLVSMKIGDLSKTDVVI
                     AYVETIADMDVVGEVLKRLSRIRTDAVISGDMLEELIEDHPYSPFPQVSNTERPDIVA
                     ADLLEGRVAIMVDGTPSALIVPVTLPTFMQVNDDYYQRAMIVIIVRTIRYWGAAIALL
                     APSLYIAVTTFHQELLPTPLVLSLAANREAVPFSALGEALLMLLALEILQEGGLRLPK
                     PIGQTIGIVGALIIGEAAVSAGLISPIMVIVIGLTAVSGYTIPYYDLAIAIRLIRLPL
                     MILAGTMGFFGLAIGLYLSIIHLLALRSFGTPYLSPIAPLRIRAFFQDTFVRAPWWAS
                     RKIPDLVDVHDTKSGRKK"
     misc_feature    123410..124828
                     /locus_tag="DSY0118"
                     /note="Bacillus/Clostridium GerA spore germination
                     protein; Region: GerA; pfam03323"
                     /db_xref="CDD:251873"
     gene            124865..125977
                     /locus_tag="DSY0119"
                     /db_xref="GeneID:3955792"
     CDS             124865..125977
                     /locus_tag="DSY0119"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516352.1"
                     /db_xref="GI:89892865"
                     /db_xref="GeneID:3955792"
                     /translation="MERISTHQFTILSTAVLLGTTYMVAGSALAGTAGRDGWMAILPG
                     FALGIPLAFMIFSLMPRYPGMNLIEISEKVLGKWLGKGMGLLYSAITLYFGAILLGQG
                     VDMYNRSVLPLMPQYILVLGLFVIVVYLYFSGIEVLSRFSEVVFPIIFLSLVFIALFS
                     IPRFERGELFPMLDNGIRPLLKAMSNVAPWPMEYILFLGGLLPFLPRKAKDLKVLKKG
                     VFKAFFMVIALSTLMVVIQIMTFGPFETSRLTYALLVLGNMVEISRTISGVEVIFTLI
                     WTGALALKVTALLFAGIWGLRTVFGIKSRKASVRTGVVVGIIYVLIPLYTLTGITVVV
                     EIQLVDQYLILPFTMVWVVLIWGVERWKRRKKSFSH"
     misc_feature    124871..125842
                     /locus_tag="DSY0119"
                     /note="Spore germination protein; Region: Spore_permease;
                     cl17796"
                     /db_xref="CDD:266844"
     gene            125944..127185
                     /locus_tag="DSY0120"
                     /db_xref="GeneID:3955793"
     CDS             125944..127185
                     /locus_tag="DSY0120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516353.1"
                     /db_xref="GI:89892866"
                     /db_xref="GeneID:3955793"
                     /translation="METPQKKFFPLRLTLVLLLIMGVLLLGGCGGKREIDELAYMLGI
                     GIDQGKEEGTYLVTMQIAEPKTSGGGAAELENWTISMETKSISTIMEQAAEAFSKQPF
                     AGTVRVIVLGEDLAGAGINEALDYFQRFYEFRRTIYLLVAKGQAKDIMEAELRTKQIP
                     SLNLFDTIEGQSRQSVFPITRLGHYLTVLGRESQNPIIPRVEKIQPGEHGLFYSDKEG
                     EEMLIHESAVFEGGKCVAKLNDQETKGYLWLDNEIESRVLEGEDGDGVTVTAWVLNSK
                     TKYKVENIDGKMGIKFNIKTTVSINEILGKGEQADIYRWQQFIKELQPLMAQAIQEEC
                     EAAVAKSKEQGLDFIGIGRKIEIKNPKYWREIKENWPQGIKDIPVAYDINVKIEHSGL
                     ARNSPVSPQENGAKGGSHTLQ"
     misc_feature    126037..127125
                     /locus_tag="DSY0120"
                     /note="Spore germination B3/ GerAC like, C-terminal;
                     Region: Spore_GerAC; cl19906"
                     /db_xref="CDD:268259"
     gene            127229..128671
                     /locus_tag="DSY0121"
                     /db_xref="GeneID:3955794"
     CDS             127229..128671
                     /locus_tag="DSY0121"
                     /note="similarity to COG1982 Arginine/lysine/ornithine
                     decarboxylases(Evalue: 3E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516354.1"
                     /db_xref="GI:89892867"
                     /db_xref="GeneID:3955794"
                     /translation="MSILEEENVLNLGHKLLQYEAQKLISFHTPGHKGKAEFFTDLHF
                     PDQDLTELPGLDMLHSPAGVIAQAQARAAAVYQSDASFYLINGATVGNQGMFMALAGT
                     GKRGKDLQLPKVLVERQSHRSVFSALVLSGCEPEYIPSVVHPEFGLPLGLKSIAEVDL
                     GEFLGVHLTYPGYYGTLPDLAMIAAQRDRQAVQVSILVDQAHGSHYLSPLFPKGALAY
                     GADLVLCSTHKTLSALTQAAMLHVQGSRIPLSALKEALELLQSSSPSYLLMASLERAV
                     EHALESRRWELLHEAVQELHHRVGGSLRILNPQDVGTYGIAGLDWTKIMINTQRLGVA
                     APRCVEHLRKSYGIDPELWDDKNILFLLGIGNTPEEVEILTKGLLSLASLNKDVVASP
                     EEMVFEIPLPPVRLTPRQAYFARKRKIPLAESVGHIVGESISPYPPGIPWIVMGEEMT
                     PEILELLTRHKGRWQGWEDAGQGVWIIEEV"
     misc_feature    127271..128662
                     /locus_tag="DSY0121"
                     /note="Arginine/lysine/ornithine decarboxylases [Amino
                     acid transport and metabolism]; Region: LdcC; COG1982"
                     /db_xref="CDD:224893"
     misc_feature    127271..128119
                     /locus_tag="DSY0121"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    order(127490..127495,127502..127504,127733..127735,
                     127823..127825,127832..127834,127904..127906,
                     127913..127915)
                     /locus_tag="DSY0121"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    127913..127915
                     /locus_tag="DSY0121"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     misc_feature    <128429..>128584
                     /locus_tag="DSY0121"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            128634..129521
                     /locus_tag="DSY0122"
                     /db_xref="GeneID:3955795"
     CDS             128634..129521
                     /locus_tag="DSY0122"
                     /note="similarity to COG0470 ATPase involved in DNA
                     replication(Evalue: 2E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516355.1"
                     /db_xref="GI:89892868"
                     /db_xref="GeneID:3955795"
                     /translation="MQAKESGSSRRFNVNIALHLIEKAAQEGRLAHLLLFHGGSGPER
                     RKAGLEIARRINCTSGQDAPCGHCPSCKKILSGNHPDVEVVKPAKASIGIEQILDWQE
                     RVYRKHYEGNYKVFILEEADKLTIPAANALLKVIEEPPERTLIVLSAQNAEVLLPTIQ
                     SRAQAVYFPFRGEEEWLKSLEESLDPWEAREAFRLSSHNPELAYEILTLGVEKVKEWV
                     RGFEQAVEEGDFLKLFPLFPVEKKEAELYLHILALGTAQKHQVNPQAMLAVGKAIEQI
                     QMQANPRLVIEGLALKLFQ"
     misc_feature    128685..129242
                     /locus_tag="DSY0122"
                     /note="DNA polymerase III, delta' subunit; Region: holB;
                     TIGR00678"
                     /db_xref="CDD:233087"
     misc_feature    <128946..>129119
                     /locus_tag="DSY0122"
                     /note="DNA polymerase III subunit delta'; Validated;
                     Region: PRK08485"
                     /db_xref="CDD:236274"
     gene            129535..130383
                     /locus_tag="DSY0123"
                     /db_xref="GeneID:3955796"
     CDS             129535..130383
                     /locus_tag="DSY0123"
                     /note="similarity to COG1774 Uncharacterized ACR, PSP1
                     homologs(Evalue: 7E-87)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516356.1"
                     /db_xref="GI:89892869"
                     /db_xref="GeneID:3955796"
                     /translation="MVEVVGVRFKRAGKIYYFSTGDLALNANDKVIVETARGVEYGEC
                     VLAPRQVPEADVVMPLKPVIRKATPEDERIVEVNRTKEKEAFDICLKKIGDHQLPMKL
                     VDVEYTFDGNKIIFSFTAEGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGS
                     CGRVLCCSSFLGDFEPVSIRMAKDQKLSLNPTKISGICGRLMCCLKYENGAYDESHCK
                     GQCGKQCHQREEDILVLSEESVLKALEEQELKGERGSAVPTAGKGRQEGRHKKGEKNR
                     GKSEKV"
     misc_feature    129535..130176
                     /locus_tag="DSY0123"
                     /note="Uncharacterized homolog of PSP1 [Function unknown];
                     Region: COG1774"
                     /db_xref="CDD:224688"
     gene            130380..130691
                     /locus_tag="DSY0124"
                     /db_xref="GeneID:3955797"
     CDS             130380..130691
                     /locus_tag="DSY0124"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516357.1"
                     /db_xref="GI:89892870"
                     /db_xref="GeneID:3955797"
                     /translation="MSQLTQALTEVEEKLNSLIEEVQRLLPYVKSLEDENARLKRELC
                     ALPEKERSRVIANAEHLQGVAHDNLERLYREGFHVCHLHFGQPLEEGDCLFCMGFLRK
                     D"
     misc_feature    130389..130670
                     /locus_tag="DSY0124"
                     /note="Protein of unknown function (DUF972); Region:
                     DUF972; pfam06156"
                     /db_xref="CDD:253589"
     gene            130712..131557
                     /locus_tag="DSY0125"
                     /db_xref="GeneID:3955798"
     CDS             130712..131557
                     /locus_tag="DSY0125"
                     /note="similarity to COG0313 Predicted
                     methyltransferases(Evalue: 4E-65)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516358.1"
                     /db_xref="GI:89892871"
                     /db_xref="GeneID:3955798"
                     /translation="MATVQRGTLYICGTPIGNLGDITLRALEVLKGVDLIAAEDTRHS
                     RKLLDHFGIATPLTSYHEHNEKGKALELVRRLEQGEAIALISDAGMPGISDPGQEVIQ
                     LCLEKGIPLDVLPGANAGLTALLLSGMPNDHFLFHGFLPSQSGARKKELQNYAQLPFT
                     QIFYEAPHRLVATLEDLWEVFGERETAVVREITKLHQSVHKGTLSTLIHEFKDTAPRG
                     EICVLTSPYIPVPPTGGEKEWRQEVQELTEQGMKPNDAMKVVAQKYGVSKREVYQAVL
                     SQKKN"
     misc_feature    130736..131389
                     /locus_tag="DSY0125"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(130757..130759,130973..130981,130988..130993,
                     131063..131068,131201..131203,131276..131278,
                     131282..131287,131366..131374)
                     /locus_tag="DSY0125"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(130775..130786,130790..130792,130979..130996,
                     131003..131008,131012..131017,131048..131050,
                     131054..131065,131069..131074,131081..131086,
                     131111..131125)
                     /locus_tag="DSY0125"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            complement(131690..131959)
                     /locus_tag="DSY0126"
                     /db_xref="GeneID:3955799"
     CDS             complement(131690..131959)
                     /locus_tag="DSY0126"
                     /note="similarity to COG2002 Regulators of
                     stationary/sporulation gene expression"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516359.1"
                     /db_xref="GI:89892872"
                     /db_xref="GeneID:3955799"
                     /translation="MKSTGIVRKVDELGRVVLPIELRRTLGIDEKDALEIYVDQEKII
                     LKKYEPACVFCNNATDVQIFRGKNVCRECATAMGEAASGNQPEAV"
     misc_feature    complement(<131807..131959)
                     /locus_tag="DSY0126"
                     /note="Regulators of stationary/sporulation gene
                     expression [Transcription]; Region: AbrB; COG2002"
                     /db_xref="CDD:224913"
     gene            132210..132512
                     /locus_tag="DSY0127"
                     /db_xref="GeneID:3955800"
     CDS             132210..132512
                     /locus_tag="DSY0127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516360.1"
                     /db_xref="GI:89892873"
                     /db_xref="GeneID:3955800"
                     /translation="MNRGSATLRKPRSPDRPSAKSVRFCAQSHVLRVSFSSFSFSWGA
                     EALLQSLSRSSRPCRSSGVGKDGKSNSGQVLTFPATPAYSNPKSSPRILIYVRERI"
     gene            132905..134848
                     /locus_tag="DSY0128"
                     /db_xref="GeneID:3955801"
     CDS             132905..134848
                     /locus_tag="DSY0128"
                     /note="similarity to COG0143 Methionyl-tRNA
                     synthetase(Evalue: 1E-161)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516361.1"
                     /db_xref="GI:89892874"
                     /db_xref="GeneID:3955801"
                     /translation="MKYYITTPIFYPNASPHIGTAYTTVAADAFARYHRLKGHDVYFL
                     TGTDENAQKIVRTAESQGMEPLAYVDGVVERFKALWEELDISYDDFIRTTEERHHEVV
                     KKIFTKLYEQGDIYKSEYEGWYCTPCETFWTENKLIDGKCPNPDCGRDVELLKEESYF
                     FKLSKYQDALLRHIKDHPDFIQPASRRNEMIKFIEGGLEDLCVSRTTFQWGIQVPFNP
                     KHVVYVWLDALINYISALGYPDGELYQRYWPAEVHLMGKDIVRFHAVIWPIILMALDV
                     PLPKVVYGHGWYLSKEGGKISKSRGNVQDSFKLIRRYGSDAIRYFLLREMQVGTDGAY
                     SEDSLVERLNSDLANDLGNFVSRSLAMIVKYRGGVIPKAGEPTELEAELRALGQEVVA
                     KVEERLEAHDPAGALENLWRLVSRMNKYVDETAPWTLAKQEGQQERLDTVLHTFAEAI
                     RVLGILCAPFMPKLTGKMFRQCGISDELLAWEAAKEWDVLGEGIQVQRGEALFPRIDL
                     AQFSIEEEKASVNEIKETPAVEENKVEFEPIKEEISIDDFAKIDLRVAKVLHAEKVEK
                     TDKLLKLEIEVAGKPRTIVSGIAQHYAPEDLVGKHVVIVANLKPAKLRGITSEGMILA
                     ASHEGVLEVLVLDKELPAGARVK"
     misc_feature    132905..134845
                     /locus_tag="DSY0128"
                     /note="methionyl-tRNA synthetase; Reviewed; Region:
                     PRK12267"
                     /db_xref="CDD:237028"
     misc_feature    132908..133906
                     /locus_tag="DSY0128"
                     /note="catalytic core domain of methioninyl-tRNA
                     synthetases; Region: MetRS_core; cd00814"
                     /db_xref="CDD:173907"
     misc_feature    order(132926..132931,132935..132937,133046..133048,
                     133577..133579,133586..133591,133598..133600,
                     133679..133681,133691..133693)
                     /locus_tag="DSY0128"
                     /note="active site"
                     /db_xref="CDD:173907"
     misc_feature    132953..132964
                     /locus_tag="DSY0128"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    133787..133801
                     /locus_tag="DSY0128"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    133931..134317
                     /locus_tag="DSY0128"
                     /note="Anticodon-binding domain of methionyl tRNA
                     synthetases; Region: Anticodon_Ia_Met; cd07957"
                     /db_xref="CDD:153411"
     misc_feature    order(133934..133936,133955..133960,133967..133972,
                     133979..133984,133991..133996,134003..134008,
                     134156..134161,134165..134170,134183..134185)
                     /locus_tag="DSY0128"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153411"
     misc_feature    order(133955..133957,133967..133972,133979..133984,
                     133991..133996,134003..134008,134165..134167,
                     134183..134185)
                     /locus_tag="DSY0128"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153411"
     misc_feature    134531..134845
                     /locus_tag="DSY0128"
                     /note="tRNA-binding-domain-containing Escherichia coli
                     methionyl-tRNA synthetase (EcMetRS)-like proteins.  This
                     family includes EcMetRS and Aquifex aeolicus Trbp111
                     (AaTrbp111). This domain has general tRNA binding
                     properties.  MetRS aminoacylates methionine...; Region:
                     tRNA_bind_EcMetRS_like; cd02800"
                     /db_xref="CDD:239199"
     misc_feature    order(134534..134536,134675..134677,134723..134731,
                     134738..134740,134774..134785,134801..134803,
                     134807..134809,134813..134815,134822..134824,
                     134834..134845)
                     /locus_tag="DSY0128"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239199"
     misc_feature    order(134609..134611,134645..134647,134723..134725,
                     134735..134737,134756..134758,134765..134767)
                     /locus_tag="DSY0128"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239199"
     gene            134845..135606
                     /locus_tag="DSY0129"
                     /db_xref="GeneID:3955802"
     CDS             134845..135606
                     /locus_tag="DSY0129"
                     /note="similarity to COG0084 Mg-dependent DNase(Evalue:
                     5E-65)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516362.1"
                     /db_xref="GI:89892875"
                     /db_xref="GeneID:3955802"
                     /translation="MIWDTHAHLDDPRYQGDFQGVLDNMARAHITRVTNVGYDLPSSE
                     RSVRLAHQYDAVYAAVGVHPHDAQGAAEETWESLTQLAREDKVIAWGEIGLDYYRDLS
                     PRKIQQEVFIRQIELADQAGLPIIIHNRDAHQDLLEIVKAHTPKKGGVFHCYSGSWEM
                     AKLILNLGFYISFAGPLTFKNARHTVEVAEKVPLDRFLVETDSPYLTPEPYRGKRNEP
                     AYVRQVVERFATIRGLEVEEAARLAFENGNRLFGL"
     misc_feature    134845..135603
                     /locus_tag="DSY0129"
                     /note="Predicted metal-dependent hydrolases with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1099"
                     /db_xref="CDD:224024"
     misc_feature    134848..135600
                     /locus_tag="DSY0129"
                     /note="TatD like proteins;  E.coli TatD is a cytoplasmic
                     protein, shown to have magnesium dependent DNase activity;
                     Region: TatD_DNAse; cd01310"
                     /db_xref="CDD:238635"
     misc_feature    order(134860..134862,134866..134868,135226..135228,
                     135298..135300,135448..135450)
                     /locus_tag="DSY0129"
                     /note="active site"
                     /db_xref="CDD:238635"
     gene            135824..136672
                     /locus_tag="DSY0130"
                     /db_xref="GeneID:3955803"
     CDS             135824..136672
                     /locus_tag="DSY0130"
                     /note="similarity to COG3584 Uncharacterized BCR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516363.1"
                     /db_xref="GI:89892876"
                     /db_xref="GeneID:3955803"
                     /translation="MYSLPIATYTDYWRLAKNRSLTMGGTLVLAGSTLLYAPADAFPK
                     RMELTLPVFERNSQSPASAPGSQALGREETLLNPEGTALPLAEGIGAAEGVGVEIGQI
                     AMTYRIEDVEIPINTEYIESDRVLPGTSQVQEEGQVGIERQVIRRTTIGGELSDEQIV
                     NQFFLNAPKKRVVIQNTRPVERSDVDLSQYTVLKTFEVEATAYTYTGNPTATGVWPRE
                     GLIAVDPRVIPLGTEVYVEGYGHAIAADTGGAIKGNIIDVFFPSLQRCIQWGRRPVVI
                     HILDNK"
     misc_feature    136145..136360
                     /locus_tag="DSY0130"
                     /note="G5 domain; Region: G5; pfam07501"
                     /db_xref="CDD:254241"
     misc_feature    136403..136657
                     /locus_tag="DSY0130"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3584"
                     /db_xref="CDD:226112"
     gene            136766..137935
                     /locus_tag="DSY0131"
                     /db_xref="GeneID:3955804"
     CDS             136766..137935
                     /locus_tag="DSY0131"
                     /note="similarity to COG3584 Uncharacterized BCR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516364.1"
                     /db_xref="GI:89892877"
                     /db_xref="GeneID:3955804"
                     /translation="MLEKTRTSVFSLVRSSRKAQISVTLLTVAFIVASVFLLKAKTVT
                     VEIDGGKQSLTTLYSTVGAALEHSRLGIYPEDIVEPNRETDIAKGLEIKITRSLPVEL
                     TVDGETYPARTPAPTVGEALVDLSNRLGLDLKVTDEVNLHREAVLVADAKLEVRRAVP
                     VKVKVDGKEIDTYLAPRTVEEALEKLDIVLNEKDKVSLPMKHMIEAEDEIQVVRVEEK
                     IETMTNEIPYQTVAQPADFPIGLPDKVVTKGVNGQHEQTVKITMEDGIEVAREVLQQE
                     VLRAPVNQVVSRGSQTTISRGGKTIEFKRAYLMRASAYSGGGRTATGHNVRYGVIAVD
                     PRVIPLGTEVYVDGYGEAVALDTGGAIKGNRVDLYMNTEESCWSWGVRSVVVYVK"
     misc_feature    136787..137641
                     /locus_tag="DSY0131"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3583"
                     /db_xref="CDD:226111"
     misc_feature    136889..137017
                     /locus_tag="DSY0131"
                     /note="Domain of unknown function (DUF348); Region:
                     DUF348; pfam03990"
                     /db_xref="CDD:252299"
     misc_feature    137060..137200
                     /locus_tag="DSY0131"
                     /note="Domain of unknown function (DUF348); Region:
                     DUF348; pfam03990"
                     /db_xref="CDD:252299"
     misc_feature    137243..137356
                     /locus_tag="DSY0131"
                     /note="Domain of unknown function (DUF348); Region:
                     DUF348; pfam03990"
                     /db_xref="CDD:252299"
     misc_feature    137408..137641
                     /locus_tag="DSY0131"
                     /note="G5 domain; Region: G5; pfam07501"
                     /db_xref="CDD:254241"
     misc_feature    137609..137929
                     /locus_tag="DSY0131"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3584"
                     /db_xref="CDD:226112"
     gene            138147..138863
                     /locus_tag="DSY0132"
                     /db_xref="GeneID:3955805"
     CDS             138147..138863
                     /locus_tag="DSY0132"
                     /note="similarity to COG0860 N-acetylmuramoyl-L-alanine
                     amidase(Evalue: 3E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516365.1"
                     /db_xref="GI:89892878"
                     /db_xref="GeneID:3955805"
                     /translation="MRRPIVIPGRQTQGMAIIIVLTVMFGLVLSVFYQGSAAVLGPLE
                     TKYKVVVDAGHGGYDPGAITKQGVYEKEINLEMAKRVKELLEPAGIEVILTREEDIDY
                     VPEGVRGRQSKKQADLNHRISLAAEAEADTLISLHLNATPSGRNTGAETFYYFDSEEG
                     KRLAETIQQELIKVPGMNRRIAKPGDFYLIKNAPMPAVIVELGYISNPKEFARLRQSW
                     YQDQLAQAVAKGVANYFGLP"
     misc_feature    138282..138860
                     /locus_tag="DSY0132"
                     /note="N-acetylmuramoyl-L-alanine amidase [Cell envelope
                     biogenesis, outer membrane]; Region: AmiC; COG0860"
                     /db_xref="CDD:223929"
     misc_feature    138288..138842
                     /locus_tag="DSY0132"
                     /note="N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA
                     (also known as peptidoglycan aminohydrolase, NAMLA
                     amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC
                     3.5.1.28) is an autolysin that hydrolyzes the amide bond
                     between N-acetylmuramoyl and L-amino...; Region:
                     MurNAc-LAA; cd02696"
                     /db_xref="CDD:119407"
     misc_feature    order(138309..138311,138354..138356,138555..138557,
                     138747..138749)
                     /locus_tag="DSY0132"
                     /note="active site"
                     /db_xref="CDD:119407"
     misc_feature    order(138309..138311,138354..138356,138555..138557)
                     /locus_tag="DSY0132"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119407"
     gene            139085..140239
                     /locus_tag="DSY0133"
                     /db_xref="GeneID:3955806"
     CDS             139085..140239
                     /locus_tag="DSY0133"
                     /note="similarity to COG3325 Chitinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516366.1"
                     /db_xref="GI:89892879"
                     /db_xref="GeneID:3955806"
                     /translation="MKRFLTLNLIAVLVLSFSLVGCNTAQQQNTQAPNQIATESGEPP
                     KAEAETRQDVLGEEKRVVMGFYTDPEGEIPGSKESMMKNIKLMDEVSFFWYSFDANGK
                     ILTTGKKDLSIKEAAQKNGAKAYALIHNMRGGLFDANLAHSVFANPQTRSKFINNIVQ
                     LVINEKWDGVAIDIEKTPPADRNNFTAFLGELHGALKAKDKVLNVSIPAKFIDYPSDL
                     WSGAYDYASIGKNADQIVLMTYDEHGLGTTHGPISSHAWVNKVISYAVTKIPREKIVL
                     GLPVYSFDWGSNKPTMPDYLSYEQSMARAKKHGVEVGYDEEHKVPWYTYTANGVRHEV
                     YFENKQSLQPKMEYAREHKLHGVAIWRLGMEDPSIWDSLVKTYGTNKNKK"
     misc_feature    139265..140203
                     /locus_tag="DSY0133"
                     /note="Cortical fragment-lytic enzyme (CFLE) is a
                     peptidoglycan hydrolase involved in  bacterial endospore
                     germination.  CFLE is expressed as an inactive preprotein
                     (called SleB) in the forespore compartment of sporulating
                     cells.  SleB translocates across the...; Region:
                     GH18_CFLE_spore_hydrolase; cd02874"
                     /db_xref="CDD:119353"
     misc_feature    139265..140176
                     /locus_tag="DSY0133"
                     /note="Glyco_18 domain; Region: Glyco_18; smart00636"
                     /db_xref="CDD:214753"
     misc_feature    order(139274..139276,139361..139366,139490..139492,
                     139595..139597,139601..139603,139607..139609,
                     139796..139798,139802..139807,139925..139927,
                     140162..140164)
                     /locus_tag="DSY0133"
                     /note="active site"
                     /db_xref="CDD:119353"
     gene            140384..140992
                     /locus_tag="DSY0134"
                     /db_xref="GeneID:3955807"
     CDS             140384..140992
                     /locus_tag="DSY0134"
                     /note="similarity to COG1658 Small primase-like proteins
                     (Toprim domain)(Evalue: 1E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516367.1"
                     /db_xref="GI:89892880"
                     /db_xref="GeneID:3955807"
                     /translation="MIEELIVVEGKNDAHAVRRALGNVDILWTEGYGLTQEKLAYIAE
                     AAKRCGVIVLTDPDSVGEQIRERIRRQVPEAKHVYLSKKDARSPKDDDIGVENASPED
                     IQKAFQKIRTDTLYSEPKNNEYPTAGTSFTMKDLLEAGLAGLSHSAERRLAVGKILGI
                     GDANAKQFLRRLNRFGITHEEFNKAVREAIHGERSELYPAHP"
     misc_feature    140387..140944
                     /locus_tag="DSY0134"
                     /note="ribonuclease M5; Region: 5S_RNA_mat_M5; TIGR00334"
                     /db_xref="CDD:232924"
     misc_feature    140387..140623
                     /locus_tag="DSY0134"
                     /note="TOPRIM_ RNase M5_like: The topoisomerase-primase
                     (TOPRIM) nucleotidyl transferase/hydrolase domain found in
                     Ribonuclease M5: (RNase M5) and other small primase-like
                     proteins from bacteria and archaea.  RNase M5 catalyzes
                     the maturation of 5S rRNA in low...; Region:
                     TOPRIM_RNase_M5_like; cd01027"
                     /db_xref="CDD:173777"
     misc_feature    order(140408..140413,140420..140422,140549..140551,
                     140555..140557,140561..140563)
                     /locus_tag="DSY0134"
                     /note="putative active site [active]"
                     /db_xref="CDD:173777"
     misc_feature    order(140408..140410,140549..140551)
                     /locus_tag="DSY0134"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173777"
     misc_feature    140657..140941
                     /locus_tag="DSY0134"
                     /note="Domain of unknown function (DUF4093); Region:
                     DUF4093; pfam13331"
                     /db_xref="CDD:257661"
     gene            140955..141791
                     /locus_tag="DSY0135"
                     /db_xref="GeneID:3955808"
     CDS             140955..141791
                     /locus_tag="DSY0135"
                     /note="similarity to COG0030 Dimethyladenosine transferase
                     (rRNA methylation)(Evalue: 1E-50)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516368.1"
                     /db_xref="GI:89892881"
                     /db_xref="GeneID:3955808"
                     /translation="MENAANYTRRILKGGAKAHKSLGQNFLMDDRVIEAIAAASIKDP
                     EIPVVEIGPGLGVLTRVLAQKAQKVWAVELDRGKVNLLQRELQGLPVDILNMDALKLD
                     LKDIWGTGKGVLVGNLPYYITSPLLMHFLEQKDSLASMVVMVQKEVADRLVAKPGGKD
                     YGILSIAAQVSAQGEKLFEVPPQAFWPAPKVTSAVVRFELRSYPGFRVKEKDFFRVVK
                     AAFSQRRKTLGNSLAGGLGLPKQQIGEILAAAGVDEQRRAETLSIDEFQAVTEAVMKN
                     LD"
     misc_feature    141096..141353
                     /locus_tag="DSY0135"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(141105..141125,141171..141176,141240..141248,
                     141303..141305)
                     /locus_tag="DSY0135"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            141883..142254
                     /locus_tag="DSY0136"
                     /db_xref="GeneID:3955809"
     CDS             141883..142254
                     /locus_tag="DSY0136"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516369.1"
                     /db_xref="GI:89892882"
                     /db_xref="GeneID:3955809"
                     /translation="MRPCREEKMVKKYNYRPGREKKSRTIKKVQHRHPSEYLNDLEEW
                     QRYQYDPGHYLGGNIHPQLKYASGTKAGKYFAALCLMLGVISGIGTVFTFIEGVGNIL
                     ALLMTLLFISVGLTCFGGSKE"
     gene            142230..142730
                     /locus_tag="DSY0137"
                     /db_xref="GeneID:3955810"
     CDS             142230..142730
                     /locus_tag="DSY0137"
                     /note="similarity to COG0419 ATPase involved in DNA
                     repair"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516370.1"
                     /db_xref="GI:89892883"
                     /db_xref="GeneID:3955810"
                     /translation="MFWRQQRIARGARIPSIHLCTRYDRIETKEGAAMEEELLRQILT
                     QLQGLTSEVQGVKDEIQDLQGLKGEVQGLTGEMQGLKGEVQGLKSDVQGLKSDVQGLK
                     SEVQAIKDSQERMESDLSILQYDVGNLKRDVKDIKRDLGHVWTDIKHFDNRLAAQKEK
                     VDKLIK"
     misc_feature    <142488..142727
                     /locus_tag="DSY0137"
                     /note="Bacterial protein of unknown function (DUF948);
                     Region: DUF948; cl01972"
                     /db_xref="CDD:261135"
     gene            complement(142812..144497)
                     /locus_tag="DSY0138"
                     /db_xref="GeneID:3955811"
     CDS             complement(142812..144497)
                     /locus_tag="DSY0138"
                     /note="similarity to COG0685
                     5,10-methylenetetrahydrofolate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516371.1"
                     /db_xref="GI:89892884"
                     /db_xref="GeneID:3955811"
                     /translation="MTCLDWIYLCEEGGNTESRRLNPIDKVEKTFREGKGIEMENRFK
                     QSLLDPNTLSVTWELVPGRGAREKAQESALLAAEQAAKGGKVHALTITDNPGGNPAIL
                     ADYLGQEILKLGIEPLVHFTCKDKNRNQMESQLYALDRAEVRSLLVMTGDYTVSGFKG
                     RPKPVFDLDPTHTLELIAQMNEGLGIPGPKGMSYHQPSDFFAGAAVSPFKGTEAEQMV
                     QYYKLKKKVTSGAQFIVTQLGYDARKIHEVLQFMKLNDLNVPLVGNIYILPFGAAKIM
                     NQNQLPGCVVTDKLLAEIDKERTAEDKGVSARLLRAAKMYALMKGMGFAGVHIGGHNI
                     KYEQVEYVIEKGEELSKDWLALVPEFDYPMPNGFYYYEKDPKTGLNTTTPVNRKNLPL
                     DAPVGVAYSGMRLMHSMLFTPGKNFFPVMRKIYKGRKDNRKHGLEHLAKVITNDCKDC
                     GDCAMFELAYLCPMSQCPKNQRNGACGGSYQGWCEVYPNQKQCIYVRAYARLKKYDEE
                     GDLDSHHIPPANWDLYQTSSWSNFFLGRDHSGKILGIPTPEEEAKAKGADPAK"
     misc_feature    complement(143436..144335)
                     /locus_tag="DSY0138"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    complement(order(143508..143510,143787..143789,
                     143793..143795,143820..143825,143832..143834,
                     143850..143852,143871..143873,143877..143879,
                     143901..143903,143907..143909,143979..143984,
                     144045..144053,144138..144140,144219..144221))
                     /locus_tag="DSY0138"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     misc_feature    complement(142926..143228)
                     /locus_tag="DSY0138"
                     /note="Methylene-tetrahydrofolate reductase C terminal;
                     Region: MTHFR_C; pfam12225"
                     /db_xref="CDD:256910"
     gene            144875..146590
                     /locus_tag="DSY0139"
                     /db_xref="GeneID:3953146"
     CDS             144875..146590
                     /locus_tag="DSY0139"
                     /note="similarity to COG0840 Methyl-accepting chemotaxis
                     protein(Evalue: 3E-73)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516372.1"
                     /db_xref="GI:89892885"
                     /db_xref="GeneID:3953146"
                     /translation="MMAGIVGGFNIYNQTVLTQNNVDEYRKTLYEEYDRGLKMNVEIA
                     ISIIQGVYREQQEGLLTEAEAREKAAALVRTILFDQGNYIWVDTVEGINVVYLGKDSE
                     GKSRIDAVDPSGFLYIRELIKNGMQEGGGYTDYEFAKPNESEPKPKRSYTQLFEPYAW
                     IVGTGNWVDDIESKVSEKEMYYNQHMLNDIIKVVAAMVIGLGVVAVLAFVISGRIAQR
                     VQRIAQGAREVAQGNLTIDKIVVDTQDELGQLAGDFNQMTDNLAEVVKKVAYASEQVS
                     LTAQELSSGAEESAQAAMEVAAAVTDVAQGTERQIRSVSEVSEVVKEMAAGMEQVLTN
                     TGYVVRSAEETSQAAAKGQGSVETTIEQMNHIQKVVNHSAELVERLGLRSQEIGQIIE
                     TISGIAAQTNLLALNAAIEAARAGEQGRGFAVVAEEVRKLAEQSQGAAKQISALILEI
                     QGDTVKAVEAMQEGTHEVGKGAKVVVEAGSAFAEIAELIQEVTGQVRDISAEIEQISQ
                     GNERIIRAVEEVDQISREITDQTYGVSASTEEQSASVEEIASSCQVLENMAMELEKIL
                     AKFKV"
     misc_feature    144959..145228
                     /locus_tag="DSY0139"
                     /note="Cache is an extracellular domain that is predicted
                     to have a role in small-molecule recognition in a wide
                     range of proteins; Region: Cache_2; smart01049"
                     /db_xref="CDD:214995"
     misc_feature    145367..146587
                     /locus_tag="DSY0139"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    145517..145663
                     /locus_tag="DSY0139"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(145517..145522,145529..145534,145538..145543,
                     145550..145555,145559..145561,145610..145615,
                     145619..145624,145631..145636,145640..145645,
                     145652..145657)
                     /locus_tag="DSY0139"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    145841..146437
                     /locus_tag="DSY0139"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(145862..145867,145874..145879,145886..145888,
                     145895..145900,145904..145909,145916..145918,
                     145925..145930,145937..145939,145946..145951,
                     145958..145963,145970..145972,145979..145984,
                     145988..145993,146003..146005,146009..146014,
                     146021..146023,146030..146035,146042..146047,
                     146054..146056,146063..146065,146072..146077,
                     146084..146086,146096..146098,146105..146107,
                     146126..146128,146138..146140,146147..146149,
                     146156..146161,146168..146170,146177..146182,
                     146189..146194,146198..146203,146210..146215,
                     146252..146257,146264..146266,146273..146278,
                     146285..146287,146294..146299,146303..146308,
                     146315..146320,146327..146329,146336..146341,
                     146348..146350,146357..146362,146366..146371,
                     146378..146383,146387..146392,146399..146401,
                     146408..146413,146420..146422,146429..146434)
                     /locus_tag="DSY0139"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    146072..146173
                     /locus_tag="DSY0139"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            146823..148589
                     /locus_tag="DSY0140"
                     /db_xref="GeneID:3953147"
     CDS             146823..148589
                     /locus_tag="DSY0140"
                     /note="similarity to COG0840 Methyl-accepting chemotaxis
                     protein(Evalue: 2E-80)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516373.1"
                     /db_xref="GI:89892886"
                     /db_xref="GeneID:3953147"
                     /translation="MKSIRARLILAFIFTSMLMSIIVGGYNIYRQIDILKNNVQSYRE
                     TLFAEYDRGIKTDVEIAISVIDKVYKEQQAGLLSEEEAKTKAADLVRELRFDGENYFW
                     VDTTEGINVVLLGRDTEGKSRLDAVDPNGYAYVRDGFIKNALSGGGYSDYEFAKPNET
                     EPTPKRGYTQLFEPYGWVIGTGNWVDDIETEVIAQELIYQKQMSKDIISISVAMILGL
                     IIVSAVGFKISQGITRQVKQVAQGANEVAQGNLRIEKIQVDSRDELGQLAQDFNHMAE
                     NLTQLVKQVSLASEHIASSSQQLSAGAEQSAQAANEVASAITEVAQGTEKQMTAVNDV
                     AAVVEEMAAGMGQVLNNTEYVVRSAEGTAKATDKGQQSIHTTVKQMESIQKAVNHSAS
                     LVEHLGVRSQEIGQIVEAISGIADQTNLLALNAAIEAARAGEQGRGFAVVAEEVRKLA
                     EQSQIAAKQIADLIGEIQEDTHKAVDSMKNGTQEVEIGSKVVHEAGSAFEEIAGLIQE
                     VTGQVRGISHEIEEISQGNERIVASIHEVNQISKSIAEQTLNVSASTEEQSASVEEIA
                     SSSQLLAKMTEDMEQALHKFKI"
     misc_feature    146958..147227
                     /locus_tag="DSY0140"
                     /note="Cache is an extracellular domain that is predicted
                     to have a role in small-molecule recognition in a wide
                     range of proteins; Region: Cache_2; smart01049"
                     /db_xref="CDD:214995"
     misc_feature    147516..147662
                     /locus_tag="DSY0140"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(147516..147521,147528..147533,147537..147542,
                     147549..147554,147558..147560,147609..147614,
                     147618..147623,147630..147635,147639..147644,
                     147651..147656)
                     /locus_tag="DSY0140"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    <147606..147848
                     /locus_tag="DSY0140"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    147756..148583
                     /locus_tag="DSY0140"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    147837..148436
                     /locus_tag="DSY0140"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(147861..147866,147873..147878,147885..147887,
                     147894..147899,147903..147908,147915..147917,
                     147924..147929,147936..147938,147945..147950,
                     147957..147962,147969..147971,147978..147983,
                     147987..147992,148002..148004,148008..148013,
                     148020..148022,148029..148034,148041..148046,
                     148053..148055,148062..148064,148071..148076,
                     148083..148085,148095..148097,148104..148106,
                     148125..148127,148137..148139,148146..148148,
                     148155..148160,148167..148169,148176..148181,
                     148188..148193,148197..148202,148209..148214,
                     148251..148256,148263..148265,148272..148277,
                     148284..148286,148293..148298,148302..148307,
                     148314..148319,148326..148328,148335..148340,
                     148347..148349,148356..148361,148365..148370,
                     148377..148382,148386..148391,148398..148400,
                     148407..148412,148419..148421,148428..148433)
                     /locus_tag="DSY0140"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    148071..148172
                     /locus_tag="DSY0140"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(148579..149292)
                     /locus_tag="DSY0141"
                     /db_xref="GeneID:3953148"
     CDS             complement(148579..149292)
                     /locus_tag="DSY0141"
                     /note="similarity to COG3503 Predicted membrane
                     protein(Evalue: 3E-30)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516374.1"
                     /db_xref="GI:89892887"
                     /db_xref="GeneID:3953148"
                     /translation="MTSTRFPIIDSLRTLALALMITYHLIYDLDQWTGLAVDVDALFW
                     FSIGKTAALLFIFLSGLSSGFSKHPLKNGLRVLFFGMIITLVTYVTFPEQYVRFGILH
                     FLGVMMVLYPLIQKLPNGALILGSVLIIAGGLIIKDQAVNTPLLLPLGFMYPGFATMD
                     FYPLFPYSGVTLLGVPCYRYFFAEHSRTNASVPPAEKSKAAYPMVTWVSRHSLWIYLI
                     HQPILLGLIFALKAIAIIS"
     misc_feature    complement(148630..149280)
                     /locus_tag="DSY0141"
                     /note="Protein of unknown function (DUF1624); Region:
                     DUF1624; pfam07786"
                     /db_xref="CDD:254430"
     gene            complement(149378..150235)
                     /locus_tag="DSY0142"
                     /db_xref="GeneID:3953149"
     CDS             complement(149378..150235)
                     /locus_tag="DSY0142"
                     /note="similarity to COG0463 Glycosyltransferases involved
                     in cell wall biogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516375.1"
                     /db_xref="GI:89892888"
                     /db_xref="GeneID:3953149"
                     /translation="MYDVVIPAQNEEKSILAVLATVLKLPIKRVILVLNGCTDRTLDL
                     TRTILDQRIHTIYFAEPLGIDVPRAIGALYARSLHTQGVLFVDGDTSGDIYDGLAKLL
                     AALADGTDIALTNCYPYITHRAKLANLVLRFRGSLNKELGYFQLLGNATPTHGPHALS
                     AKALEVLMPEAIAIPPLTLVLAKRFDLKVKVATSIRHQDLKSPRKHRRHARLIAETII
                     GDCVMGLTLARNEEVTRSLGKHKMLGYHPERRFDILQLWTESLITTHSYCENHLIIPR
                     DTPWLGGYS"
     misc_feature    complement(<149969..150235)
                     /locus_tag="DSY0142"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(<149966..150226)
                     /locus_tag="DSY0142"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    complement(order(149969..149971,149975..149977,
                     150137..150139,150209..150211,150215..150217))
                     /locus_tag="DSY0142"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            150382..151215
                     /locus_tag="DSY0143"
                     /db_xref="GeneID:3953150"
     CDS             150382..151215
                     /locus_tag="DSY0143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516376.1"
                     /db_xref="GI:89892889"
                     /db_xref="GeneID:3953150"
                     /translation="MLKVGDIVARKSHKQDLFFRIEQIMSIKGERIAILKGINLRLIA
                     DAPLQDLVEKEPSEVAHYQREDYQDIYNKLKIVVNQRKYVPEVQDEFYEIPGRVLHLD
                     GDEEYLSQCIKTYQQLGLDAKGICISEAEQPKKIRQVLQENPTDIVVLTGHDGFLKGK
                     KDFKSLDSYRSSRFFVQSVLEARRFQPNRDALVIFAGACQSNYEAIIRAGANFASSPK
                     RTLIHAFDPVFIVERIAFTPIDQMVSLKEIIQHTVTGTDGLGGIETRGQLRKGYPRSP
                     Y"
     misc_feature    150385..151212
                     /locus_tag="DSY0143"
                     /note="YabG peptidase U57; Region: Peptidase_U57;
                     pfam05582"
                     /db_xref="CDD:147641"
     gene            complement(151269..151616)
                     /locus_tag="DSY0144"
                     /db_xref="GeneID:3953151"
     CDS             complement(151269..151616)
                     /locus_tag="DSY0144"
                     /note="similarity to COG1376 Uncharacterized BCR(Evalue:
                     5E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516377.1"
                     /db_xref="GI:89892890"
                     /db_xref="GeneID:3953151"
                     /translation="MNPLPQRRIIIRRSSRQIELYDGNQLLACYPCAVGKSSTPTPLG
                     NYAVATKVMNPGGAFGTRWLGLSLPDYGIHGTNKPASIGTQASLGCIRMHNHHVEALY
                     DQVGAGTPVIITE"
     misc_feature    complement(151278..151562)
                     /locus_tag="DSY0144"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:252135"
     misc_feature    complement(151272..>151526)
                     /locus_tag="DSY0144"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     gene            151736..152578
                     /locus_tag="DSY0145"
                     /db_xref="GeneID:3953152"
     CDS             151736..152578
                     /locus_tag="DSY0145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516378.1"
                     /db_xref="GI:89892891"
                     /db_xref="GeneID:3953152"
                     /translation="MIKGRNDMNHYVEGKLLIIGGAEDKKGECKILKRFIQEAGGRES
                     RVVVLTAATEMPEQVGSEYKELFENLGAAEVQVLDIAERVSANRESISQELQKATGIF
                     FTGGDQLRITGILGGTRLGRTLHNLYQRGVIIAGTSAGASVMSDTMIVGGEAGTPKKD
                     TLTMAPGLGLLHSVVVDQHFAQRGRIGRLLTAIAQNPYVLGVGIDEDTSILVYSDGHF
                     TVVGSQTVTVVDASPTMASNVSEISPGQALVLTPVLMHILSDGYRFDLKRRAASLNET
                     PSGG"
     misc_feature    151778..152425
                     /locus_tag="DSY0145"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in cyanophycinase; Region:
                     GAT1_cyanophycinase; cd03145"
                     /db_xref="CDD:153239"
     misc_feature    order(152147..152149,152270..152272,152351..152353)
                     /locus_tag="DSY0145"
                     /note="proposed catalytic triad [active]"
                     /db_xref="CDD:153239"
     misc_feature    152147..152149
                     /locus_tag="DSY0145"
                     /note="active site nucleophile [active]"
                     /db_xref="CDD:153239"
     gene            152698..155355
                     /locus_tag="DSY0146"
                     /db_xref="GeneID:3953153"
     CDS             152698..155355
                     /locus_tag="DSY0146"
                     /note="catalyze the formation of cyanophycin which may act
                     to store excess nitrogen"
                     /codon_start=1
                     /transl_table=11
                     /product="cyanophycin synthetase"
                     /protein_id="YP_516379.1"
                     /db_xref="GI:89892892"
                     /db_xref="GeneID:3953153"
                     /translation="MEILKIQAIPGANVYSYRPVIRAVVDLQEWTERTSDTFGDFNTR
                     LVQCLPSLYEHFCSRGKPGGFVERLKEGTLVGHIIEHVTIELLTRAGQNIPYGKTLCL
                     PEHPGHYEIIFNYDSLEGGLEGFKQGYALVQELLAGQKPNVTNRIERIREVIQRFELG
                     ASTRAIIEAAEGRGIPVIRLNDSSLLQLGYGRNQKRVQAAMSDQTSCIGVDIACDKGL
                     TKKLLYEGGIPVPDGVVTRNEDEAVEVFRQLDRLVVVKPYNGNQGKGVTLKLGTEAEV
                     RAAFRVAQTYEEQVVVEEYIEGKNYRLLVVDGKMAAAAERIPAHVIGDGVSTVGELVQ
                     LANSDPQRGEDHEKALTKIKIDPVVLMTLTQKKIALETVPADGEVVYLRDSANLSTGG
                     ISVDVTERVHPDNAALAEYAARIVGLDIAGVDMVLEDIERPHQEQRGAIIEVNAAPGL
                     RMHQYPTVGRPLDVGKIIVDHVMPKGNGRIPVISVTGTNGKTTTTRMIGKMLMDRELA
                     VGMTTTDGIYVGGKLLLKGDTTGPESAQIVLRHPDVQVAVLETARGGILRAGLAYDYA
                     DVAVVTNVANDHLGQYGMESLEDIAHVKSLIAEVVRPHSYVVLNADDPLVASFARKTK
                     GKVIFFSTEKDNLTIRKHLAVGGIAVFVRRGNILLCQGDQSHKICGVKDLPVTWNGKA
                     LHNLQNALAAIAVGWSLGLKAEGIRISLSEFTSDPECNRGRLNPYTIGGVQVFIDYGH
                     NAAGIKAIAQTLRKFKAPAVVGCVTVPGDRPDETIREVARVAARGFHRLIIREDGDLR
                     GRRPGEIAGMIMEEAIASGMDPRRISVVLPEREAFCHGLDTCKPGEIFVMFYEHLEPI
                     EEEIALRLESGPLAKEEEGFLEVANLGAI"
     misc_feature    152698..154878
                     /locus_tag="DSY0146"
                     /note="cyanophycin synthetase; Provisional; Region:
                     PRK14016"
                     /db_xref="CDD:237586"
     misc_feature    153334..>153624
                     /locus_tag="DSY0146"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    154183..154785
                     /locus_tag="DSY0146"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    154858..155115
                     /locus_tag="DSY0146"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            155583..156497
                     /locus_tag="DSY0147"
                     /db_xref="GeneID:3953154"
     CDS             155583..156497
                     /locus_tag="DSY0147"
                     /note="similarity to COG3177 Uncharacterized BCR(Evalue:
                     3E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516380.1"
                     /db_xref="GI:89892893"
                     /db_xref="GeneID:3953154"
                     /translation="MGYISVQQAAEQWGLSDRRVRLLCEQGKIEGVIREGRSYRIPAD
                     SVKPLDGRILRGKIIPQEYTTLFARVDALKSQISKRRPFTQGELKRLQEKFLVEFTYN
                     SNAIEGNTLTLRETALVLEGVTIDQKPLKDHLEAVGHRDAFLYIQRLVTEKAPVSERI
                     IKDIHSLVLMDRPDDKGVYRRIPVTIMGTYHEPSQPYRIPVQMEQLIAAQKEEKRHPL
                     ENAAVFHLKFEGIHPFIDGNGRTGRLLLNLMLMQQGYPPIDVKFADRKRYYACFDSYY
                     KDKTAAPMVEMVAGYLEERLKRYLDILL"
     misc_feature    155589..155720
                     /locus_tag="DSY0147"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:257254"
     misc_feature    155805..>156461
                     /locus_tag="DSY0147"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    156045..156311
                     /locus_tag="DSY0147"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            156698..157570
                     /locus_tag="DSY0148"
                     /db_xref="GeneID:3953155"
     CDS             156698..157570
                     /locus_tag="DSY0148"
                     /note="similarity to COG1947
                     4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
                     synthase(Evalue: 2E-48)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516381.1"
                     /db_xref="GI:89892894"
                     /db_xref="GeneID:3953155"
                     /translation="MIRNQVEMFAYAKINLALAITGRRPDGYHELESVMQSIGIYDRI
                     RVTLAEGGIQCSCGEWSGPENLAYRAAEAFLSGLGSSQGIHIDIEKNIPVQAGLGGGS
                     ADAAAALQALNKLFKEPYTEEELKSFAAQLGADVAFCLKGGTQWATGVGEELKGLPHA
                     PKINLVLIKPDQGVNTAEAYRAFDQEGKFSHLDYAGWQEALASGRAESLIPLLYNDLE
                     PASMKLLPEIAWVKEELMKQNGCLGALMSGSGSAVFGIVQTEEQAEKIAAIWRERNYH
                     VWVTHTMERGNIYG"
     misc_feature    156725..157558
                     /locus_tag="DSY0148"
                     /note="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;
                     Provisional; Region: ipk; PRK00128"
                     /db_xref="CDD:234652"
     misc_feature    157292..157525
                     /locus_tag="DSY0148"
                     /note="GHMP kinases C terminal; Region: GHMP_kinases_C;
                     pfam08544"
                     /db_xref="CDD:254869"
     gene            157563..158282
                     /locus_tag="DSY0149"
                     /db_xref="GeneID:3953156"
     CDS             157563..158282
                     /locus_tag="DSY0149"
                     /note="similarity to COG1802 Transcriptional
                     regulators(Evalue: 3E-28)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516382.1"
                     /db_xref="GI:89892895"
                     /db_xref="GeneID:3953156"
                     /translation="MGRKLVPVKLDSYKPLREIVFESLREAIINGVLEPGERLMEIQL
                     AEEMGVSRTPVREAIRKLELENFVVMIPRKGAYVAGVSHKDVADVFEIRSALEGLAAG
                     LAAERATDQEIEEMERFLLYYEGQEMSLDQMVDSDTGFHALVYKASRNERLIQILANL
                     REQIQRFRATSLSVPGRLKNAIDEHRSIVEALARHDVEEAQTLAMAHIVTAENVMFEA
                     LRLSKEQGDSKEDSEANSEKE"
     misc_feature    157587..158222
                     /locus_tag="DSY0149"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    157605..157799
                     /locus_tag="DSY0149"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(157605..157607,157611..157613,157680..157682,
                     157683..157688,157710..157724,157728..157733,
                     157740..157742,157770..157775,157779..157790)
                     /locus_tag="DSY0149"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    157824..158186
                     /locus_tag="DSY0149"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            158294..159130
                     /locus_tag="DSY0150"
                     /db_xref="GeneID:3953157"
     CDS             158294..159130
                     /locus_tag="DSY0150"
                     /note="similarity to COG0503 Adenine/guanine
                     phosphoribosyltransferases and related PRPP-binding
                     proteins(Evalue: 2E-69)"
                     /codon_start=1
                     /transl_table=11
                     /product="pur operon repressor"
                     /protein_id="YP_516383.1"
                     /db_xref="GI:89892896"
                     /db_xref="GeneID:3953157"
                     /translation="MEKMKRAERMVAVMQVLMSKPNMLIPLTTLAERFGAAKSTISED
                     LLAVKESMRCTGQGRLETVSGAAGGVRYIPEISAEDAGGFLISLAERLSSQDRVLAGG
                     FLYMTDLLYDPAVLRPLALIFAGVFREKKPDVVVTIETKGIPLALVTAEALGVPMVII
                     RHGNKVTEGTAVSINYVSGSSKRIQSMTLGRRALEPGRKVLIIDDFMKAGGTALGMIN
                     LLKEFDADVVGLGVLMETPREEEPKLVDHYLSLLQLRELDPVKGVVQVIPQNSFLHYQ
                     KL"
     misc_feature    158297..159109
                     /locus_tag="DSY0150"
                     /note="pur operon repressor; Provisional; Region:
                     PRK09213"
                     /db_xref="CDD:236414"
     misc_feature    158306..158515
                     /locus_tag="DSY0150"
                     /note="Bacterial purine repressor, N-terminal; Region:
                     PuR_N; pfam09182"
                     /db_xref="CDD:255220"
     misc_feature    158648..159040
                     /locus_tag="DSY0150"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(158708..158710,158714..158716,158903..158911,
                     158915..158929,158999..159001)
                     /locus_tag="DSY0150"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            159378..159632
                     /locus_tag="DSY0151"
                     /db_xref="GeneID:3953158"
     CDS             159378..159632
                     /locus_tag="DSY0151"
                     /note="similarity to COG2088 Uncharacterized protein,
                     involved in the regulation of septum location(Evalue:
                     3E-29)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516384.1"
                     /db_xref="GI:89892897"
                     /db_xref="GeneID:3953158"
                     /translation="MNITDVRVRKVNVEGKMKAVVSVTFDNSFVVHDVKVVEGTNGLF
                     VAMPSRKTPEGEFRDIAHPISSAAREVIQNAVLKAYQEAM"
     misc_feature    159378..159626
                     /locus_tag="DSY0151"
                     /note="regulatory protein SpoVG; Reviewed; Region:
                     PRK13259"
                     /db_xref="CDD:237321"
     gene            159820..161181
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /db_xref="GeneID:3953159"
     CDS             159820..161181
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase"
                     /protein_id="YP_516385.1"
                     /db_xref="GI:89892898"
                     /db_xref="GeneID:3953159"
                     /translation="MPHWAAVIMAAGKGTRMKSKLPKVMHTLAGKPMLQHVLDCVRSV
                     EIPRSMVVLGHGREQIEATLDDRTEVVVQEEQCGTGHAIMQAIPHCHEVDHIIVLSGD
                     QPLIRPETLRNLIRIHIEHNAAATLLTACFENPHGLGRILKEGDQFLRVVEEKDATPE
                     ERLVQEINTGTYCFNVAKLREALKNITPKNAQGEYYLTDVFAVFHAQGEVIRTYCTED
                     VHEALGINSRAQLAAAEDVARQRILSYWMEEGVTIIDPRSTFIEAGVVLQPDVVLQPF
                     TILKGRTQVAEDAVIGPHTTLTDCTVGAGSEVSHTVGNQAVIGGHCTIGPYAYLRPGT
                     VLQDKVKVGDFVEIKNSQIGEGSKIPHLSYVGDSQVGKSVNIGAGTITCNYDGVNKYK
                     TIIRDKAFLGSNTNLVAPVEIGEGSVTGAGSTISKNVPANTLAIERSTQKHIENWVRN
                     KKK"
     misc_feature    159826..161178
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase; Provisional; Region: glmU; PRK14354"
                     /db_xref="CDD:184643"
     misc_feature    159835..160512
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    order(159844..159852,159973..159975,160054..160056,
                     160063..160065,160117..160119,160123..160125)
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    order(160123..160125,160495..160497)
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    160567..161142
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="N-acetyl-glucosamine-1-phosphate uridyltransferase
                     (GlmU), C-terminal left-handed beta-helix (LbH)
                     acetyltransferase domain: GlmU is also known as
                     UDP-N-acetylglucosamine pyrophosphorylase. It is a
                     bifunctional bacterial enzyme that catalyzes two...;
                     Region: LbH_GlmU_C; cd03353"
                     /db_xref="CDD:100044"
     misc_feature    order(160810..160812,160858..160860,160864..160866,
                     160900..160902,160909..160911,160942..160953,
                     160966..160974,160987..160989,161017..161019,
                     161023..161028,161077..161082,161131..161133)
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="active site"
                     /db_xref="CDD:100044"
     misc_feature    order(160810..160812,160858..160860,160864..160866,
                     160900..160902,160909..160911,160942..160950,
                     160969..160971,160987..160989)
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100044"
     misc_feature    order(160951..160953,160966..160968,160972..160974,
                     161023..161028,161077..161082,161131..161133)
                     /gene="glmU"
                     /locus_tag="DSY0152"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100044"
     gene            161196..162137
                     /locus_tag="DSY0153"
                     /db_xref="GeneID:3953160"
     CDS             161196..162137
                     /locus_tag="DSY0153"
                     /note="similarity to COG0462 Phosphoribosylpyrophosphate
                     synthetase(Evalue: 1E-117)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516386.1"
                     /db_xref="GI:89892899"
                     /db_xref="GeneID:3953160"
                     /translation="MSVKELKIFCGNANRALAEEIVDYLGVPLGEAKVKRFKDGEITI
                     AIDESVRGADVFVVQPTCNPTNDNIMELLIMIDALKRASARRITPVIPYYGYARQERK
                     SKARDPITAKLMANLITTAGADRVVTMDLHAPAIQGFFDIPVDHLPGVPILAEYFKSK
                     ELENVVVVSPDHGGVQRARNLAERIGAPLAIIDKRRPEPNVSEIMNVIGDIQGKQVIM
                     IDDIIDTAGTITQGAQALKDRGAQDVYACCTHPVLSGPAFERLENSVIKEVVITNTIP
                     VHPEKMISKIKVLSVAPLLGAAIVRIHEDLSVSKLFS"
     misc_feature    161211..162131
                     /locus_tag="DSY0153"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK01259"
                     /db_xref="CDD:234929"
     misc_feature    161211..161561
                     /locus_tag="DSY0153"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:258077"
     misc_feature    161643..162017
                     /locus_tag="DSY0153"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(161706..161708,161712..161714,161853..161861,
                     161865..161879,161949..161951)
                     /locus_tag="DSY0153"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(162300..164159)
                     /locus_tag="DSY0154"
                     /db_xref="GeneID:3953161"
     CDS             complement(162300..164159)
                     /locus_tag="DSY0154"
                     /note="similarity to COG2217 Cation transport
                     ATPases(Evalue: 1E-101)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516387.1"
                     /db_xref="GI:89892900"
                     /db_xref="GeneID:3953161"
                     /translation="MLTFFKNEEKRTILFLVLSLPALIMSFFEIGSFPVDPAWIAILL
                     CGIPIIKGAIVGLVTEFDIKADVLVSLALIAAIFIGEIFAAGEVAFIMAIGAYLEERT
                     VAKARAGIEKLVHLTPTTARLVNNGEERIVPAEQVKVGDVLRVLAGETIAVDGIIISG
                     QTSVNQAVMTGESLPVDKSTGEKISSGTVNQFGTFDMQATKVGEDSSLQRMIRLVQSA
                     DAGKAKIVGIADRWATWIVVIALFSAGATWFITDEIIRAVTILVVFCPCALVLATPTA
                     IMAGIGNATKFGILVREGDALERLSMVKRMAFDKTGTLTFGKPDVAAVESFDPSLSAD
                     ELLALAASAELRSEHPLGKAVVAHYRTAAKASLPEPHDFRMLAGRGVYAVVNNRTIYA
                     GNGELLQDNGIPLAQAIIEKAASYRNDGCTIIFVAIDGHASGFIALSDTLRPDAVDIV
                     RNLEKLNVTSVLLTGDNHHAASHMAKIAGIHDIHTDCLPENKLAVIEQYQSKGDLVCM
                     VGDGVNDAPALKKAHVGIAMGGIGSDIAVDAADIALVRDDIKNIPHLFALSKRTMNTI
                     KINMALSMALNFGAILLAMFGHLGPVVGALVHNVGSVVVIINSSLLLNWRKSK"
     misc_feature    complement(162324..163964)
                     /locus_tag="DSY0154"
                     /note="heavy metal translocating P-type ATPase; Region:
                     ATPase-IB_hvy; TIGR01525"
                     /db_xref="CDD:233447"
     misc_feature    complement(163263..163898)
                     /locus_tag="DSY0154"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(162579..>162842)
                     /locus_tag="DSY0154"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            164365..164577
                     /locus_tag="DSY0155"
                     /db_xref="GeneID:3953162"
     CDS             164365..164577
                     /locus_tag="DSY0155"
                     /note="similarity to COG1476 Predicted transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516388.1"
                     /db_xref="GI:89892901"
                     /db_xref="GeneID:3953162"
                     /translation="MKNRLEEIRKQRGIRQEELAAALAVSRQTIGSLENGRYNPSIIL
                     AFKIARFFGMSIEEIFIYEEEEYDEK"
     misc_feature    164371..164529
                     /locus_tag="DSY0155"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(164380..164382,164392..164394,164467..164469)
                     /locus_tag="DSY0155"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(164389..164391,164464..164466)
                     /locus_tag="DSY0155"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(164410..164415,164446..164448,164455..164457,
                     164467..164472)
                     /locus_tag="DSY0155"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            164624..165004
                     /locus_tag="DSY0156"
                     /db_xref="GeneID:3953163"
     CDS             164624..165004
                     /locus_tag="DSY0156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516389.1"
                     /db_xref="GI:89892902"
                     /db_xref="GeneID:3953163"
                     /translation="MAVGLGLIKWQGDAEGMLRTLPYICVGVGAGVFGSNLGTAIKLR
                     QFKKHPETARQVEIEEKDERNIAISNQAKAKAYDLMLVLYSALLLGFALMQVALQVIL
                     ALVGAYLLVVFTMVYYLAKYQKEM"
     gene            165008..165625
                     /locus_tag="DSY0157"
                     /db_xref="GeneID:3953164"
     CDS             165008..165625
                     /locus_tag="DSY0157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516390.1"
                     /db_xref="GI:89892903"
                     /db_xref="GeneID:3953164"
                     /translation="MVGMLERTIAGLQRNNMAGYFVHNRQELMALLSGLMEKGQTVGC
                     GDSVTLEELGVFDFLRKGDYIFYDKYVPGLTSEDKRRLYIQNFAADTFITGTNAVTTD
                     GKLFNIDGNGSRVAPMIYGPRQVIVVVGTNKITEDVESAIQRVRQIAAPMDAKRLKKE
                     TPCTKLNRCVDCRHPQRICNDFVLITGQFVKDRIKVIIIDMEIGY"
     misc_feature    165020..165604
                     /locus_tag="DSY0157"
                     /note="Uncharacterized ACR, YkgG family COG1556; Region:
                     DUF162; pfam02589"
                     /db_xref="CDD:251397"
     gene            165962..166204
                     /locus_tag="DSY0158"
                     /db_xref="GeneID:3953655"
     CDS             165962..166204
                     /locus_tag="DSY0158"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516391.1"
                     /db_xref="GI:89892904"
                     /db_xref="GeneID:3953655"
                     /translation="MESFRLLFNLERGFKMNYAAIANLVHECVKNPTCLVTQKEKSGE
                     SKIKPDEFSVIQNVFSRHEVSGNGAAIGVLPMGFWS"
     gene            166208..167167
                     /locus_tag="DSY0159"
                     /db_xref="GeneID:3953656"
     CDS             166208..167167
                     /locus_tag="DSY0159"
                     /note="similarity to COG0142 Geranylgeranyl pyrophosphate
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516392.1"
                     /db_xref="GI:89892905"
                     /db_xref="GeneID:3953656"
                     /translation="MMNLQLDQIFFREIDSVLAKARLDAEMERLIRLSLNADSPTGEL
                     FRWAHLTRMSCECAGGDPEDALPGAIGMEFFALALDIFDDVQDQDNENMPWRQLPDAQ
                     AINLAICLLMLSDEAISAIPDNRLFREVAATLHRTGICASNGQFREFIYDDRQQVSFE
                     QYFEMAGQKAGSLTACACKIGAILGGAEEPVIHGLEQFGINLGILNQIRNDLNDFLDF
                     FRKSDFVNNKKTLPYVYLLNTLKAEAAERFKELTQGHGEGAYGFGDREREYVRQLAAE
                     EGVAPYCTVMFEIYCQKAREILEGIPVPEKNKENMKELVGESV"
     misc_feature    166355..167029
                     /locus_tag="DSY0159"
                     /note="Isoprenoid Biosynthesis enzymes, Class 1; Region:
                     Isoprenoid_Biosyn_C1; cl00210"
                     /db_xref="CDD:260263"
     misc_feature    order(166433..166435,166442..166447,166454..166456,
                     166466..166468,166727..166729,166823..166828,
                     166835..166837,166856..166858,166868..166870)
                     /locus_tag="DSY0159"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173830"
     misc_feature    order(166454..166459,166466..166468,166835..166840,
                     166856..166858,166868..166870)
                     /locus_tag="DSY0159"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173830"
     misc_feature    166454..166468
                     /locus_tag="DSY0159"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173830"
     misc_feature    order(166835..166843,166853..166870)
                     /locus_tag="DSY0159"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173830"
     gene            167148..169505
                     /locus_tag="DSY0160"
                     /db_xref="GeneID:3953657"
     CDS             167148..169505
                     /locus_tag="DSY0160"
                     /note="similarity to COG0642 Signal transduction histidine
                     kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516393.1"
                     /db_xref="GI:89892906"
                     /db_xref="GeneID:3953657"
                     /translation="MLEKVFKRQIYYIASLVFVVLGLGYFAACLTQPFIGLDLKNSNG
                     QWLVATSDPNGEGYRSGIRVGDEILKINGEDAGKYRFAQKWETAEGASTIEFRSPGEL
                     TDQTVTITPQPVLLTVLSEIPLLILGLVFWCLGFMTWYKRPFLEQARILFWMNWAFGL
                     AIVLAHASSRCLLLSKEMEHITFSLAPVFLIIFISVFPVSNQNKLNKFGRKIATILFI
                     LILVLTILQSLGFVQLISLIKKLSLSNMVIGILFTLWNLGILIKLPKNQPGKNEAYII
                     LLGMGIGFLPFVLLSALPIIFNLEQLIYSQVSSLSISAIPISLYYVIINKYLPDSRRL
                     YATALSYIGAAAILSFIVFLALFFLQVLPAIRLEYYTALLLFTLLSILCFHLIQIGIT
                     RLWERSSFFQDKHTLKQKVAVLNENLTSLVAEERILDEIVNTLGIDGIFMIMENEQIG
                     CLKKTAGRFKEHPRELETLENYFYHNQRLDLEAKMLPDDCPAGIYVPFIAQDSTCGIF
                     FGRRSSRIKFEQSELPFFTLLAGQLEYQIIMSLVIGKLTKEINALTKSSGRSYRRKME
                     LQGITNALFRKVEQKRKRLTDEICAGPLQWSMDLSRWLKYLKKECPADNKTLKVIAYL
                     QERAEDLNYELNCIANDWGPPILTDLGLVPAVQWLCQEIMTEELSLISLEISRLGQQS
                     RFKEDVEVTAYRFLQEGIMNSVRHSRSNMQTVRMTLNETWLELTVSDSGRGFDTGQIE
                     NWLLTGTHFGLVEMKERIEGLGGELQIISGINRGTTLKALIPVFS"
     misc_feature    167250..>167381
                     /locus_tag="DSY0160"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     misc_feature    order(167250..167258,167262..167264)
                     /locus_tag="DSY0160"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238080"
     misc_feature    <168717..169496
                     /locus_tag="DSY0160"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    169224..169475
                     /locus_tag="DSY0160"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(169239..169241,169251..169253,169260..169262,
                     169326..169328,169332..169334,169338..169340,
                     169344..169349,169389..169400,169446..169448,
                     169452..169454,169467..169472)
                     /locus_tag="DSY0160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    169251..169253
                     /locus_tag="DSY0160"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(169338..169340,169344..169346,169389..169391,
                     169395..169397)
                     /locus_tag="DSY0160"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            169559..170245
                     /locus_tag="DSY0161"
                     /db_xref="GeneID:3953658"
     CDS             169559..170245
                     /locus_tag="DSY0161"
                     /note="similarity to COG2197 Response regulator containing
                     a CheY-like receiver domain and an HTH DNA-binding
                     domain(Evalue: 1E-22)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516394.1"
                     /db_xref="GI:89892907"
                     /db_xref="GeneID:3953658"
                     /translation="MSVHWEKSQETAEQIHMLIVDSHRPFAEGTRALLSFEPRIVTIG
                     IAGDEDSCLNFLRHSVPDVVLLDFYLRDISGLDLMDKIKAAHPALKVILMVEQSQEGY
                     VLAASRKGAEGLLLKTCAVEEMIQAVLSVSKGGVYYSPSPLAFSQVEIDFHDLHFPAK
                     PAEVLKRLLTPREKEIMSLLTKPLHNREIAAALGITARAAHLQVKIILLKFGIKTRLE
                     AVLSWAYVDE"
     misc_feature    169601..170218
                     /locus_tag="DSY0161"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    169610..169951
                     /locus_tag="DSY0161"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(169619..169624,169757..169759,169781..169783,
                     169841..169843,169898..169900,169907..169912)
                     /locus_tag="DSY0161"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    169757..169759
                     /locus_tag="DSY0161"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(169766..169771,169775..169783)
                     /locus_tag="DSY0161"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    169907..169915
                     /locus_tag="DSY0161"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    170063..170218
                     /locus_tag="DSY0161"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(170066..170074,170111..170119,170141..170146,
                     170150..170155,170159..170173,170204..170206)
                     /locus_tag="DSY0161"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(170099..170101,170105..170107,170111..170113,
                     170204..170212)
                     /locus_tag="DSY0161"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(170369..170644)
                     /locus_tag="DSY0162"
                     /db_xref="GeneID:3953659"
     CDS             complement(170369..170644)
                     /locus_tag="DSY0162"
                     /note="similarity to COG1937 Uncharacterized BCR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516395.1"
                     /db_xref="GI:89892908"
                     /db_xref="GeneID:3953659"
                     /translation="MRQCMDFDNLHRRLNKVIGQIKAIDKMLEEDIPCEDILIQINAA
                     KKALHKVGQVVLEGHLNHCVREGIEHGDADKTINDFAKAVEHFSRLT"
     misc_feature    complement(170375..170629)
                     /locus_tag="DSY0162"
                     /note="Uncharacterized family 3; belongs to a superfamily
                     containing the transcriptional regulators CsoR
                     (copper-sensitive operon repressor), RcnR, and FrmR, and
                     related domains; this family was previously known as part
                     of DUF156; Region: CsoR-like_DUF156_3; cd10160"
                     /db_xref="CDD:197395"
     misc_feature    complement(order(170390..170419,170423..170428,
                     170453..170455,170462..170470,170474..170482,
                     170486..170491,170498..170503,170510..170515,
                     170519..170524,170528..170536,170540..170548,
                     170552..170563,170570..170575,170579..170584,
                     170591..170593,170600..170605,170612..170617,
                     170624..170626))
                     /locus_tag="DSY0162"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197395"
     misc_feature    complement(order(170390..170401,170408..170410,
                     170468..170470,170480..170482,170489..170491,
                     170498..170503,170510..170515,170519..170524,
                     170528..170536,170540..170548,170552..170563,
                     170570..170575,170579..170584,170591..170593,
                     170600..170605,170612..170617,170624..170626))
                     /locus_tag="DSY0162"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197395"
     misc_feature    complement(order(170456..170458,170468..170470,
                     170543..170545))
                     /locus_tag="DSY0162"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197395"
     misc_feature    complement(order(170402..170407,170411..170419,
                     170423..170428,170453..170458,170462..170467,
                     170474..170479,170486..170488))
                     /locus_tag="DSY0162"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197395"
     gene            170933..171943
                     /locus_tag="DSY0163"
                     /db_xref="GeneID:3953660"
     CDS             170933..171943
                     /locus_tag="DSY0163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516396.1"
                     /db_xref="GI:89892909"
                     /db_xref="GeneID:3953660"
                     /translation="MRKEAGLELWRKLHEVTRLIGSLQPWDYLWDMDMITLVLPEYEQ
                     PFFVSVMGRNGECYAITVMEGPEALRGFYRLAESREIPPGQLIRYQNNLTCYFGDRDE
                     LSKAERDRIKALGLKFRGRNQWIFFRAFERGYAPHTLDEEQVLKLTRVFQELFMALRA
                     LLEHGIAVDFEKGQTLYRCFDPEQKLWLTSAMPRFMPSPQYLVPVLEDEVMAARLKRQ
                     KKVKEKLEIDTLFLDTFIDESKSGRPTIPILLILASRSSGMILDQEFLDPGDDEVAAV
                     LGQVINYIEDSGRPQKIFVRDEEMAHLLSDLCRRVDIPIAIEGSLQVIDDFAENFELL
                     SF"
     gene            172142..173293
                     /locus_tag="DSY0164"
                     /db_xref="GeneID:3953661"
     CDS             172142..173293
                     /locus_tag="DSY0164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516397.1"
                     /db_xref="GI:89892910"
                     /db_xref="GeneID:3953661"
                     /translation="MKLANLLSFGSETTDIQLNSLNVVVGPNGSGKSNLIDAISLLQA
                     SPSDLAVPIRKGGGIRDWLWRGMELPTASMEVITPSAPHGNKDLRYYLAFTALKQRFE
                     LIDECLETKEPYTNHSEPYFYYRYQNGNPVINNIKDQKRMLKREDIDPEQSILSQRKD
                     PDQYPEITWLGKQFAAIRIYREWNFGRKALLRQPQGADAPNDYLAEDCSNLGLVLNKL
                     RTNYKVKKKVLDLLSQFYEGIDDFDVIVEGGTVQLFLQEGEFMIPATRLSDGTLRFLC
                     LLAILCNPDPPPLICIEEPELGIHSDIIPVIGQLLKDASKMTQLIVTTHSEILVDELT
                     DMPEAVLVCEKHEGMTRFRRLEKDLLKDWLERYSLGELWRKGEIGGTRW"
     misc_feature    172142..173248
                     /locus_tag="DSY0164"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG4637"
                     /db_xref="CDD:226984"
     misc_feature    172145..>172258
                     /locus_tag="DSY0164"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    172202..>172477
                     /locus_tag="DSY0164"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     misc_feature    172217..172240
                     /locus_tag="DSY0164"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(172226..172231,172235..172243)
                     /locus_tag="DSY0164"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    172940..172969
                     /locus_tag="DSY0164"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    <172952..173134
                     /locus_tag="DSY0164"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     misc_feature    173006..173023
                     /locus_tag="DSY0164"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    173042..173053
                     /locus_tag="DSY0164"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    173102..173119
                     /locus_tag="DSY0164"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            173287..173916
                     /locus_tag="DSY0165"
                     /db_xref="GeneID:3953662"
     CDS             173287..173916
                     /locus_tag="DSY0165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516398.1"
                     /db_xref="GI:89892911"
                     /db_xref="GeneID:3953662"
                     /translation="MVRSIRNTVKIYIEGGGEQEHLKRECRKAFSSFFDKIGFRGRMP
                     RVVACGSRNEAFRDYCISLKTSQSTGELAFLLVDSEGPVDAAFCNRPGQYLRTHESWN
                     MPRNAQDEQIHLMIQCMESWFLADIDALREFFGNGFREGSLPRGSNIEDISKTDILDG
                     LKNASGSSYKGKYGKAAHSFKLLEKVDPQKVKIAFPSVNRLHEELDKVL"
     misc_feature    173320..173910
                     /locus_tag="DSY0165"
                     /note="Domain of unknown function (DUF4276); Region:
                     DUF4276; pfam14103"
                     /db_xref="CDD:258322"
     gene            174106..176832
                     /locus_tag="DSY0166"
                     /db_xref="GeneID:3953663"
     CDS             174106..176832
                     /locus_tag="DSY0166"
                     /note="similarity to COG2909 ATP-dependent transcriptional
                     regulator(Evalue: 2E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516399.1"
                     /db_xref="GI:89892912"
                     /db_xref="GeneID:3953663"
                     /translation="MRLRNIRPKATEALLQRPRLLDKIALPGTQLTYIHADAGYGKTT
                     LLLQYAKGRDDVVWMALDGKDREPIFFLQHLESSLKEKLIQFEFHATDYIPFAGSDTF
                     AAVVLSALLKAIGSSVLTIIFDDVHVITHHQLTDLLTEWVKSSPPNLTLIMASRHELW
                     SSLFRLKIAGEVVELTKRDLCFSQEEAERLWGFFDEAAYSATEGWTLAIQSYRLAAEG
                     NKEFSLARLDADRDVSRYLFNEIFMGITEETRDFLKATSRLPELEVQGCNYLLNIKHS
                     QKILEELMHRNLFILRTSTTSYRYHTLFRNFLQQNDEGRGWEILHKAKDSCYGSGDYG
                     RAAEYALLVEDEKIVHACLSAMAGEFFTKGSSRNLKRYFDFLEARHVELTPRVQLVKG
                     IYLSDGGDFYQAEKYLKVVMPQLKSDEQDLYILAMTHLARVKRNRASFPESTACLDSL
                     LPLLEGAPMAAWYGVVIEKIHNLTLTSQLTEALALTIAMMNKCLVNGDLRIKGWFERY
                     LTVVYFYKGDYKNCLQAYEKSLAIPQEEQDQLMRHGVGVYAAKAYQIAGQEDKARPLL
                     DAELYRMRQLGLHEEFSINYLLYAETLNTAEQLNYYLGKAADFSAADRYLNMAEDYAL
                     LNRSTREHWLFVKIWKDCAEIFKQPEKAEEITAGILTLIQDTTPFFQTVAYGRMANAL
                     QVHQKNREQSIEYYRKSIAIGEEIGCYAYATLAYGKLASIYLEEGDEEQARSYTQRFL
                     ELSCQYDHRYYIRFKPLFADVLKQAAEAGIMPDYTRELLDYGGYASVRVYINTLGTFY
                     IAPAHERKSPIKIRTQKARELLAYLLEHREGVSKERIFDDLWWDSEANVTSLFHTRRG
                     EIKRAFESAGAGNPILYERGVYRLEMAEISCDLDALRQAAADFARQPSFINA"
     misc_feature    174109..>175494
                     /locus_tag="DSY0166"
                     /note="ATP-dependent transcriptional regulator
                     [Transcription]; Region: MalT; COG2909"
                     /db_xref="CDD:225461"
     misc_feature    <175249..175794
                     /locus_tag="DSY0166"
                     /note="Cohesin loading factor; Region: Cohesin_load;
                     pfam10345"
                     /db_xref="CDD:255924"
     misc_feature    176125..176331
                     /locus_tag="DSY0166"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    176542..176745
                     /locus_tag="DSY0166"
                     /note="Transcriptional regulatory protein, C terminal;
                     Region: Trans_reg_C; smart00862"
                     /db_xref="CDD:214866"
     gene            177208..177762
                     /locus_tag="DSY0167"
                     /db_xref="GeneID:3953664"
     CDS             177208..177762
                     /locus_tag="DSY0167"
                     /note="similarity to COG1595 DNA-directed RNA polymerase
                     specialized sigma subunits, sigma24 homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516400.1"
                     /db_xref="GI:89892913"
                     /db_xref="GeneID:3953664"
                     /translation="MEKRELIGLVQKDETSLTELYNVYFPRINNYVHYRVADYHDAED
                     LVSQILEKVFTKSHSYQENKAPFSVWLFRIARNTITDYYRSRKGVHNISLDGYTRDIV
                     AREPEPAEIVELNELQHHLLKAIASLSQREQEIIALKFWSDLSNREIARLVGISESNT
                     GVILFRAMRQLRLILASQGMCIYE"
     misc_feature    177238..177723
                     /locus_tag="DSY0167"
                     /note="RNA polymerase sigma-70 factor, TIGR02952 family;
                     Region: Sig70_famx2"
                     /db_xref="CDD:131997"
     misc_feature    177265..177468
                     /locus_tag="DSY0167"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    177565..177723
                     /locus_tag="DSY0167"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(177592..177594,177622..177624,177640..177645,
                     177673..177675,177679..177684,177688..177696,
                     177700..177705,177709..177711)
                     /locus_tag="DSY0167"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            177755..178129
                     /locus_tag="DSY0168"
                     /db_xref="GeneID:3953665"
     CDS             177755..178129
                     /locus_tag="DSY0168"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516401.1"
                     /db_xref="GI:89892914"
                     /db_xref="GeneID:3953665"
                     /translation="MNEKQQAEIYLAYLERLIAGEKDLGVVEEPEIRKLLFLAETMLT
                     HDLSSNSKLRDSLKEKILAQLGQVNPVGLREFSRDEELAEEDLEYVAAGFSQQLGWQK
                     CPRCGSRLGKSTGDRECPNCKL"
     misc_feature    <178055..>178120
                     /locus_tag="DSY0168"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            178249..178491
                     /locus_tag="DSY0169"
                     /db_xref="GeneID:3953666"
     CDS             178249..178491
                     /locus_tag="DSY0169"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516402.1"
                     /db_xref="GI:89892915"
                     /db_xref="GeneID:3953666"
                     /translation="MSIESAKAFMEKMKTDQDFAKKVMAAKDAEERRALVKEDGFDFS
                     AAELKELGEEMSDSELDAVAGGSCLVDTCGMKELIW"
     misc_feature    178255..178446
                     /locus_tag="DSY0169"
                     /note="nif11-like leader peptide domain; Region:
                     ocin_TIGR03798"
                     /db_xref="CDD:234358"
     gene            complement(178560..179957)
                     /locus_tag="DSY0170"
                     /db_xref="GeneID:3953667"
     CDS             complement(178560..179957)
                     /locus_tag="DSY0170"
                     /note="similarity to COG0641 Arylsulfatase regulator (Fe-S
                     oxidoreductase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516403.1"
                     /db_xref="GI:89892916"
                     /db_xref="GeneID:3953667"
                     /translation="MSKKEVSPFHLFEYRGHPYLLNIEKMAAHSVSTELLPILHNIRE
                     PQTKLPADQEKILRSWDLISECQDNDAPVVQMEPVPITYLYLFLTQSCNLRCIYCYGD
                     GGEYGAGGSMDSATAKQAVDWLITWSGNMKKIHLGFFGGEPFINFPLMKATVDYAQSK
                     AQEAHKEVAFYVTTNATLLDDEKIAFIKEHQFSVQISFDGPREIQDAQRPYANGQGSY
                     DSVVPKIKKLLACVPEASGHGVLWGDTNPQLVKATLQDLGFTSLTLAPASSSLFTDES
                     EKKPSSRKTQAQLQALEQETAAWLHHLRSRDKDILHGLRASSGGYGIYPGMIALLHNR
                     RKYHFCGVGRKMAGVSVTGDIYPCHRFVGNDDYKLGHVGDENFNRDDYLQSPPALRAN
                     CASCFARYYCAGGCRHDNLSSSGSSHVPSEEICRLRRRELELAAVIVSNLSSDDQAFL
                     VNERIIAPKPCPLDF"
     misc_feature    complement(178563..179942)
                     /locus_tag="DSY0170"
                     /note="nif11-like peptide radical SAM maturase; Region:
                     rSAM_nif11; TIGR04064"
                     /db_xref="CDD:188579"
     misc_feature    complement(<179274..179702)
                     /locus_tag="DSY0170"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(179367..179369,179433..179441,
                     179532..179537,179547..179549,179658..179666,
                     179670..179672,179676..179678,179682..179684))
                     /locus_tag="DSY0170"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(178683..178940)
                     /locus_tag="DSY0170"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     gene            180201..181307
                     /locus_tag="DSY0171"
                     /db_xref="GeneID:3953668"
     CDS             180201..181307
                     /locus_tag="DSY0171"
                     /note="similarity to COG0683 ABC-type branched-chain amino
                     acid transport systems, periplasmic component(Evalue:
                     3E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516404.1"
                     /db_xref="GI:89892917"
                     /db_xref="GeneID:3953668"
                     /translation="MIFILGLSLWPLGCTQVNPSGEIFIGVAWPFASLDDLFAEGLEL
                     AVQEINEQGGVQGRRLSLVKADDEAELEKGLAIAQAFADNAGIQAVIGHRNSFISIPT
                     ASIYDQAGLVMLSPASTSPDLTDHGYIHVFRNIPSDQEIARQLAIYLAEQGHERMVIY
                     YTDDSYGNGLANAFEDYARAQGITIVDRFNYYGNLKDLERLYDKWQAFGMDGIFIAKT
                     ATGGGTEFLVDAKSVGIEVPLIAGNSWDALSLTEDIENIGMTAEGLLVGSFFNPQRPD
                     SRTQDFVEAFRREYGQPPTSYAAAGYDAVILLAEALEKSDLTHPATLAQGLRDLGSWE
                     GVMGMHRFDGRGDDIGDLVVLKKMKDGRFEYLGH"
     misc_feature    180273..181241
                     /locus_tag="DSY0171"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    180315..181253
                     /locus_tag="DSY0171"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     gene            181323..182261
                     /locus_tag="DSY0172"
                     /db_xref="GeneID:3953669"
     CDS             181323..182261
                     /locus_tag="DSY0172"
                     /note="similarity to COG0845 Membrane-fusion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516405.1"
                     /db_xref="GI:89892918"
                     /db_xref="GeneID:3953669"
                     /translation="MRQGLFRDVSLTRLSSPEQLDQRIQVTSPKAWLALLAIGLILMS
                     GVVWGLLGSIPTKIQGQGILLNNGGVFSLQHHAPGQISDIRVKVGQEVRQGDVIARIE
                     QPELVAQIKGLLGSQAAMDKDGQGGEPALAGIEEQIRQLRSELVYRTQVVSEVDGRIL
                     ELNISKGSIVKPGDTLATLEQYGDTVKLEAIVYVPAEQGGLLRPGMECQISPTTVNKE
                     EYGYLLGRVNTVAEYPATAQSMMQTLGNESLVTFLAGQGAPLLVKIDLVPDSATESGY
                     RWSSPLGPPMSFQSGTIITTEIITQREKPIHKVIPF"
     misc_feature    181359..182255
                     /locus_tag="DSY0172"
                     /note="NHLM bacteriocin system secretion protein; Region:
                     NHLM_micro_HlyD; TIGR03794"
                     /db_xref="CDD:163506"
     misc_feature    181554..181859
                     /locus_tag="DSY0172"
                     /note="Biotinyl_lipoyl_domains are present in
                     biotin-dependent carboxylases/decarboxylases, the
                     dihydrolipoyl acyltransferase component (E2) of 2-oxo acid
                     dehydrogenases, and the H-protein of the glycine cleavage
                     system (GCS). These domains transport CO2, acyl; Region:
                     Biotinyl_lipoyl_domains; cl11404"
                     /db_xref="CDD:264355"
     misc_feature    181686..181688
                     /locus_tag="DSY0172"
                     /note="lipoyl-biotinyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133456"
     gene            182287..184470
                     /locus_tag="DSY0173"
                     /db_xref="GeneID:3953670"
     CDS             182287..184470
                     /locus_tag="DSY0173"
                     /note="similarity to COG2274 ABC-type
                     bacteriocin/lantibiotic exporters, contain an N-terminal
                     double-glycine peptidase domain(Evalue: 1E-101)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516406.1"
                     /db_xref="GI:89892919"
                     /db_xref="GeneID:3953670"
                     /translation="MVKKKIVKVPTVLQMEAVECGAASLAMILAYYGKYITLEELRIA
                     CGVSRDGSKASNLLKAARNYGLEAKGYRKEPEALRRMPLPLVIHWNFSHFLVLEGFHK
                     GKAVLNDPAAGRRTVSEEEFNLAFTGIVLSFTPTTEFQKDSRKPGLSLALRRRLKGSE
                     QALIYIILLGLALVIPGLIIPVFSRVFVDDILLGGLHSWVWPLLLGMGITAMLRGVLT
                     WMQQYYLLRLETKIALATSGQFLWHIFRLPSEFFSQRAAGELTSRIQSNDKVAKLLSG
                     KLATTALNVLMIMFYFTLMLTYSWILALVGLAIAFINVGYLIAVSARRVDLNRRLLQD
                     EGKLIGSSMAGLQIIETLKATGSEANFFAQWSGYQAKLLNAEQELGVSSQFLSVFPSF
                     LTGINNALVLVIGGFLILDGQMTIGMLVAFQSLMSSFMTPVTGLVGLGAELQEMTGEM
                     NRLDDVLNYPLGRNQGDQGGQGGQEDLGGTAEPPAGQKLSGYVELRNITFGYSILEPP
                     LIEDFSLSLRPGSRVALVGGSGSGKSTIAKIIAGIHHPWSGEILFDGQPRSSFTKEVL
                     SNSLAMVDQEICMLQGTVKENITLWDGTISEFEMIRAARDACIHDEITARPGGYEQMV
                     EEGGKNYSGGQRQRLEIARALAQNPVILIMDEATSALDPITEKNVDEYIRYRGCTCII
                     VAHRLSTIRDCDEIIVLEKGKIIERGTHGSLYERAGTYAKLIATG"
     misc_feature    182308..184461
                     /locus_tag="DSY0173"
                     /note="NHLM bacteriocin system ABC transporter,
                     peptidase/ATP-binding protein; Region: NHLM_micro_ABC1;
                     TIGR03796"
                     /db_xref="CDD:163508"
     misc_feature    182311..182685
                     /locus_tag="DSY0173"
                     /note="A sub-family of peptidase family C39. Peptidase
                     family C39 mostly contains bacteriocin-processing
                     endopeptidases from bacteria. The cysteine peptidases in
                     family C39 cleave the 'double-glycine' leader peptides
                     from the precursors of various...; Region: Peptidase_C39D;
                     cd02420"
                     /db_xref="CDD:239101"
     misc_feature    order(182326..182328,182344..182346,182563..182565,
                     182611..182613)
                     /locus_tag="DSY0173"
                     /note="putative active site [active]"
                     /db_xref="CDD:239101"
     misc_feature    182773..183585
                     /locus_tag="DSY0173"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    183763..184455
                     /locus_tag="DSY0173"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    183865..183888
                     /locus_tag="DSY0173"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(183874..183879,183883..183891,184009..184011,
                     184249..184254,184339..184341)
                     /locus_tag="DSY0173"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    184000..184011
                     /locus_tag="DSY0173"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    184177..184206
                     /locus_tag="DSY0173"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    184237..184254
                     /locus_tag="DSY0173"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    184261..184272
                     /locus_tag="DSY0173"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    184327..184347
                     /locus_tag="DSY0173"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            184508..187303
                     /locus_tag="DSY0174"
                     /db_xref="GeneID:3953671"
     CDS             184508..187303
                     /locus_tag="DSY0174"
                     /note="similarity to COG2274 ABC-type
                     bacteriocin/lantibiotic exporters, contain an N-terminal
                     double-glycine peptidase domain(Evalue: 2E-74)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516407.1"
                     /db_xref="GI:89892920"
                     /db_xref="GeneID:3953671"
                     /translation="MSEIDYGEFVKQAGMSIPLDGQEPLFLQEDGSVWLVEQGKVAVF
                     LATMENQLQAGAKIFLFEGRAGDWLFGITPEGSPHKKGLLVSGLPGSRLLRLDIRQLT
                     ELLRDRRETDGGAQRGLQGPAHGEKIYGAVGQWLHTLARISRHGDISREARVAPGLAF
                     SQDEVAATAEAVLSEYEYLTNDSLRARYHSQVLQGVSDLWDKKIAAEQKRLEEKGRSD
                     QRLMANAIARLAAITEEVETKVLADQTGDPLLDACRLVGRTMQIGIVAPPEVLGSSKV
                     MLLDEIARASRIRVREVSLHGNWYTQDSGPLLGYMKEDHRPIALIPATPASYCIHDYT
                     LGITRSVDSETAQEIDAFGFVFYRPLAERKITARDLLALGWGNSWRRDFLMILLMGVL
                     GGILGTATPLATGIIFNTIIPEGERGHLVQIAFFLGASALAAMIFQFVRSLAALRIEG
                     KMEGAIQAAIWDRLLSLPVPFFKQFPAGELAMRAMGISQIRKILSGVTLNTVLSSIFS
                     VFTLVLMFYYDRRLAAAATMLVAVELLIIGFLGYLQVHYERKILEVSNQIAGMMLQLI
                     GSITKFRVAGAEVRVFYRWAERFSEQRQFVFKKRILGNWLTTFHDVFPILAGMIIFYT
                     LIAGHSLLSPGEFIGFNAAFISFMMSMTSLTEALIGAYSVIPLYQRAKPILDTLPEYD
                     ETKIAPAPLRGSIAMDHISFRYKVDGPLVLKDVSCRIEEGDYVALVGTSGCGKSTLLR
                     ILLGFEKPETGKIYYDGQDLEKVDIRAIRKQLGVVLQNGQLMSGNIFTNIVGANPYLT
                     IDDAWAAVKMVGMEEDIQAMPMGMHTMISEGASTLSGGQRQRLMIARAIVNQPKILFF
                     DEATSALDNRTQAMVSQSLDRLKVTRIVIAHRLSTIINCSKIIVMDQGRIVESGTYDE
                     LMSKGGIFANLVHRQLT"
     misc_feature    185243..187297
                     /locus_tag="DSY0174"
                     /note="NHLM bacteriocin system ABC transporter,
                     ATP-binding protein; Region: NHLM_micro_ABC2; TIGR03797"
                     /db_xref="CDD:234357"
     misc_feature    185654..186460
                     /locus_tag="DSY0174"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    186590..187282
                     /locus_tag="DSY0174"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    186692..186715
                     /locus_tag="DSY0174"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(186701..186706,186710..186718,186836..186838,
                     187076..187081,187166..187168)
                     /locus_tag="DSY0174"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    186827..186838
                     /locus_tag="DSY0174"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    187004..187033
                     /locus_tag="DSY0174"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    187064..187081
                     /locus_tag="DSY0174"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    187088..187099
                     /locus_tag="DSY0174"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    187154..187174
                     /locus_tag="DSY0174"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            187512..188501
                     /locus_tag="DSY0175"
                     /db_xref="GeneID:3953672"
     CDS             187512..188501
                     /locus_tag="DSY0175"
                     /note="similarity to COG0789 Predicted transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516408.1"
                     /db_xref="GI:89892921"
                     /db_xref="GeneID:3953672"
                     /translation="MTLQPISKVSKAYGVSTRTLRYYEQLGLLQSSKLPGYAYRAYDE
                     EALSRLRQILVLRKLRIPLKQIGVILETRDARLAIEVFEQSITGLQSEKQALETIEGI
                     LRSFVRELEKLLPEPLSPHVFEQEHVMELVQALSVKTLSQKEETSMEELNRASELLEH
                     LKDIRILYLPPMTVASCQSTGDNQEEVVGAAISTFIKESGLGESKPDFRRIGFNNPAS
                     EQSGGSLGYEAWVSIPGDMEVPAPLVKKQFLGGLYAAHMIAFGEFQEWGRLWQWVMDN
                     GEYDVDFSPRTDPADLGADPSLEEQLNAIHHLEDTSPFGTQLDLLVPIKPKQG"
     misc_feature    187524..187853
                     /locus_tag="DSY0175"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    187527..187811
                     /locus_tag="DSY0175"
                     /note="Helix-Turn-Helix DNA binding domain of MerR-like
                     transcription regulators; Region: HTH_MerR-like; cd00592"
                     /db_xref="CDD:133378"
     misc_feature    order(187527..187532,187572..187574,187623..187631)
                     /locus_tag="DSY0175"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133378"
     misc_feature    order(187665..187667,187674..187676,187686..187691,
                     187716..187718,187755..187757,187767..187769,
                     187785..187787,187797..187799,187806..187811)
                     /locus_tag="DSY0175"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133378"
     misc_feature    187998..188486
                     /locus_tag="DSY0175"
                     /note="Bacterial transcription activator, effector binding
                     domain; Region: AraC_E_bind; smart00871"
                     /db_xref="CDD:214874"
     gene            188779..189336
                     /locus_tag="DSY0176"
                     /db_xref="GeneID:3953673"
     CDS             188779..189336
                     /locus_tag="DSY0176"
                     /note="similarity to COG0778 Nitroreductase(Evalue:
                     1E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516409.1"
                     /db_xref="GI:89892922"
                     /db_xref="GeneID:3953673"
                     /translation="MVDEEKEAIPRLHSDMEAITAIAGRASVRKYADKTVEPQKLEVI
                     LRAGLSAPSAKNKRPFHFVVVEDKAVLGAWAAGNSNAKMLSHAPCCIVVCGDGNVEGT
                     RDFLVGGCAAATQNMLIAIHALGLGGVWCGVLRGKEWSRQVAADLYLPVKVEPLTVIA
                     LGYPTEQEKAPVPWDMKSHIHYERW"
     misc_feature    188833..189333
                     /locus_tag="DSY0176"
                     /note="NAD(P)H:flavin oxidoreductase-like family 1.  A
                     subfamily of the nitroreductase family containing
                     uncharacterized proteins that are similar to
                     nitroreductase. Nitroreductase catalyzes the reduction of
                     nitroaromatic compounds such as nitrotoluenes; Region:
                     NADPH_oxidoreductase_1; cd02150"
                     /db_xref="CDD:239063"
     misc_feature    order(188851..188853,188857..188859,188863..188865,
                     188941..188943,189172..189177)
                     /locus_tag="DSY0176"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239063"
     gene            complement(189720..190583)
                     /locus_tag="DSY0177"
                     /db_xref="GeneID:3953674"
     CDS             complement(189720..190583)
                     /locus_tag="DSY0177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516410.1"
                     /db_xref="GI:89892923"
                     /db_xref="GeneID:3953674"
                     /translation="MHDSTDKRTPLVIAAEINAINQESRRMLLKSAIEVGRRLKEAKE
                     LLNHGEWMKWLKESVSYSKSTAANLMNLYEEYGHLLLNPSDNDSNFQTFGNLTYSQAL
                     LLLGIPEEERQEFAVQNDVANMTARQLNQAVKEQKTPAPVKEPPKTGTETGAEAGAGA
                     MAESQTQPQPQLPPQTQGDIQIKYVSRTVRPRRQSITKTEPAPATSSLVTSYEEKCTA
                     CCQTIANTFQELLTALGHLARLDPRTKEKCSRNADQLASYMVDRLKDWPPVAGTNMKG
                     VQTYSTCEWGG"
     misc_feature    complement(190176..190562)
                     /locus_tag="DSY0177"
                     /note="Protein of unknown function (DUF3102); Region:
                     DUF3102; pfam11300"
                     /db_xref="CDD:256401"
     gene            complement(190792..191697)
                     /locus_tag="DSY0178"
                     /db_xref="GeneID:3954059"
     CDS             complement(190792..191697)
                     /locus_tag="DSY0178"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516411.1"
                     /db_xref="GI:89892924"
                     /db_xref="GeneID:3954059"
                     /translation="MKPSKEFLSLPIVSLSEGQHIGYVKSLVIDAQAKALAALVIDPK
                     GFFRDQRIIPYAKVVSVGADAITIDKGAYVEKSASLPEILSLIKEKLTIIGTRVITQS
                     GKTLGVVEEYYVDPDTGKITQMEISGGKIEGFFSGKAILEADYVVTIGQDVIVAQKGC
                     ETSLMIADKGINDTFKSVLRSTSNLASGTGQAFGKIFSKKDKDKTKHAAKGKVKGKGK
                     GTAEDSASPIPIIEGENMAPLQDPPAAEDENILSSANNQPIEAVIIKDSSPEVPEISP
                     AEQPAETGPELSQVAEAPSTKEPLG"
     misc_feature    complement(191167..191697)
                     /locus_tag="DSY0178"
                     /note="PRC-barrel domain containing protein [General
                     function prediction only]; Region: COG3881"
                     /db_xref="CDD:226398"
     misc_feature    complement(191491..191682)
                     /locus_tag="DSY0178"
                     /note="PRC-barrel domain; Region: PRC; pfam05239"
                     /db_xref="CDD:253112"
     misc_feature    complement(191230..191421)
                     /locus_tag="DSY0178"
                     /note="Protein implicated in RNA metabolism, contains
                     PRC-barrel domain [General    function prediction only];
                     Region: COG1873; cl17889"
                     /db_xref="CDD:248443"
     gene            191763..192353
                     /locus_tag="DSY0179"
                     /db_xref="GeneID:3954060"
     CDS             191763..192353
                     /locus_tag="DSY0179"
                     /EC_number="3.1.1.29"
                     /note="Enables the recycling of peptidyl-tRNAs produced at
                     termination of translation"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="YP_516412.1"
                     /db_xref="GI:89892925"
                     /db_xref="GeneID:3954060"
                     /translation="MSSICLEEWSFMKLIAGLGNPGGQYAETRHNAGFLLLDCLAEEL
                     KLDFRPKFQGLVAETMMGGEKVYLLKPQTFMNLSGRSIRELAQFYKIAPKDIMVVYDD
                     MDLPIGRLRLRSSGSAGGHNGIKSTIAELGTEDFWRLKVGIGRPTAGWDSARYVLASF
                     TKEELPVLEEILDKGIKAVTLWAKEGGDKAMNLYNR"
     misc_feature    191802..192308
                     /locus_tag="DSY0179"
                     /note="Peptidyl-tRNA hydrolase (PTH) is a monomeric
                     protein that cleaves the ester bond linking the nascent
                     peptide and tRNA when peptidyl-tRNA is released
                     prematurely from the ribosome. This ensures the recycling
                     of peptidyl-tRNAs into tRNAs produced through...; Region:
                     PTH; cd00462"
                     /db_xref="CDD:238259"
     misc_feature    order(191820..191822,191850..191852,191982..191987,
                     192063..192065,192123..192125)
                     /locus_tag="DSY0179"
                     /note="putative active site [active]"
                     /db_xref="CDD:238259"
     misc_feature    191850..191852
                     /locus_tag="DSY0179"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238259"
     gene            192416..192991
                     /locus_tag="DSY0180"
                     /db_xref="GeneID:3954061"
     CDS             192416..192991
                     /locus_tag="DSY0180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516413.1"
                     /db_xref="GI:89892926"
                     /db_xref="GeneID:3954061"
                     /translation="MPLPQERGNFTYADYLSWPQHERWEIIDGVAYMQAAPSSVHQEI
                     LTGLLVQFHQYLAGKAGKVYPAPFCVRLIENDEKNDEEIIKVVEPDITVVCDKSKVDE
                     KGCCGVPDLIVEIISPTSTEMDKLVKFNKYEKAGVREYWIVEPEGRFVSVFVLREQKY
                     GRPEIYAENDKIKVAIFPDLLIDLKPVFEGI"
     misc_feature    192479..192955
                     /locus_tag="DSY0180"
                     /note="Domain of unknown function (DUF820). This family
                     consists of hypothetical proteins that are greatly
                     expanded in cyanobacteria. The proteins are found
                     sporadically in other bacteria. They have been predicted
                     to belong to the PD-(D/E)xK superfamily of...; Region:
                     DUF820; cd06260"
                     /db_xref="CDD:99749"
     misc_feature    order(192536..192538,192683..192685,192755..192757,
                     192797..192799,192809..192811)
                     /locus_tag="DSY0180"
                     /note="putative active site [active]"
                     /db_xref="CDD:99749"
     gene            193354..194232
                     /locus_tag="DSY0181"
                     /db_xref="GeneID:3954062"
     CDS             193354..194232
                     /locus_tag="DSY0181"
                     /note="similarity to COG0226 ABC-type phosphate transport
                     system, periplasmic component(Evalue: 4E-28)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516414.1"
                     /db_xref="GI:89892927"
                     /db_xref="GeneID:3954062"
                     /translation="MSETAAHYGITHENYPRIDGLTSTQGIAMAINQAMYRYLENENL
                     PMEVSKTVPSYKRLIAGEVELILVPYPSAAVLALAQESGVELEFHPVAAEALIFITPA
                     ENPADNITGDQVRTIYLDYGIRSWSELGGSDKELIPICRNADSGSQSQLDNLVLHDQP
                     MHPGIQKNYVELTMEGMLELVAFYHHGGLDGKPTDSYALGYTLYTYLQNMNEVTEIGS
                     RLKILSFEGVEPTEENIAKGSYSLADGYYAVVRKDLPAAHSARGILKWLQSDEAAAAI
                     KARGFIPKQDRTKLSW"
     misc_feature    193402..194166
                     /locus_tag="DSY0181"
                     /note="PBP superfamily domain; Region: PBP_like_2;
                     pfam12849"
                     /db_xref="CDD:257347"
     gene            194510..194935
                     /locus_tag="DSY0182"
                     /db_xref="GeneID:3954063"
     CDS             194510..194935
                     /locus_tag="DSY0182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516415.1"
                     /db_xref="GI:89892928"
                     /db_xref="GeneID:3954063"
                     /translation="MRVLIDTNVILDAVIRRVPYNNPAERLFLLIAGDRLKAYITASS
                     VTDIYYLLHRHFRDADQAKQVLAKLFVLFEVLEVTQSDCERALSLAMDDYEDALLATC
                     AKRKKLDMIITRNLPYFKDSPVKAIAPDEFIAHYFDEEG"
     misc_feature    194513..194848
                     /locus_tag="DSY0182"
                     /note="Predicted nucleic acid-binding protein, contains
                     PIN domain [General function prediction only]; Region:
                     COG1848"
                     /db_xref="CDD:224761"
     misc_feature    order(194525..194527,194795..194797,194852..194854)
                     /locus_tag="DSY0182"
                     /note="putative active site [active]"
                     /db_xref="CDD:189022"
     gene            complement(195034..196260)
                     /locus_tag="DSY0183"
                     /db_xref="GeneID:3954064"
     CDS             complement(195034..196260)
                     /locus_tag="DSY0183"
                     /note="similarity to COG1373 Uncharacterized ATPases of
                     the AAA superfamily(Evalue: 1E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516416.1"
                     /db_xref="GI:89892929"
                     /db_xref="GeneID:3954064"
                     /translation="MAYIKRTIETTIENAAKMFSTVLITGARQVGKTTVLKHITEDIS
                     YLTLDDPILLLNAFEEAGSFFKSTPPPVIIDEIQYAPNLFPYIKMIADENGKRGQFYL
                     TGSQQFKMMKNVSESLAGRIGIINLLGLSLREIKGDADFNKAFIPTESYLETRRLSAK
                     ELNYKEIWKIIYKGSMPAMYADELDWQLFYGSYTKTYLERDVRELTQVGDELKFIKFM
                     TAMASRTSQMLNLTSIANEVGISVPTADRWLSILVSSNIVYLLKPYYNYIMKRAVKTP
                     KLYFLDTGLAAYLTKWNSPDVIEAGAMSGAFFETFVLAEILKGYYNAGILEPALYYYR
                     DKDAKEIDIILEENGTLYPIEIKKTANPSKEHIANFSVLDRLKDMKIGTGCVICMYDK
                     VIHINDNNVSIPVTWL"
     misc_feature    complement(195190..196212)
                     /locus_tag="DSY0183"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    complement(195856..196197)
                     /locus_tag="DSY0183"
                     /note="AAA domain; Region: AAA_14; pfam13173"
                     /db_xref="CDD:257541"
     misc_feature    complement(195190..195669)
                     /locus_tag="DSY0183"
                     /note="Domain of unknown function (DUF4143); Region:
                     DUF4143; pfam13635"
                     /db_xref="CDD:257945"
     gene            196631..197932
                     /locus_tag="DSY0184"
                     /db_xref="GeneID:3954065"
     CDS             196631..197932
                     /locus_tag="DSY0184"
                     /note="similarity to COG1373 Uncharacterized ATPases of
                     the AAA superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516417.1"
                     /db_xref="GI:89892930"
                     /db_xref="GeneID:3954065"
                     /translation="MICLRRKLEEKLVQWKDRSEGRMPLLLYGARQVGKTYLLAELGE
                     KHFANTVYINLETNPAVAGYFADDITPERLIRFLETTVNQEIIPGKTLIIFDEIQSCE
                     RALTSLKYFCESAPEYHVAAAGSLLGVAINREHYSFPVGKVESMTLFPLDFEEFLWAM
                     GEERLAQEIRRCFSLLEPMAEVLHQKAIELYRYYLIVGGMPACVELFKRTGKLVLIPT
                     SQNEILNNYVADMAKYAGAADTVKIRACFNSIPAQLAKENKKFQYKVVQKGGSASLFG
                     VSIDWLTQAGIVLKCQKLEQAMNPIAVYVDLSSFKLYMSDVGLLVMKSGLPQQSVLTG
                     EANLFMGSVAENYVAQALAANGHSLYYWTSEHTAELDFVLQKGRDIIGIEVKKGTKVK
                     SKSINVFSQRYHSAYCIRFSEKNFGKTDNLWSVPLYGAFCV"
     misc_feature    196640..197914
                     /locus_tag="DSY0184"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    196658..>196930
                     /locus_tag="DSY0184"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    196715..196738
                     /locus_tag="DSY0184"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(196718..196741,196916..196918)
                     /locus_tag="DSY0184"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    196904..196921
                     /locus_tag="DSY0184"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    197309..197794
                     /locus_tag="DSY0184"
                     /note="Domain of unknown function (DUF4143); Region:
                     DUF4143; pfam13635"
                     /db_xref="CDD:257945"
     gene            complement(198022..198699)
                     /locus_tag="DSY0185"
                     /db_xref="GeneID:3954066"
     CDS             complement(198022..198699)
                     /locus_tag="DSY0185"
                     /note="similarity to COG3381 Uncharacterized component of
                     anaerobic dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic dehydrogenase"
                     /protein_id="YP_516418.1"
                     /db_xref="GI:89892931"
                     /db_xref="GeneID:3954066"
                     /translation="MDTTEQKDLLEIRQFMYSFLSAVFLYPPQAEQVTMILQRQLFKE
                     FPLDIADEQYQEALANLVRWTNENCASDLVNVTSSLNKDYTALFIGPGHLAAPPWESV
                     YRTEERLTFGEPTLEVREWYQRCGLEFVHKNSEPDDHFGLELEFMSKLIASELEAWEE
                     DDVIKAEGLAREQPAFLDEHLLRWAKEFTQDVQASAQTLYYQGLAQLAYSYLIWDGKQ
                     LRDGKNT"
     misc_feature    complement(198064..198663)
                     /locus_tag="DSY0185"
                     /note="Nitrate reductase delta subunit; Region:
                     Nitrate_red_del; cl00958"
                     /db_xref="CDD:260720"
     gene            198925..201324
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /db_xref="GeneID:3958113"
     CDS             198925..201324
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG0243 Anaerobic dehydrogenases,
                     typically selenocysteine-containing(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic DMSO reductase subunit A"
                     /protein_id="YP_516419.1"
                     /db_xref="GI:89892932"
                     /db_xref="GeneID:3958113"
                     /translation="MSKQPELQNKTKISRRAFVKWSAAATATAAIAPSLVGCSTQTQA
                     SGEPAVVQAGQRLAGAEEKPSICWHNCGGRCQLKAYVKDGVVVRFGTDNVGPDTPEDL
                     QARACLKGRTQRQRLYHPDRLKYPMKRVGERGSGEWARISWEEAFDTTAKELRRIIDQ
                     YGNESVYFNYACGAYGLLNQTNSNNSLRRLLNIMGGYLQSYGNYSQANYMYAVPYMFG
                     NPYSGSSPTTFPDAKLIVMFGDNPACTRVGGFNSTYYLKLAKQNGARIIVIDPRHSDT
                     VSTFADQWIPIRPTTDSALVAGMAYVMISEGLHDQAFLDKYCLGFDEEHMPEGIPAGN
                     SYKSYILGESDGKPKTPEWASEITGIPVETIKQLARDIAGTKPGFILQGRGIQRHGNG
                     EFQSLAVPVLSFMTGNVGILGSNPGLYEGGPSVKTGNYPIGTNPIKTKISIFMWTDAI
                     ERILTKEQDRIEGADKTKSTIKMIINYGGNTLINQHSDSGRTAALLKDDSKCEFILGM
                     DNFMTPSMQYCDIVLPGVTQFEVNDMITRSMGHGVAYYGQKLVEPMFECKTINEVGRA
                     LAERLGVLAQFDDGKSEEDYLREFVGVSQASHPDFPSYEEFREKGIYKTKATKVVAYE
                     KFIKDPEANPLTTPSGKFEIFSKDLYDIQNPQIPAIPKYMPTEEGPEDPLKEKYPLQC
                     IGHHTKRRVHSTFDNMPWLEEAEAQMLWMNPQDAAARGLKDHDMIKVYNDRGTVKVKV
                     KVTPRLIPGVCSLPQGAWYTPDQSGVDVRGCINTLTKWTPNPLSKGNPQHTNLVQIEK
                     A"
     misc_feature    198961..201321
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /note="anaerobic dimethyl sulfoxide reductase, A subunit,
                     DmsA/YnfE family; Region: dmsA_ynfE; TIGR02166"
                     /db_xref="CDD:233756"
     misc_feature    199114..200934
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /note="This CD (MopB_DmsA-EC) includes the DmsA enzyme of
                     the dmsABC operon encoding the anaerobic dimethylsulfoxide
                     reductase (DMSOR) of Escherichia coli and other related
                     DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this
                     group has a  predicted...; Region: MopB_DmsA-EC; cd02770"
                     /db_xref="CDD:239171"
     misc_feature    order(199123..199125,199135..199137,199147..199149,
                     199243..199245)
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /note="putative [Fe4-S4] binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239171"
     misc_feature    order(199537..199539,199639..199641,199654..199659,
                     199729..199737,199789..199794,199798..199800,
                     200074..200079,200086..200088,200356..200358,
                     200362..200364,200374..200376,200380..200382,
                     200446..200451,200461..200463,200515..200517,
                     200602..200604)
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239171"
     misc_feature    200956..201318
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /note="The MopB_CT_DmsA-EC CD includes the DmsA enzyme of
                     the dmsABC operon encoding the anaerobic dimethylsulfoxide
                     reductase (DMSOR) of Escherichia coli and other related
                     DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this
                     group has a  predicted...; Region: MopB_CT_DmsA-EC;
                     cd02794"
                     /db_xref="CDD:239195"
     misc_feature    order(200974..200976,200980..200985,200992..200994,
                     200998..201006,201187..201189,201241..201243,
                     201289..201294)
                     /gene="dmsA"
                     /locus_tag="DSY0186"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239195"
     gene            201338..201910
                     /gene="dmsB"
                     /locus_tag="DSY0187"
                     /db_xref="GeneID:3958129"
     CDS             201338..201910
                     /gene="dmsB"
                     /locus_tag="DSY0187"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG0437 Fe-S-cluster-containing
                     hydrogenase components 1(Evalue: 6E-56)"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic DMSO reductase iron-sulfur subunit B"
                     /protein_id="YP_516420.1"
                     /db_xref="GI:89892933"
                     /db_xref="GeneID:3958129"
                     /translation="MAKQYGFYMDQSNCIGCFTCQIACKDKNDLEVGQCWRKVHEFQG
                     GDTILEGGVYRSNVFAYWLSMSCNHCQEPKCVQNCPAGAMYKREEDGIVLVDQNKCLG
                     CGYCTWSCPYGAPKLAGKTVSKCNFCIDLLEQGKNPACVDACIMRVIEFGPIDELRAK
                     YGNVDEVKGLPSAQITKPCIVISPHKKAIE"
     misc_feature    201347..201823
                     /gene="dmsB"
                     /locus_tag="DSY0187"
                     /note="DMSO reductase, iron-sulfur subunit; Region:
                     DMSO_dmsB; TIGR02951"
                     /db_xref="CDD:131996"
     misc_feature    201536..201793
                     /gene="dmsB"
                     /locus_tag="DSY0187"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            201925..202743
                     /gene="dmsC"
                     /locus_tag="DSY0188"
                     /db_xref="GeneID:3958145"
     CDS             201925..202743
                     /gene="dmsC"
                     /locus_tag="DSY0188"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG3302 DMSO reductase anchor
                     subunit(Evalue: 2E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic DMSO reductase anchor subunit C"
                     /protein_id="YP_516421.1"
                     /db_xref="GI:89892934"
                     /db_xref="GeneID:3958145"
                     /translation="MHELPLLTFTLCLQAAVGAVLWAVVFRIKAQDAPLFKRNTLAAL
                     ILAAVGIVASLLHLGKPMLALTSMFNLATSWLSREIFFSGAFFGLLLIFWWVERREKA
                     PGARTALGVITAGVGLIDIYAMARLYMESIMPAWQNANTLISFYATAIVLGGIVFYVT
                     AGEQREKLPRVDLMLWAVVLVQAAFALGYVASLGALSGAGKETAALLAGSQATLILSW
                     LFTLGGVFLLSLSRTGRLAKQTSFLYLAMAVIVVGEIVGRYLFYTSGIPIGLGL"
     misc_feature    201925..202710
                     /gene="dmsC"
                     /locus_tag="DSY0188"
                     /note="DMSO reductase anchor subunit (DmsC); Region: DmsC;
                     cl17519"
                     /db_xref="CDD:248073"
     gene            203181..206717
                     /locus_tag="DSY0189"
                     /db_xref="GeneID:3954067"
     CDS             203181..206717
                     /locus_tag="DSY0189"
                     /note="similarity to COG1197 Transcription-repair coupling
                     factor - superfamily II helicase(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516422.1"
                     /db_xref="GI:89892935"
                     /db_xref="GeneID:3954067"
                     /translation="MKTLSHYLRLGFDIEAVDKAVSYKEWPQMIYNLTGSQKPAFAAQ
                     LIQKGKPGLIITYSEELAQKWVNDLRSWLPGEDVLYFPSSEWLPFEVLGKSRETTIER
                     IRVLNRLAQDNQCTVVVPALAVNQRSFSRRRWQEYILELKEGTSYDLKDLAQKLSTAG
                     YERLDVVDGKGQFAIRGGIMDIAPLDGEPLRVEFFDDEVDSIRVFDLETQKSTETLKS
                     VKIPPALEVVIRPEELEKLGWEVRAQARKQAGRLNRSGRSDVAEQVMKQAQRIEERLK
                     TGRVDESIYPYLSLLEEPLEPFFSLLSQDHYVILDEPLRLKEQLEFQQKERLEEYTQA
                     LAKGEEFYSPEDQFVSYEQFLRYGEKHPFVLISTLPREIPGVAPKRIFNLNARPLTGF
                     MGKTGILVDEIEHWQKSGHIVNLFVGDEEHAERMLQGLRDRGALAKKHELHEPVQEGG
                     VYVYSSSLDQGFELPLSKLIVLSEAEIYKRERKAAVKRKKAPEKTGQRLQFADLKPGD
                     FVVHVHHGIGQFMGIERIAVGGVEKDYFSVKYAGQDKLYVPLDQLNFLQKYLGSDAET
                     LPKLYKLGGSEWKKVKAKAKSAIKEMAFDLVKLYAQREATKGYAFSPDNVWQQEFEEK
                     FPYQETPDQMQCIVEVKQDMMRQRPMDRLLCGDVGYGKTEVALRAAFKAVMDSKQVAV
                     LVPTTILAQQHFNTFQERFMGYPVSIQMLSRFRSAKEQKLILQGLKEGSIDIVVGTHK
                     LVSDSIKFKDLGLLIVDEEQRFGVAHKEKLKTLKANVDVLTLSATPIPRTLHMSLVGV
                     RDLSIIETPPEDRFPVQTYVAEFRPDVVREAIRREIQRGGQVFFVHNRVEDMEQVVHF
                     LSQLVPEARYGIAHGQMSEKELEQEMLAFLEHESDVLVCTTIIETGLDMPNVNTLIID
                     EADRLGLGQLYQLRGRVGRSNRRAYSYFLYKPQKVLTEVAEKRLAAIREFTEFGSGLK
                     IAMRDLEIRGAGNLIGAQQHGHLAALGFELYSQMLKEAVQELKGEQVEEKIETSIEVQ
                     VDAYLPDIYIGERQLKAALYQRMVAIDNEEDLSMMIDELIDRFGTPPREVENLLKIVR
                     IKWMASGMKIEQIQQLKQQMVFRFAADPGISGEMLMTMATQSPYPVSFGTTGNGNLEI
                     KVRLRSVVQEELLEAIHKVLMVFNGIASKTAS"
     misc_feature    203259..206678
                     /locus_tag="DSY0189"
                     /note="Transcription-repair coupling factor (superfamily
                     II helicase) [DNA replication, recombination, and repair /
                     Transcription]; Region: Mfd; COG1197"
                     /db_xref="CDD:224118"
     misc_feature    204687..204983
                     /locus_tag="DSY0189"
                     /note="CarD-like/TRCF domain; Region: CarD_TRCF;
                     smart01058"
                     /db_xref="CDD:215001"
     misc_feature    205128..205538
                     /locus_tag="DSY0189"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    205155..205169
                     /locus_tag="DSY0189"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    205449..205460
                     /locus_tag="DSY0189"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    205629..206009
                     /locus_tag="DSY0189"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(205713..205724,205788..205793,205866..205874)
                     /locus_tag="DSY0189"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(205890..205892,205956..205958,205968..205970,
                     205977..205979)
                     /locus_tag="DSY0189"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    206262..206558
                     /locus_tag="DSY0189"
                     /note="TRCF domain; Region: TRCF; pfam03461"
                     /db_xref="CDD:251972"
     gene            206756..207703
                     /locus_tag="DSY0190"
                     /db_xref="GeneID:3954068"
     CDS             206756..207703
                     /locus_tag="DSY0190"
                     /note="similarity to COG0760 Parvulin-like peptidyl-prolyl
                     isomerase(Evalue: 5E-30)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516423.1"
                     /db_xref="GI:89892936"
                     /db_xref="GeneID:3954068"
                     /translation="MRSFRKGIIAALVLTLALTGCSSAGGDQWAAKVNGETITEQDFA
                     ARVSNVQKAYEGMGMDFSTDQGKEALNQVKSQVLEAMIASRLVIQEAQRLKLDVNDPS
                     ILEQEKNIIQMVGDESQYQEWLKQQAMTEDEVKNYFALSAEITKDVTVTPEQEKTFFE
                     NNQELYGGKGEEVQARHILVETEDEAKAIIAQLDGGADFSELAKEKSTDTGSQSSGGY
                     LGSFGKGKMVPEFEEAAFAQEVGTYTKTPVKSEFGYHIILVEDHKAATKADYEAVKSQ
                     VAEDALADAKAQKFGGYFDELREKAKANIEYSEKYKPAA"
     misc_feature    206756..207661
                     /locus_tag="DSY0190"
                     /note="peptidylprolyl isomerase; Provisional; Region:
                     prsA; PRK00059"
                     /db_xref="CDD:234605"
     misc_feature    206777..207205
                     /locus_tag="DSY0190"
                     /note="SurA N-terminal domain; Region: SurA_N_3; cl07813"
                     /db_xref="CDD:263474"
     misc_feature    207284..207538
                     /locus_tag="DSY0190"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:250020"
     gene            208018..208560
                     /locus_tag="DSY0191"
                     /db_xref="GeneID:3954069"
     CDS             208018..208560
                     /locus_tag="DSY0191"
                     /note="similarity to COG2002 Regulators of
                     stationary/sporulation gene expression(Evalue: 1E-59)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516424.1"
                     /db_xref="GI:89892937"
                     /db_xref="GeneID:3954069"
                     /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEV
                     ILKKYSPIGELGDFAKEYADSLYEATGHIACIADRDVIIAVSGASKKEYLNKPIWSSI
                     EQAMAERKTVQLKAGEGKPDEDEEHVKLTSQVAAPIIAEGDPIGAVILMSKDPNVKMG
                     DLELKLVETAAGFLAKQMEQ"
     misc_feature    208018..208263
                     /locus_tag="DSY0191"
                     /note="Regulators of stationary/sporulation gene
                     expression [Transcription]; Region: AbrB; COG2002"
                     /db_xref="CDD:224913"
     misc_feature    208021..208554
                     /locus_tag="DSY0191"
                     /note="stage V sporulation protein T; Region: spore_V_T;
                     TIGR02851"
                     /db_xref="CDD:131898"
     misc_feature    <208324..208542
                     /locus_tag="DSY0191"
                     /note="GAF domain; Region: GAF_2; pfam13185"
                     /db_xref="CDD:257553"
     gene            208687..210168
                     /locus_tag="DSY0192"
                     /db_xref="GeneID:3954070"
     CDS             208687..210168
                     /locus_tag="DSY0192"
                     /note="similarity to COG1694 Predicted
                     pyrophosphatase(Evalue: 3E-67)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516425.1"
                     /db_xref="GI:89892938"
                     /db_xref="GeneID:3954070"
                     /translation="MSNILHVVGLGPAGLESMTLGDYRMIKEAGRVFLRTVNHPCAQD
                     LLAEGLQAESFDYLYERENSFERIYEEIVSRLEKECELYPEVVYGVPGHPTVAERSVV
                     LLVDKLSERFQVKVHPAVSFLDPLFAAIPLDPVEGFLLRNYDALKGSGITGKEWLIIP
                     QVYDGFIASEVKLDLMDIYPDEVELYVVQALGTKMQKVWQCPLYQLDHQTFDHLTTVV
                     VPPCGEGISMTKLLEVMSTLRGRGGCPWDAEQTHDSLKPYLIEESYEVLEAIEAQDMY
                     NLAEELGDLLLQVVFHAQVAQEAGEFQFQDVLKGIIDKMIRRHPHVFGDVRVQNSAEV
                     LSNWDQIKKEEKGEKAEEELFSFPKGLPALMLAVKTQKKVAKFGFDWPDLKGPLAKVY
                     EELKELEEAMAEQKGIQEEFGDILFALVNLSRFIKCDPEDSLRQTIRKFQLRFLEMAK
                     LAGQAGEGLGDLNLEKMDYYWEIAKSKEKNKEIGNNPEIKAGV"
     misc_feature    208687..210123
                     /locus_tag="DSY0192"
                     /note="Protein containing tetrapyrrole methyltransferase
                     domain and MazG-like (predicted pyrophosphatase) domain
                     [General function prediction only]; Region: COG3956"
                     /db_xref="CDD:226465"
     misc_feature    208705..209352
                     /locus_tag="DSY0192"
                     /note="S-AdoMet dependent tetrapyrrole methylases; Region:
                     TP_methylase; cl00304"
                     /db_xref="CDD:260339"
     misc_feature    order(208720..208722,208957..208965,208972..208980,
                     209047..209052,209110..209112,209161..209166,
                     209248..209250,209254..209259,209329..209334)
                     /locus_tag="DSY0192"
                     /note="active site"
                     /db_xref="CDD:212499"
     misc_feature    order(208720..208722,208738..208749,208753..208758,
                     208969..208974,208990..208992,208999..209004,
                     209029..209049,209065..209073,209077..209082,
                     209098..209106,209269..209271)
                     /locus_tag="DSY0192"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212499"
     misc_feature    order(208957..208965,208972..208977,209047..209052,
                     209164..209166,209248..209250,209254..209259,
                     209329..209334)
                     /locus_tag="DSY0192"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212499"
     misc_feature    209377..209709
                     /locus_tag="DSY0192"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) N-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs; Region:
                     NTP-PPase_MazG_Nterm; cd11528"
                     /db_xref="CDD:212135"
     misc_feature    order(209377..209379,209386..209388,209440..209445,
                     209452..209454,209461..209466,209473..209478,
                     209485..209487,209494..209496,209509..209511,
                     209518..209523,209530..209547,209551..209553,
                     209560..209562,209587..209589,209596..209610,
                     209614..209622,209626..209631)
                     /locus_tag="DSY0192"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212135"
     misc_feature    order(209470..209472,209479..209481,209527..209529,
                     209536..209538)
                     /locus_tag="DSY0192"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212135"
     misc_feature    209770..210111
                     /locus_tag="DSY0192"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) C-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs'; Region:
                     NTP-PPase_MazG_Cterm; cd11529"
                     /db_xref="CDD:212136"
     misc_feature    order(209770..209778,209782..209787,209794..209796,
                     209806..209808,209815..209823,209857..209862,
                     209878..209883,209908..209916,209920..209928,
                     209932..209937,209941..209943,209962..209970,
                     209977..209979,209983..210012,210019..210024,
                     210031..210033,210076..210078,210085..210087,
                     210097..210099)
                     /locus_tag="DSY0192"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212136"
     misc_feature    order(209821..209829,209854..209856,209866..209868,
                     209875..209877,209905..209907,209914..209919,
                     209926..209928)
                     /locus_tag="DSY0192"
                     /note="active site"
                     /db_xref="CDD:212136"
     misc_feature    order(209863..209868,209875..209877,209914..209919,
                     209926..209928)
                     /locus_tag="DSY0192"
                     /note="putative chemical substrate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:212136"
     misc_feature    order(209866..209868,209875..209877,209917..209919,
                     209926..209928)
                     /locus_tag="DSY0192"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212136"
     gene            210226..210501
                     /locus_tag="DSY0193"
                     /db_xref="GeneID:3954071"
     CDS             210226..210501
                     /locus_tag="DSY0193"
                     /note="similarity to COG0776 Bacterial nucleoid
                     DNA-binding protein(Evalue: 6E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516426.1"
                     /db_xref="GI:89892939"
                     /db_xref="GeneID:3954071"
                     /translation="MNKADLVAAVAEKAEVSKKDAEKAVNAVFASIEEALAKNEKVQL
                     VGFGTFEVKDRAERTGRNPQTKEAIVIPASKVPGFKAGKALKDAVQQ"
     misc_feature    210229..210486
                     /locus_tag="DSY0193"
                     /note="histone-like DNA-binding protein HU; Region: HU;
                     cd13831"
                     /db_xref="CDD:259853"
     misc_feature    order(210241..210243,210250..210255,210262..210264,
                     210289..210300,210304..210312,210316..210324,
                     210328..210333,210343..210357,210364..210366,
                     210448..210456,210460..210462,210466..210468,
                     210478..210483)
                     /locus_tag="DSY0193"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(210382..210384,210388..210393,210397..210399,
                     210403..210414,210427..210432,210436..210438)
                     /locus_tag="DSY0193"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            210589..210861
                     /locus_tag="DSY0194"
                     /db_xref="GeneID:3954072"
     CDS             210589..210861
                     /locus_tag="DSY0194"
                     /note="similarity to COG1188 Ribosome-associated heat
                     shock protein implicated in the recycling of the 50S
                     subunit (S4 paralog)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516427.1"
                     /db_xref="GI:89892940"
                     /db_xref="GeneID:3954072"
                     /translation="MRIDKYLKVSRLIKRRTVAKDICEGEKIRLNGRIAKPSAEVKPG
                     DIVTLEMARHLLEVRVLSTPNSAKANEAHLLYEVLKDEKRGGQEEI"
     misc_feature    210589..>210735
                     /locus_tag="DSY0194"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(210592..210594,210628..210633,210637..210642,
                     210646..210651,210658..210663,210667..210669,
                     210688..210693,210694..210708,210712..210714)
                     /locus_tag="DSY0194"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            211771..212064
                     /locus_tag="DSY0195"
                     /db_xref="GeneID:3954073"
     CDS             211771..212064
                     /locus_tag="DSY0195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516428.1"
                     /db_xref="GI:89892941"
                     /db_xref="GeneID:3954073"
                     /translation="MEKGGLVGMEKNPSNHRLAMDNRQFLSLTGVSKVQSFDPKEILL
                     ETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPRNSGSRQNVWAKIFR"
     misc_feature    211816..212061
                     /locus_tag="DSY0195"
                     /note="YabP family; Region: YabP; cl06766"
                     /db_xref="CDD:244496"
     gene            212141..212629
                     /locus_tag="DSY0196"
                     /db_xref="GeneID:3954074"
     CDS             212141..212629
                     /locus_tag="DSY0196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516429.1"
                     /db_xref="GI:89892942"
                     /db_xref="GeneID:3954074"
                     /translation="MIWVVAAGAAVGFVFDFYRSLRKWLGWGKVMTVVGDLIFSAAAL
                     FLLFKFFLKANHLDLRFYIVWGSVLGLFLYTRILSRITLWLFFKCYRFIEACLGLILL
                     VLKFPFKVLAVLMRPPYAALRWFSLLVFRIAEAFLGKPLTKTRKTMISFWERLFPPRT
                     NG"
     misc_feature    212141..212380
                     /locus_tag="DSY0196"
                     /note="Spore cortex protein YabQ (Spore_YabQ); Region:
                     Spore_YabQ; pfam09578"
                     /db_xref="CDD:204269"
     gene            213046..213372
                     /locus_tag="DSY0197"
                     /db_xref="GeneID:3954075"
     CDS             213046..213372
                     /locus_tag="DSY0197"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516430.1"
                     /db_xref="GI:89892943"
                     /db_xref="GeneID:3954075"
                     /translation="MILTKKSPTTKESRPKTRKQPFRPLSTLVVLFAFCALVSSAYQL
                     YELRKEVNQSIAQLNQEKEDLLQQQKLLEEEILQLNTPSYIEQLAREQLGLVRKGEIR
                     IAPKTE"
     misc_feature    213127..213348
                     /locus_tag="DSY0197"
                     /note="Septum formation initiator; Region: DivIC;
                     pfam04977"
                     /db_xref="CDD:252916"
     gene            213495..213881
                     /locus_tag="DSY0198"
                     /db_xref="GeneID:3954076"
     CDS             213495..213881
                     /locus_tag="DSY0198"
                     /note="similarity to COG1098 Ribosomal protein S1
                     domains(Evalue: 1E-36)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516431.1"
                     /db_xref="GI:89892944"
                     /db_xref="GeneID:3954076"
                     /translation="MAIAVGTIVEGVVTGITNFGAFVELPEKVTGLVHISEVADAYVK
                     DVRDYLKEQDRVKVKVIHVDEKGKIGLSIKQANPSPKNTTRERRQPTVSFEDKLAKFI
                     KDSDERQLEFRRATESKRGGRGSSRY"
     misc_feature    213495..213878
                     /locus_tag="DSY0198"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05807"
                     /db_xref="CDD:235614"
     misc_feature    213510..213716
                     /locus_tag="DSY0198"
                     /note="S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_hs4; cd05692"
                     /db_xref="CDD:240197"
     misc_feature    order(213534..213536,213558..213560,213588..213590,
                     213594..213596)
                     /locus_tag="DSY0198"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240197"
     gene            214134..216245
                     /locus_tag="DSY0199"
                     /db_xref="GeneID:3954077"
     CDS             214134..216245
                     /locus_tag="DSY0199"
                     /note="similarity to COG2208 Serine phosphatase RsbU,
                     regulator of sigma subunit(Evalue: 2E-52)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516432.1"
                     /db_xref="GI:89892945"
                     /db_xref="GeneID:3954077"
                     /translation="MVRGEVMAEWATLKTKQGLRKEKLTLEGHFWPFLLGLLIARGSI
                     LGLYPFGIAFGAALMLHGRKGTMMGLLGVTAGVSSLFLKDLASGLQILLTLLILSLFV
                     PRLRGNKRESLYLGISTALVTGCVALAVLSFGQFEVSLGMQAAVLGILNGGLAVVFRF
                     ALRYQDAVWRGNFTREQGMAWLLILIGVLSGLHGVMFKEINFSVVVLSFFILFIAQRF
                     GAGAAAGVGAMLGFLPQLEFNPQNLMAAGIYGLAGFGTGAFQKLGKLGLGVAFMSITL
                     MFTVYLQPEVLYSQLLSSGIGLLLFLLFPSTTSQHDFLKDKPMPEVESTVTKVKTVAE
                     IFDQIAYSAQAAEAEVGKSKPEIPELMNVLVERVCKNCPTLDTCWTREFYRTYHLLFN
                     LFEWVEREEEKVNVQNLPVEWKRHCGKLKEMLLGVQFIMEHEKSIESWRSRLTANQEA
                     LARQFQSVSQVIGHLAKELNARHNVEQVKPASLARRRKQFLDVGVASFTKKGNSISGD
                     NYASLAFAPTQHAFIVSDGMGVGEGAAKMSSTALNLLEQLLTTGFEPESAIQALNSIL
                     VLRSPEESFVTLDIGILDCESDDLKLIKVGACPSYIVREDKVHIFQSSSLPVGILNHV
                     EIPVIEEKLRPDEYLVLVTDGIQDILKDGKDWLKKFLDRQHPQTAQELAEAIVQEARA
                     MSGNDLADDGIVLVVKKNIFH"
     misc_feature    214230..216227
                     /locus_tag="DSY0199"
                     /note="stage II sporulation protein E; Region: spore_II_E;
                     TIGR02865"
                     /db_xref="CDD:234038"
     misc_feature    215694..216227
                     /locus_tag="DSY0199"
                     /note="Stage II sporulation protein E (SpoIIE); Region:
                     SpoIIE; pfam07228"
                     /db_xref="CDD:254114"
     gene            216268..217686
                     /locus_tag="DSY0200"
                     /db_xref="GeneID:3953863"
     CDS             216268..217686
                     /locus_tag="DSY0200"
                     /note="similarity to COG0037 Predicted ATPase of the
                     PP-loop superfamily implicated in cell cycle
                     control(Evalue: 2E-41)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516433.1"
                     /db_xref="GI:89892946"
                     /db_xref="GeneID:3953863"
                     /translation="MYEKLKQQVLPQLIAPGSRILAAVSGGPDSVALAHILWRYIQDK
                     QEQKITLVITHVHHGVREESDDEEKMVQNMARDWEIPCLIHRFDSKNYAKSVGKSFQT
                     AAREWRYACWQEDMRKENCTLLATAHHLGDQAETVLYRLLRGSGTAGLAGIYPQKGKL
                     IRPLLTVTKEDILEYCRNEKLPYALDHSNEEPVYVRNKIRLQLLPELQREYNPKIIEA
                     LGRTAEVLRWDEEYLEEEVQSAWKRWAILDTEQRVGLRRTIFELPKAILSRLIRRAAT
                     LVSGEPRGIAFQYVEQVMASQGQVGWSQDLPGLNIGIDYQGVWFQRADWGQSINESPD
                     ILLPSLPVGAHWGEWLPWRDEAGVNWLVGLFCLEKEAEDNDYPGQCVDKVFFDGPGLI
                     RNSEKLQWRYRQEGDCLWLAGLGHKSLKKIFQDAKVPAKHRPVIPLLAMGNEILWIPG
                     VKRGDRYPLEQGKGAVGVLIKC"
     misc_feature    216268..217077
                     /locus_tag="DSY0200"
                     /note="tRNA(Ile)-lysidine synthase MesJ [Cell cycle
                     control, cell division, chromosome partitioning]; Region:
                     MesJ; COG0037"
                     /db_xref="CDD:223115"
     misc_feature    216322..216882
                     /locus_tag="DSY0200"
                     /note="N-terminal domain of predicted ATPase of the
                     PP-loop faimly implicated in cell cycle control [Cell
                     division and chromosome partitioning]. This is a subfamily
                     of Adenine nucleotide alpha hydrolases
                     superfamily.Adeninosine nucleotide alpha hydrolases...;
                     Region: PP-ATPase; cd01992"
                     /db_xref="CDD:238950"
     misc_feature    order(216334..216342,216346..216357,216430..216432,
                     216436..216438)
                     /locus_tag="DSY0200"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238950"
     misc_feature    217459..217659
                     /locus_tag="DSY0200"
                     /note="TilS substrate C-terminal domain; Region: TilS_C;
                     smart00977"
                     /db_xref="CDD:198045"
     gene            217829..219802
                     /locus_tag="DSY0201"
                     /db_xref="GeneID:3953864"
     CDS             217829..219802
                     /locus_tag="DSY0201"
                     /note="similarity to COG0465 ATP-dependent Zn
                     proteases(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516434.1"
                     /db_xref="GI:89892947"
                     /db_xref="GeneID:3953864"
                     /translation="MKFFKNAAVYLLIILIAIMLIRFANPPATQPLDMDYTKFYEAVV
                     TGQVEEVVISTDDNVNTYEVKTKDGQQYVVLGEAKDVDLSAQMNEHKVNVRVNPPVTT
                     PWWAGLITTVLPFLLIGGFIFFMMQQSQGGGNRVMQFGKSRAKLVTDEKKKVTFADVA
                     GADEVKEELEEVVEFLKFPKKFNELGAKIPKGVLLFGPPGTGKTLLARAVAGEAGVPF
                     FSISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGHDER
                     EQTLNQLLVEMDGFNGNEGIIIIAATNRPDILDPALLRPGRFDRQVVVDVPDVKGREE
                     ILKVHVKGKPMHSDVELDVLARRTPGFTGADLANLVNEAALLSARRNEKEIKMNALED
                     SVERVIAGPEKKARVISDYEKKLVSYHEAGHALVGEMLTHTDPLHKVSIIPRGRAGGY
                     TLLLPKEDRNYMTKSHLLDQVTMLLGGRVAEALVLHEISTGASNDLERATGLVRKMIT
                     ELGMSEELGPLTFGQKEGQVFLGRDIARDRNYSEAVAYSIDKEARRMIDECYLKAQTI
                     IQENMHKLNAIAETLMEKETIEAKEFAELMARFDQPVETAQVPEPSETENNTTEHDDL
                     LPATEETSVEEEGRTEAEGLSGSTLEEEKNKID"
     misc_feature    217895..218125
                     /locus_tag="DSY0201"
                     /note="FtsH Extracellular; Region: FtsH_ext; pfam06480"
                     /db_xref="CDD:253758"
     misc_feature    218138..219619
                     /locus_tag="DSY0201"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    218396..218803
                     /locus_tag="DSY0201"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    218417..218440
                     /locus_tag="DSY0201"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(218420..218443,218594..218596,218735..218737)
                     /locus_tag="DSY0201"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    218582..218599
                     /locus_tag="DSY0201"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    218777..218779
                     /locus_tag="DSY0201"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    219044..219613
                     /locus_tag="DSY0201"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:250619"
     gene            219814..220263
                     /gene="ndk"
                     /locus_tag="DSY0202"
                     /db_xref="GeneID:3953865"
     CDS             219814..220263
                     /gene="ndk"
                     /locus_tag="DSY0202"
                     /note="catalyzes the formation of nucleoside triphosphate
                     from ATP and nucleoside diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="YP_516435.1"
                     /db_xref="GI:89892948"
                     /db_xref="GeneID:3953865"
                     /translation="MEKTFIMLKPDAVQRGLVGQIIARFETKGCKLVGMKLMSVDQAL
                     AEQHYAEHKGKSFFEPTVQYIMSSPVVAMVWEGKNVVALARELMGATNPANANPGSIR
                     GSFGMDISRNVIHGSDSVASAEREIALYFRPEELCDYRKAGEEWLSE"
     misc_feature    219817..220221
                     /gene="ndk"
                     /locus_tag="DSY0202"
                     /note="Nucleoside diphosphate kinase; Region: NDK;
                     pfam00334"
                     /db_xref="CDD:249778"
     misc_feature    219817..220206
                     /gene="ndk"
                     /locus_tag="DSY0202"
                     /note="Nucleoside diphosphate kinase Group I
                     (NDPk_I)-like: NDP kinase domains are present in a large
                     family of structurally and functionally conserved proteins
                     from bacteria to humans that generally catalyze the
                     transfer of gamma-phosphates of a nucleoside...; Region:
                     NDPk_I; cd04413"
                     /db_xref="CDD:239876"
     misc_feature    order(219838..219840,219958..219960,219982..219984,
                     220066..220068,220084..220086,220117..220119,
                     220147..220149,220156..220158,220162..220167,
                     220189..220191)
                     /gene="ndk"
                     /locus_tag="DSY0202"
                     /note="active site"
                     /db_xref="CDD:239876"
     misc_feature    order(219850..219852,219865..219873,219880..219882,
                     219889..219891,219916..219924)
                     /gene="ndk"
                     /locus_tag="DSY0202"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239876"
     gene            220345..221082
                     /locus_tag="DSY0203"
                     /db_xref="GeneID:3953866"
     CDS             220345..221082
                     /locus_tag="DSY0203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516436.1"
                     /db_xref="GI:89892949"
                     /db_xref="GeneID:3953866"
                     /translation="MIRVRGVLTMNLPKNGKMMLTVAGLILGILFISLLKTTGAAGST
                     ARTDTTLASLIQIGQENEQLKNDISKLKEDLSKFQAGQNASKVVLEQLDTAKRNAGLT
                     KVTGPGLRITLDDAQDRDINNEDIQYYVIHEEYIRTIVNLLWHGGAEAVAVNGQRITG
                     NTEIFCSGAFIQIGQTRQMPPYVIEAVGDVNYLQSSLNFYFWDRLGEYQEQYGITRKL
                     EVPTEPLVIPAGKAQQFRYSEPMKEAK"
     misc_feature    220609..221064
                     /locus_tag="DSY0203"
                     /note="Bacterial protein of unknown function (DUF881);
                     Region: DUF881; pfam05949"
                     /db_xref="CDD:253472"
     gene            221082..221774
                     /locus_tag="DSY0204"
                     /db_xref="GeneID:3953867"
     CDS             221082..221774
                     /locus_tag="DSY0204"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516437.1"
                     /db_xref="GI:89892950"
                     /db_xref="GeneID:3953867"
                     /translation="MKKRTLAIPLTLVALVLGFLLTLQMQTQKSVLELEKIQAQRAAS
                     ARDFLAEAQEENKLLKEQHTALTAQLEEARTQGGTSPALLAELDRYRMMEGTVNVQGP
                     GIVITIDDRQQEHKVVLPMSNEDLLEIINTLKFAGAEAISVNGQRVVASSAIVLSGTS
                     TKLINQVPITRTEGVPYEILAIGNQDQLLDYFTQLKAQRLKQLGMSVSVSRKTVQIPS
                     YKGVSPVKSPES"
     misc_feature    221331..221759
                     /locus_tag="DSY0204"
                     /note="Bacterial protein of unknown function (DUF881);
                     Region: DUF881; pfam05949"
                     /db_xref="CDD:253472"
     gene            221957..223627
                     /locus_tag="DSY0205"
                     /db_xref="GeneID:3953868"
     CDS             221957..223627
                     /locus_tag="DSY0205"
                     /note="catalyzes the formation of
                     10-formyltetrahydrofolate from formate and
                     tetrahydrofolate"
                     /codon_start=1
                     /transl_table=11
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="YP_516438.1"
                     /db_xref="GI:89892951"
                     /db_xref="GeneID:3953868"
                     /translation="MKTDIEIAQEATMKPITEIAQGLDLLEDEIELYGKYKAKVNFSA
                     WERLKDKPDAKLILVTAINPTPAGEGKTTTTVGLGQAMSKIGKNAMIALREPSLGPCF
                     GVKGGAAGGGYAQVVPMEDINLHFTGDFHAITSTHNLLAALLDNHIQQGNLLNIDPRQ
                     IVFRRVMDMNDRALRKIVIGLGGRTEGIPRENGFDITVASEIMAILCLAKDLMDLKER
                     FGRIVVAYTYDGKAITAHDLEAEGAMALLMKDAIKPNLVQTLENTPVFIHGGPFANIA
                     HGCNSVVATRMAMKLADYVITEAGFGADLGAEKFYDLKCRFAELKPAATVIVATVRAL
                     KMNGGVAKEDLGPENLEALAKGIVNLEKHIENIGKFGVPAVVAINRFPTDTDAELEFV
                     AERCRQLGAEFALSEVFTKGGEGGIELAKAVLNIVDNKESNFHVLYELDLPIAKKIET
                     ICKEVYGADGVNFTKEALTSMKKYEELGYGQLPICMAKTQYSLTDDQNVLGRPSGFTI
                     TVRELRLSAGAGFLVAITGAIMTMPGLPKRPAALRMDIDAAGRITGLF"
     misc_feature    222005..223576
                     /locus_tag="DSY0205"
                     /note="Formyltetrahydrofolate synthetase (FTHFS) catalyzes
                     the ATP-dependent activation of formate ion via its
                     addition to the N10 position of tetrahydrofolate. FTHFS is
                     a highly expressed key enzyme in both the Wood-Ljungdahl
                     pathway of autotrophic CO2...; Region: FTHFS; cd00477"
                     /db_xref="CDD:238266"
     misc_feature    order(222239..222241,222341..222343)
                     /locus_tag="DSY0205"
                     /note="Potassium binding sites [ion binding]; other site"
                     /db_xref="CDD:238266"
     misc_feature    order(222239..222244,222320..222328)
                     /locus_tag="DSY0205"
                     /note="Cesium cation binding sites [ion binding]; other
                     site"
                     /db_xref="CDD:238266"
     gene            223793..224338
                     /locus_tag="DSY0206"
                     /db_xref="GeneID:3953869"
     CDS             223793..224338
                     /locus_tag="DSY0206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516439.1"
                     /db_xref="GI:89892952"
                     /db_xref="GeneID:3953869"
                     /translation="MPRVNRILQHRNYEEFTEKNKQAEQKRIYCRHGSDHGLAVARIA
                     YLYLLEKYIEDRDSLPGTGTNKASVRLEESYGLGKESIYAAGILHDIGRWVEYENQED
                     HALAGARLARPILKDCGFTEAEMEKIVLGISEHRLPPDQTSSILGQALALADDWARDC
                     QSCSSKATCYKYTKAMEDILI"
     misc_feature    223877..224290
                     /locus_tag="DSY0206"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; smart00471"
                     /db_xref="CDD:214679"
     gene            224694..225593
                     /locus_tag="DSY0207"
                     /db_xref="GeneID:3953870"
     CDS             224694..225593
                     /locus_tag="DSY0207"
                     /note="similarity to COG0294 Dihydropteroate synthase and
                     related enzymes(Evalue: 1E-68)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516440.1"
                     /db_xref="GI:89892953"
                     /db_xref="GeneID:3953870"
                     /translation="MGKSLKGLLDALEPPKQRVLPCRGKDIVLGERTLIMGILNLTPD
                     SFSDGGKFNTLERALKQAEALVEQGADILDIGAESTRINHEPVSAEEEWERLEAVLKA
                     LLPRIAVPISVDTYKADVAERALAAGVHMINDVWGLQKDPRMAEVVGRAQAPVIVMHN
                     QEGSNYHHLMGDIMAYLKKSIHLAEEQGLAGDQIIIDPGIGGTAFGKSLDIDLEIMSR
                     LEEFRSLGRPILLGTSRKSMIGQTLNLPTEERLEGTLATSVVGVAAGVDILRVHDVQA
                     NKRAVQMADAIYRRKRGENFSGS"
     misc_feature    224778..225569
                     /locus_tag="DSY0207"
                     /note="Dihydropteroate synthase and related enzymes
                     [Coenzyme metabolism]; Region: FolP; COG0294"
                     /db_xref="CDD:223371"
     misc_feature    224790..225548
                     /locus_tag="DSY0207"
                     /note="DHPS subgroup of Pterin binding enzymes. DHPS
                     (dihydropteroate synthase), a functional homodimer,
                     catalyzes the condensation of p-aminobenzoic acid (pABA)
                     in the de novo biosynthesis of folate, which is an
                     essential cofactor in both nucleic acid and...; Region:
                     DHPS; cd00739"
                     /db_xref="CDD:238380"
     misc_feature    order(224811..224813,225033..225035,225090..225092,
                     225096..225098,225165..225167,225282..225284,
                     225387..225389,225399..225401,225501..225503,
                     225507..225509)
                     /locus_tag="DSY0207"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238380"
     misc_feature    order(225330..225332,225342..225347,225459..225461,
                     225471..225473,225483..225485,225528..225533)
                     /locus_tag="DSY0207"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238380"
     misc_feature    225393..225401
                     /locus_tag="DSY0207"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238380"
     gene            225583..225951
                     /locus_tag="DSY0208"
                     /db_xref="GeneID:3953871"
     CDS             225583..225951
                     /locus_tag="DSY0208"
                     /note="similarity to COG1539 Dihydroneopterin
                     aldolase(Evalue: 4E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516441.1"
                     /db_xref="GI:89892954"
                     /db_xref="GeneID:3953871"
                     /translation="MDRDRIALRGLKFFAYHGMLREEKILGQTFIVDIDLYADLSKAG
                     KSDQVEDTINYAEVYARIKTIVKREKYQLIERLAERIAEDVLGEFPCEGVRVVIHKPQ
                     APIPGIFDEAFVEIYREKKR"
     misc_feature    225589..225939
                     /locus_tag="DSY0208"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(225592..225624,225640..225666,225886..225891,
                     225904..225930)
                     /locus_tag="DSY0208"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(225634..225642,225649..225651,225796..225807,
                     225880..225882,225922..225924)
                     /locus_tag="DSY0208"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            225948..226421
                     /locus_tag="DSY0209"
                     /db_xref="GeneID:3953872"
     CDS             225948..226421
                     /locus_tag="DSY0209"
                     /note="similarity to COG0801
                     7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (Evalue: 9E-37)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516442.1"
                     /db_xref="GI:89892955"
                     /db_xref="GeneID:3953872"
                     /translation="MKAYLSIGSNLGDRGHYLQQSCQRLAEHPDVKIIKKSGTYETKP
                     WGNVDQPDFWNQVLEIETSLAPLDLLNLCQEVEKSLGRERLIRWGPRTIDIDLLNYDN
                     KVWEDERLILPHPRMEEREFVLAPLREIAPHYILPSGKKVTEVCGDGEVWRLESK"
     misc_feature    225954..226337
                     /locus_tag="DSY0209"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK). Folate derivatives are essential cofactors in the
                     biosynthesis of purines, pyrimidines, and amino acids as
                     well as formyl-tRNA. Mammalian cells are able to utilize
                     pre-formed folates after...; Region: HPPK; cd00483"
                     /db_xref="CDD:238269"
     misc_feature    order(225969..225971,226071..226076,226080..226082,
                     226104..226106,226110..226112,226155..226157,
                     226167..226169,226176..226178,226191..226193,
                     226197..226199,226209..226211,226218..226220,
                     226227..226229,226233..226238,226278..226280,
                     226287..226292,226305..226307,226311..226313)
                     /locus_tag="DSY0209"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    order(226155..226157,226167..226169,226176..226178,
                     226191..226193,226197..226199,226218..226220,
                     226233..226238,226278..226280,226287..226292,
                     226305..226307)
                     /locus_tag="DSY0209"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            226532..227530
                     /locus_tag="DSY0210"
                     /db_xref="GeneID:3953873"
     CDS             226532..227530
                     /locus_tag="DSY0210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516443.1"
                     /db_xref="GI:89892956"
                     /db_xref="GeneID:3953873"
                     /translation="MDHYDRDGEGKQSIAEHLHVCGVLFYMIRGQELCGLGEVNMNFG
                     IIGAGIVGTAIAIRLRQAGHHLVGVHSRSRRSYERFCTYLHHGERRPLEEWLPEADLL
                     FITTQDCMIRAAAEELTRRGLYKEGQTWIHCSGSVSSRVMQVDKDLPINYLSLHPLQA
                     FAGIDQAVELIPGTHFGIEGDREDIGLAIVTQLGGIPHQLDPQQKPLYHAGAVVASNY
                     LVTLVGLAVQLFEEAGITNQEALESLLPLMKGALQNLENVGLPQALTGPIARGDVDVI
                     RGHLEHMPAKIDPVYRALGLYTLDIGQKKMELNGGAYAKEVWEEMNSLMVKGTNEL"
     misc_feature    226634..227419
                     /locus_tag="DSY0210"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5495"
                     /db_xref="CDD:227782"
     misc_feature    226661..227002
                     /locus_tag="DSY0210"
                     /note="Rossmann-like domain; Region: Rossmann-like;
                     pfam10727"
                     /db_xref="CDD:256142"
     misc_feature    227048..227428
                     /locus_tag="DSY0210"
                     /note="Domain of unknown function (DUF2520); Region:
                     DUF2520; pfam10728"
                     /db_xref="CDD:256143"
     gene            227527..228375
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /db_xref="GeneID:3953874"
     CDS             227527..228375
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /note="catalyzes the formation of (R)-pantothenate from
                     pantoate and beta-alanine"
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="YP_516444.1"
                     /db_xref="GI:89892957"
                     /db_xref="GeneID:3953874"
                     /translation="MIICKKISAVRDIVKEQRGQGRSIALVPTMGYLHEGHLTLVEEA
                     RKSGAFVVMSIFVNPLQFGPNEDFARYPRDLERDAKKAEGAGVDLIFNPEVEEMYPAK
                     NLTHVEVDELGDSLCGASRPGHFRGVTTVVSKLFHIVQPDRAYFGQKDYQQYLIICQM
                     VKDLNFPIEVIGVPIVREEDGLALSSRNIYLSPEQRAEALVLQRSLGEAENWFRQGER
                     SALSIEERIKELIRNESSGEIDYVEIRSAENLHRVEQIEGKIFIALAVRFGSTRLIDN
                     KVLEGM"
     misc_feature    227527..228354
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /note="Pantoate-beta-alanine ligase; Region: PanC;
                     cd00560"
                     /db_xref="CDD:185673"
     misc_feature    order(227608..227619,227626..227628,227632..227637,
                     227644..227646,227698..227700,227707..227709,
                     227737..227739,227908..227910,227917..227922,
                     227962..227967,227971..227976,227983..227985,
                     228046..228054,228076..228087)
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /note="active site"
                     /db_xref="CDD:185673"
     misc_feature    order(227608..227616,227626..227628,227635..227637,
                     227644..227646,227707..227709,227917..227922,
                     227962..227967,227971..227976,227983..227985,
                     228049..228054,228073..228078)
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:185673"
     misc_feature    order(227608..227610,227614..227616,227698..227700,
                     227707..227709,227917..227922,227929..227931,
                     227983..227985)
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /note="pantoate-binding site; other site"
                     /db_xref="CDD:185673"
     misc_feature    227626..227637
                     /gene="panC"
                     /locus_tag="DSY0211"
                     /note="HXXH motif; other site"
                     /db_xref="CDD:185673"
     gene            228376..228759
                     /locus_tag="DSY0212"
                     /db_xref="GeneID:3953875"
     CDS             228376..228759
                     /locus_tag="DSY0212"
                     /EC_number="4.1.1.11"
                     /note="Converts L-aspartate to beta-alanine and provides
                     the major route of beta-alanine production in bacteria.
                     Beta-alanine is essential for the biosynthesis of
                     pantothenate (vitamin B5)"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate alpha-decarboxylase"
                     /protein_id="YP_516445.1"
                     /db_xref="GI:89892958"
                     /db_xref="GeneID:3953875"
                     /translation="MFRTMMKSKIHRATVTEANLKYVGSITIDEELLEVADILPNEKV
                     QVVNNNNGARLETYVIPGKRGERTVCLNGAAARLVQVGDEVIIIAYGIFTDEAARTYE
                     PKVIFVDEGNNPVKIAHEEIHGQQS"
     misc_feature    228382..228711
                     /locus_tag="DSY0212"
                     /note="Aspartate alpha-decarboxylase or L-aspartate
                     1-decarboxylase, a pyruvoyl group-dependent  decarboxylase
                     in beta-alanine production; Region: Asp_decarbox; cd06919"
                     /db_xref="CDD:132994"
     misc_feature    order(228382..228396,228400..228402,228406..228411,
                     228433..228444,228484..228486,228490..228492,
                     228499..228504,228514..228516,228520..228522,
                     228529..228531,228535..228549,228595..228600,
                     228604..228609,228631..228633,228643..228651,
                     228676..228678)
                     /locus_tag="DSY0212"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132994"
     misc_feature    order(228400..228402,228406..228408,228445..228450,
                     228547..228549)
                     /locus_tag="DSY0212"
                     /note="active site"
                     /db_xref="CDD:132994"
     gene            229036..230544
                     /gene="nadB"
                     /locus_tag="DSY0213"
                     /db_xref="GeneID:3958209"
     CDS             229036..230544
                     /gene="nadB"
                     /locus_tag="DSY0213"
                     /note="similarity to COG0029 Aspartate oxidase(Evalue:
                     1E-101)"
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate oxidase"
                     /protein_id="YP_516446.1"
                     /db_xref="GI:89892959"
                     /db_xref="GeneID:3958209"
                     /translation="MRVTVLTKKGIPESNTKHAQGGIAVALDQEDSPSLHYEDTLYAG
                     AGLCESDSVRALVEDGPLRVEELIRMGAHFDRKNGKLAFTQEAAHSRRRVLHANGDAT
                     GEEIERTLIAQALGEERILVKEEQFLLDLLKNSKGEVIGALSLNELTHELEIYLAQAV
                     VLATGGLGQLYCYTTNPEVATGDGIAAAYRAGAQLMDMEFVQFHPTALFIPGAPRFLI
                     SEAVRGEGAQLLNAQGERFMQDVPGKELAPRDVVARGIWREQAKGEVTLDFRPIGVAK
                     VPRRFPMIYQTCLDYGINVLEERLPVAPAAHYMMGGVRTDERGRTSLPNLYANGECAC
                     NGVHGANRLASNSLLDGLVFGGRIVEDIVNTARAKGSSNPQPRDIYAEKDEKLPEAGQ
                     EQIPLKREELQELMWEYVGIIREEEGLKKAIKLIRSWDSAFIPEKEIPQLELKNLLTA
                     GYCVARAALAREESRGGHYRSDYPEINTRDLKHSIQARGTGDVCTIPVSRVD"
     misc_feature    229036..230130
                     /gene="nadB"
                     /locus_tag="DSY0213"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     misc_feature    229039..230460
                     /gene="nadB"
                     /locus_tag="DSY0213"
                     /note="L-aspartate oxidase; Provisional; Region: PRK07395"
                     /db_xref="CDD:236010"
     misc_feature    230230..>230490
                     /gene="nadB"
                     /locus_tag="DSY0213"
                     /note="Fumarate reductase flavoprotein C-term; Region:
                     Succ_DH_flav_C; pfam02910"
                     /db_xref="CDD:251613"
     gene            230507..231394
                     /gene="nadC"
                     /locus_tag="DSY0214"
                     /db_xref="GeneID:3958210"
     CDS             230507..231394
                     /gene="nadC"
                     /locus_tag="DSY0214"
                     /note="similarity to COG0157 Nicotinate-nucleotide
                     pyrophosphorylase(Evalue: 8E-65)"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate nucleotide pyrophosphorylase"
                     /protein_id="YP_516447.1"
                     /db_xref="GI:89892960"
                     /db_xref="GeneID:3958210"
                     /translation="MMFAPFQYQELIERALQEDLGTGDLSSAIFPKTAKTHAKIYAKQ
                     KGIACGLEITKQVFKTVDPELEVSISKADGELVERGTVVMEITGAICSILSAERTALN
                     FLQHLSGVATATFEAVTECYGLPTRITDTRKTIPGLRMLQKYAVAMGGGQNHRFGLYD
                     AVMLKDNHIAAAGGIRPAVAAARSRIGHMVKIEVECENLEQVQEAVAAGAEVIMLDNM
                     NLETMGKAVEIVQGRAVVEASGGIRKGDLRAVAETGVDVISMGAITHSVQAMDFSLDI
                     GDIKALTKERWEKGENCAK"
     misc_feature    230519..231334
                     /gene="nadC"
                     /locus_tag="DSY0214"
                     /note="Nicotinate-nucleotide pyrophosphorylase [Coenzyme
                     metabolism]; Region: NadC; COG0157"
                     /db_xref="CDD:223235"
     misc_feature    230534..231331
                     /gene="nadC"
                     /locus_tag="DSY0214"
                     /note="Quinolinate phosphoribosyl transferase (QAPRTase or
                     QPRTase), also called nicotinate-nucleotide
                     pyrophosphorylase, is involved in the de novo synthesis of
                     NAD in both prokaryotes and eukaryotes. It catalyses the
                     reaction of quinolinic acid (QA) with...; Region: QPRTase;
                     cd01572"
                     /db_xref="CDD:238806"
     misc_feature    order(230582..230587,230795..230800,230810..230812,
                     230900..230902,230906..230908,230918..230923,
                     230978..230983,230993..230995,230999..231001,
                     231005..231010,231017..231019,231050..231052,
                     231299..231301)
                     /gene="nadC"
                     /locus_tag="DSY0214"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238806"
     misc_feature    order(230897..230905,230966..230971,231152..231154,
                     231221..231226,231281..231283,231287..231292,
                     231299..231301)
                     /gene="nadC"
                     /locus_tag="DSY0214"
                     /note="active site"
                     /db_xref="CDD:238806"
     gene            231384..232364
                     /locus_tag="DSY0215"
                     /db_xref="GeneID:3953876"
     CDS             231384..232364
                     /locus_tag="DSY0215"
                     /note="similarity to COG0340 Biotin-(acetyl-CoA
                     carboxylase) ligase(Evalue: 8E-40)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516448.1"
                     /db_xref="GI:89892961"
                     /db_xref="GeneID:3953876"
                     /translation="MRNKILDVLKNQQGEFVSGESLSQALSITRAAVWKQIQGLKEAG
                     YEIEGQTRKGYRLVGTPCALDLWALQQELRTQALGRQLFFFAELSSTNDLLKDMVRQG
                     REHGTVVIARRQTTGHGRMQRAWESPEGGLWLSLLLKPRLSLGDAAKLTLSTGVALAQ
                     TLQDLYGLAAGIKWPNDVVVQGRKIAGILGEVAGEWTTVQTLILGIGVNANFSGQTFS
                     SKLPATTLQDILGYEVNLNHLAAQLLFNLEKEVQSLEQGDVQGLIQRWTSFAVGINQP
                     VRIERAGTVYAGIFKGIREDGELILDLEGQEMTFSSGEVSLRAGDQYSPE"
     misc_feature    231384..231608
                     /locus_tag="DSY0215"
                     /note="Biotin operon repressor [Transcription]; Region:
                     BirA; COG1654"
                     /db_xref="CDD:224568"
     misc_feature    231393..232346
                     /locus_tag="DSY0215"
                     /note="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor; Provisional; Region:
                     PRK11886"
                     /db_xref="CDD:237010"
     misc_feature    231633..232010
                     /locus_tag="DSY0215"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:251729"
     misc_feature    232197..232337
                     /locus_tag="DSY0215"
                     /note="Biotin protein ligase C terminal domain; Region:
                     BPL_C; pfam02237"
                     /db_xref="CDD:251174"
     gene            232420..233196
                     /locus_tag="DSY0216"
                     /db_xref="GeneID:3953877"
     CDS             232420..233196
                     /locus_tag="DSY0216"
                     /EC_number="2.7.1.33"
                     /note="type III; catalyzes the formation of
                     (R)-4'-phosphopantothenate from (R)-pantothenate in
                     coenzyme A biosynthesis; type III pantothenate kinases are
                     not subject to feedback inhibition from coenzyme A and
                     have a high Km for ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_516449.1"
                     /db_xref="GI:89892962"
                     /db_xref="GeneID:3953877"
                     /translation="MILVFDVGNTNIVLGVYEQKDLIYHWRISTDKSRTVDEYAVIIK
                     NLFDLNGLDMSRIKAVVMSSVVPPVMPTLESLARKYFDVEPLVIGPGVKTGMPIVYDN
                     PREVGADRIVNAVAAYHKYGGPLVIVDFGTATTFCAISKRGEYLGGAIAPGVGISTEA
                     LFQRASKLPRIEIVKPKSIIAKNTVAGMQSGIYYGYTGQVDRIVTLMKQELGRDTRVI
                     ATGGLAELIQEDSQEIETVDPFLTLEGLLLIYERNSNQQP"
     misc_feature    232420..233190
                     /locus_tag="DSY0216"
                     /note="pantothenate kinase; Reviewed; Region: PRK13318"
                     /db_xref="CDD:237347"
     gene            233200..234180
                     /locus_tag="DSY0217"
                     /db_xref="GeneID:3953878"
     CDS             233200..234180
                     /locus_tag="DSY0217"
                     /note="similarity to COG0042 Predicted TIM-barrel enzymes,
                     possibly dehydrogenases, nifR3 family(Evalue: 1E-74)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516450.1"
                     /db_xref="GI:89892963"
                     /db_xref="GeneID:3953878"
                     /translation="MDRRAMRLGKFELGIPAFLAPMAGVTDKAFRETVRSVGGLHVWT
                     EMISDKALTYMNSRTLEMLDLSGEASPRIVQLFGSEPEVMAKAAALAVERDAEIIDIN
                     MGCPTPKIVKNGEGSALLQDLPLAQRIAEAVVKAVEVPVTVKMRLGWTAERIVAPELA
                     KRVEAVGVQMVSVHGRTREQFYAGTANRDGIKKVKGGVSIPVIANGDIFSPQEAKTVL
                     EATGCDGVMVGRGSLGNPWLIPQINVFLNKGVLLEEPSLEQKLKVATEHFERVLNYKG
                     ERIGLNEMRKHAVWYIKGIRNAAQMRDYIMQTKTPLEMKNLFRRILQENA"
     misc_feature    233221..234159
                     /locus_tag="DSY0217"
                     /note="putative TIM-barrel protein, nifR3 family; Region:
                     nifR3_yhdG; TIGR00737"
                     /db_xref="CDD:129820"
     misc_feature    233251..233928
                     /locus_tag="DSY0217"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    order(233257..233265,233335..233337,233422..233424,
                     233503..233505,233629..233631,233719..233721,
                     233812..233814,233818..233820,233884..233889)
                     /locus_tag="DSY0217"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(233422..233424,233512..233517,233629..233631,
                     233635..233637,233716..233721,233725..233730,
                     233815..233820,233887..233889)
                     /locus_tag="DSY0217"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(233512..233514,233635..233637,233719..233721,
                     233725..233727)
                     /locus_tag="DSY0217"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(233515..233517,233629..233631,233716..233718,
                     233728..233730,233815..233820)
                     /locus_tag="DSY0217"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            234379..234849
                     /locus_tag="DSY0218"
                     /db_xref="GeneID:3953879"
     CDS             234379..234849
                     /locus_tag="DSY0218"
                     /note="similarity to COG0782 Transcription elongation
                     factor(Evalue: 1E-42)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516451.1"
                     /db_xref="GI:89892964"
                     /db_xref="GeneID:3953879"
                     /translation="MAEKEVILTIEGLKRLEDELETLKTVKRREVAERIKQAIEFGDI
                     SENSEYDDAKNEQAFIEGRIITLEKMLRNARVIDDLEGSEVVALGTTVILKDKEFGEE
                     EEYTIVGSAEADPGSNKISNESPVGKAVLGQPKGTVVEINVPAGILYYEIVDIR"
     misc_feature    234382..234846
                     /locus_tag="DSY0218"
                     /note="transcription elongation factor GreA; Reviewed;
                     Region: greA; PRK00226"
                     /db_xref="CDD:234693"
     misc_feature    234394..234606
                     /locus_tag="DSY0218"
                     /note="Transcription elongation factor, N-terminal;
                     Region: GreA_GreB_N; pfam03449"
                     /db_xref="CDD:251961"
     misc_feature    234625..234846
                     /locus_tag="DSY0218"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            235042..236508
                     /locus_tag="DSY0219"
                     /db_xref="GeneID:3953880"
     CDS             235042..236508
                     /locus_tag="DSY0219"
                     /note="similarity to COG1190 Lysyl-tRNA synthetase class
                     II(Evalue: 1E-177)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516452.1"
                     /db_xref="GI:89892965"
                     /db_xref="GeneID:3953880"
                     /translation="MDEMNDLWRVRLDKLAQLRENGVEPYADRYQRTHMAQEILDGFD
                     TLEGQEVKIAGRMMSKRDQGKVVFTHIQDFSGQIQAYIRKDDVGEDWFELISKFDIGD
                     IVGIKGTVFRTRRGEISVHANEVQILSKSMRPLPEKFHGLTNVELRYRQRYVDLIMNP
                     EVRNVFVMRSKIIRSMRNFLEGQGFLEVETPTLHTIPGGAAARPFITHHNTLDMDLYL
                     RIALELPLKRLIVGGFDKVFEIGRNFRNEGISIKHNPEFTMMELYQAYANFEDIMELT
                     ENMISAIAKEVHGTTEVTYQGQMIDFKTPWRRLPMLEGILEYGGVDFSQIHTDEEAQQ
                     AAKEKGLKVEPGSSRGKIINEFFEEFVEPNLIQPTFVIGHPVEISPLAKRNAEHPEYT
                     DRFEAFAYGRELGNAFSELNDPIDQRQRFEAQVAERDKGDDEAHMMDEDFVQALEYGL
                     PPTGGLGIGIDRLVMLLTDSASIRDVILFPTMRPREDD"
     misc_feature    235045..236499
                     /locus_tag="DSY0219"
                     /note="lysyl-tRNA synthetase; Reviewed; Region: lysS;
                     PRK00484"
                     /db_xref="CDD:234778"
     misc_feature    235189..235509
                     /locus_tag="DSY0219"
                     /note="LysRS_N: N-terminal, anticodon recognition domain
                     of lysyl-tRNA synthetases (LysRS). These enzymes are
                     homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs).
                     This domain is a beta-barrel domain (OB fold) involved in
                     binding the tRNA anticodon stem-loop; Region: LysRS_N;
                     cd04322"
                     /db_xref="CDD:239817"
     misc_feature    order(235204..235209,235258..235263,235348..235350,
                     235426..235428,235435..235443)
                     /locus_tag="DSY0219"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239817"
     misc_feature    order(235216..235218,235222..235227,235243..235245,
                     235276..235278,235282..235284,235336..235338,
                     235378..235380,235396..235398)
                     /locus_tag="DSY0219"
                     /note="putative anticodon binding site; other site"
                     /db_xref="CDD:239817"
     misc_feature    235516..236493
                     /locus_tag="DSY0219"
                     /note="Lys_tRNA synthetase (LysRS) class II core domain.
                     Class II LysRS is a dimer which attaches a lysine to the
                     3' OH group of ribose of the appropriate tRNA. Its
                     assignment to class II aaRS is based upon its structure
                     and the presence of three...; Region: LysRS_core; cd00775"
                     /db_xref="CDD:238398"
     misc_feature    235612..235626
                     /locus_tag="DSY0219"
                     /note="motif 1; other site"
                     /db_xref="CDD:238398"
     misc_feature    order(235708..235710,235774..235776,235780..235782,
                     235798..235800,235810..235812,236227..236229,
                     236248..236250,236257..236259,236269..236271,
                     236425..236427)
                     /locus_tag="DSY0219"
                     /note="active site"
                     /db_xref="CDD:238398"
     misc_feature    235771..235782
                     /locus_tag="DSY0219"
                     /note="motif 2; other site"
                     /db_xref="CDD:238398"
     misc_feature    236416..236427
                     /locus_tag="DSY0219"
                     /note="motif 3; other site"
                     /db_xref="CDD:238398"
     gene            236993..238660
                     /locus_tag="DSY_16SrRNA1"
                     /db_xref="GeneID:3957997"
     rRNA            join(236993..237129,237167..238660)
                     /locus_tag="DSY_16SrRNA1"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:3957997"
     gene            238891..238966
                     /locus_tag="DSY_tRNA5-Ala"
                     /db_xref="GeneID:3958059"
     tRNA            238891..238966
                     /locus_tag="DSY_tRNA5-Ala"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3958059"
     gene            239257..241759
                     /locus_tag="DSY_23SrRNA1"
                     /db_xref="GeneID:3958003"
     rRNA            239257..241759
                     /locus_tag="DSY_23SrRNA1"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:3958003"
     gene            242145..242184
                     /locus_tag="DSY_5SrRNA1"
                     /db_xref="GeneID:3958009"
     rRNA            242145..242184
                     /locus_tag="DSY_5SrRNA1"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:3958009"
     gene            complement(242655..244280)
                     /locus_tag="DSY0220"
                     /db_xref="GeneID:3953881"
     CDS             complement(242655..244280)
                     /locus_tag="DSY0220"
                     /note="similarity to COG0840 Methyl-accepting chemotaxis
                     protein(Evalue: 3E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516453.1"
                     /db_xref="GI:89892966"
                     /db_xref="GeneID:3953881"
                     /translation="MQRNKDVYVSNSKRNQALRLISHIAREMENVLNQSPHGDWAQVI
                     GPLRQVIDANIGDNEFLVINSLEGQALVHSNRFREGNFVTKGELGILGTTKPVSQIYH
                     RDTGEILLDVICPIYIKGEHRYVARMGIPLQKNKLSYNFALSSIPLFVLGLGWSWSSP
                     SLISIGVTLGAFTLWAAYSYIFHHKIISTLNEIFRVTKSITRGNLTNSAAIKTTNELS
                     TLSYEVNKVNNGIKSIIANITTISQKSHEISNSQAAHTKTLAESYEQLAALFQEFSAG
                     SVEQIDGMKRASEQVLEIQAASERIRYSTQEVQISSNSARQVSQDGLRAVEDIIQEME
                     VISSSTYKANTSIQSLEEQALKIGEIVSIINSISGQTNLLALNAAIEAARAGEHGRGF
                     SVVADEIRKLASDSAESAHQIMELIHSVQDMIGSASNDMSRGLVEVENGKIIIRQAGD
                     AIHSLDQVIQGTGEKIQANINNVDQLLLQSKNLAEVQSNAVSIASQFSLAAQQAATTM
                     DGQMQSTQQVASMAKDLAEASEQLDNFIKRFTL"
     misc_feature    complement(242661..243488)
                     /locus_tag="DSY0220"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(242703..243404)
                     /locus_tag="DSY0220"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(242706..242711,242718..242720,
                     242727..242732,242739..242741,242748..242753,
                     242757..242762,242769..242774,242802..242807,
                     242814..242816,242823..242828,242835..242837,
                     242925..242930,242937..242942,242946..242951,
                     242958..242960,242967..242972,242979..242981,
                     242988..242993,243030..243035,243042..243047,
                     243051..243056,243063..243068,243075..243077,
                     243084..243089,243096..243098,243105..243107,
                     243117..243119,243138..243140,243147..243149,
                     243159..243161,243168..243173,243180..243182,
                     243189..243191,243198..243203,243210..243215,
                     243222..243224,243231..243236,243240..243242,
                     243252..243257,243261..243266,243273..243275,
                     243282..243287,243294..243299,243306..243308,
                     243315..243320,243327..243329,243336..243341,
                     243345..243350,243357..243359,243366..243371,
                     243378..243383))
                     /locus_tag="DSY0220"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(243072..243173)
                     /locus_tag="DSY0220"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            244833..246371
                     /locus_tag="DSY0221"
                     /db_xref="GeneID:3953882"
     CDS             244833..246371
                     /locus_tag="DSY0221"
                     /EC_number="6.1.1.13"
                     /note="transfers D-alanine to the D-alanyl carrier protein
                     during the incorporation of D-alanine into lipoteichoic
                     acid"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--poly(phosphoribitol) ligase subunit
                     1"
                     /protein_id="YP_516454.1"
                     /db_xref="GI:89892967"
                     /db_xref="GeneID:3953882"
                     /translation="MSGGLEVNLISRIDSYAESCPDRVAHHYRESRLTYRQLKEASDA
                     LACYLIETLKDDRTPIVVYGHKQHEMLICFLACVKSGHAYIPVDFSLPSQRIEDIIQS
                     SRTRLILSPGESPEREGIRTIRSDAISRLIRSYLGKSPSKDYQVKDHETYYIIYTSGS
                     TGKPKGVQITLANLESFVHWGVGVGRFPEAEVFLNQAPFSFDLSVMDLYLALTSGSTL
                     YSIDKAMIAEPKELFAHFKQSGLTVWVSTPSFAEMCLGDSSFNDELLPDLKVFMFCGE
                     TLSNQCAEKLYRRFPQGKVINSYGPTEATVAVTALIVDLEMCARKEPLPVGRVKEDCR
                     LLIVDSEGVPQEEGSQGEIVILGASVSPGYYRNEEMTDKAFFARSWDGDVKRCYRTGD
                     EGYLKEGLLHYGGRIDFQIKLNGYRIELEDIENNLRKVEGVANAIVLPIKKDGRVHYL
                     AGVVVPNKKLDKREFEIGQMIKAELKNYLPDYMIPRKIMFRDSLPMTVNGKVNRAALM
                     EEFQ"
     misc_feature    244854..246368
                     /locus_tag="DSY0221"
                     /note="D-alanine--poly(phosphoribitol) ligase subunit 1;
                     Provisional; Region: PRK04813"
                     /db_xref="CDD:235313"
     misc_feature    244881..246353
                     /locus_tag="DSY0221"
                     /note="D-alanine:D-alanyl carrier protein ligase (DltA);
                     Region: DltA; cd05945"
                     /db_xref="CDD:213310"
     misc_feature    order(245292..245294,245301..245318,245322..245327)
                     /locus_tag="DSY0221"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213310"
     misc_feature    order(245301..245306,245655..245660,245721..245738,
                     245808..245810,246006..246008,246039..246041,
                     246048..246050,246333..246335)
                     /locus_tag="DSY0221"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213310"
     gene            246368..247516
                     /locus_tag="DSY0222"
                     /db_xref="GeneID:3954078"
     CDS             246368..247516
                     /locus_tag="DSY0222"
                     /note="similarity to COG1696 Predicted membrane protein
                     involved in D-alanine export(Evalue: 7E-99)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516455.1"
                     /db_xref="GI:89892968"
                     /db_xref="GeneID:3954078"
                     /translation="MIPYSNLFFFYIIGLILLPGICLGVMEKPLKLYGLAASLLIIGL
                     LFSDSKLQLFLLVLFYLGELFLVKGYSLLRPKYPQRWILWLTILLALIPLALSKWGHL
                     FTDRLLGFLGISYLTFKVIQMLLEISDGLIKEVKLVDFTYFLLFFPTLSSGPIDRSRR
                     FLSEVNQSIPRHEYLHRVYQGLRKLLLGAGYKFILGNSIYTYWLSKIPTEAHGLAETV
                     NYMYGYSFYLFFDFAGYSLMAIGISYILGVKTPENFDKPFISKDIKDFWNRWHMTLSF
                     WFRDYLYTRFVMASMKKKRFKNRYTASYLGYLLTMGTMGIWHGTEIHYLLYGLYHGGL
                     IVGTDYFQRHSALYKKYKNTPLWIGASTLVTFHLVCFGFLIFSGYLFK"
     misc_feature    246371..247507
                     /locus_tag="DSY0222"
                     /note="D-alanyl-lipoteichoic acid biosynthesis protein
                     DltB; Region: LTA_dltB; TIGR04091"
                     /db_xref="CDD:188606"
     gene            247548..247781
                     /locus_tag="DSY0223"
                     /db_xref="GeneID:3954079"
     CDS             247548..247781
                     /locus_tag="DSY0223"
                     /note="similarity to COG0236 Acyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516456.1"
                     /db_xref="GI:89892969"
                     /db_xref="GeneID:3954079"
                     /translation="MEEKILSLLERVCGTDEVRNERDMNLFEAGILDSLGVIELLVGA
                     EELGIKIEPTEIERTDIDTPAKIIAAFSKRVAG"
     misc_feature    247548..247754
                     /locus_tag="DSY0223"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; cl09936"
                     /db_xref="CDD:263928"
     gene            247778..248977
                     /locus_tag="DSY0224"
                     /db_xref="GeneID:3954080"
     CDS             247778..248977
                     /locus_tag="DSY0224"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516457.1"
                     /db_xref="GI:89892970"
                     /db_xref="GeneID:3954080"
                     /translation="MKRFLPIVLALVISCLVVWGGNEILVSKIADNYDPSFGYKLNIQ
                     KNQGLILQRVGLEKGGSIPVYGSSELSGSTDPFQPVNFFAGQYEGVYYNLIGRGYCQS
                     LIHLINFGALGDSLKGEKIVFFLSPQWFSKTGITSDDFQKNFSQQQYLTFLNNEEISP
                     QLKRLTAQRVDSLLAQDESMDMRILSYLSANDAEQAQISLGALQPYYRLKEALLSTKD
                     HVQGYRTLVEESPLKGKDKSNMKPAIERSTVKIDWEAEKKRAQEVGKARSDNNQFGID
                     NGYFNDYLKEKLPNYKDSMHDQSYLESPEYGDLELLLSLCQELEIEPLFVSIPVNGLW
                     YDYCGFPRQDRAQYYEKVKQLVTKAGYEFADFSDHEYDPYFLRDTMHLGWKGWVEVNE
                     AILAYAR"
     misc_feature    247787..248968
                     /locus_tag="DSY0224"
                     /note="D-alanyl-lipoteichoic acid biosynthesis protein
                     DltD; Region: LTA_DltD; TIGR04092"
                     /db_xref="CDD:234465"
     misc_feature    247898..248026
                     /locus_tag="DSY0224"
                     /note="DltD N-terminal region; Region: DltD_N; pfam04915"
                     /db_xref="CDD:252875"
     misc_feature    248060..248590
                     /locus_tag="DSY0224"
                     /note="DltD central region; Region: DltD_M; pfam04918"
                     /db_xref="CDD:113682"
     misc_feature    248591..248959
                     /locus_tag="DSY0224"
                     /note="DltD C-terminal region; Region: DltD_C; pfam04914"
                     /db_xref="CDD:252874"
     gene            complement(249181..250632)
                     /locus_tag="DSY0225"
                     /db_xref="GeneID:3954081"
     CDS             complement(249181..250632)
                     /locus_tag="DSY0225"
                     /note="similarity to COG0471 Di- and tricarboxylate
                     transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516458.1"
                     /db_xref="GI:89892971"
                     /db_xref="GeneID:3954081"
                     /translation="MYIHSAIGFAIMAIFWLAPAAAPLTPIGMKLVGIFLGMVYLWST
                     VSCLWPSVLGLFLIGLSGFAGQGFAGMKAVVLTGFGNDTVVMMLFIMVLFGAMDEVGC
                     TQYIARWFLTRKIITGRPFAFLAVFYLGCYVLSTLVSPITSLLLLWPVSLKIMKTLGV
                     ERTDKIWPIFFVGMFFISAIGMPFFPFLSAQLVVLSAFDAMTKGTMPVPYLPYMALNF
                     IMSMLLIVTFLGAVKFIFRPDISKLKAIDAERIAEQEKLPPMNIQQKIMMAVLPTFIL
                     MLLAPSFLPKSLAIVKLLGSLGTIGVAMFWIAILCFIRIGGKPIINFKEVAYRQLSWD
                     VFFLVAAAVYAANAISHESTGVNAFVIQLLNPILGDASEMVFVAILFTAAIVLTNFAN
                     NAAMAIILMPIILAFCGQLGLPPIPIAMGVTQLVFLAMLTPAACPHASMMFGRKDIYE
                     VKDIMKYGFPMVTIGLLYFIFIGYPLAKFLFGA"
     misc_feature    complement(249187..250614)
                     /locus_tag="DSY0225"
                     /note="Di- and tricarboxylate transporters [Inorganic ion
                     transport and metabolism]; Region: CitT; COG0471"
                     /db_xref="CDD:223547"
     misc_feature    complement(249232..250410)
                     /locus_tag="DSY0225"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     misc_feature    complement(order(249232..249258,249349..249408,
                     249460..249507,249586..249642,249697..249726,
                     249787..249801,249823..249840,249925..249945,
                     249958..250002,250063..250065,250084..250107,
                     250108..250146,250156..250209,250213..250263,
                     250339..250392))
                     /locus_tag="DSY0225"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            251216..252988
                     /locus_tag="DSY0226"
                     /db_xref="GeneID:3954082"
     CDS             251216..252988
                     /locus_tag="DSY0226"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516459.1"
                     /db_xref="GI:89892972"
                     /db_xref="GeneID:3954082"
                     /translation="MVVKNPYIINPLAAVICFNTDEETTAEITVKGKAIEGDLSHTFA
                     AAKEHVLPVYGLYDDYVNTVVIKLSNGKTSEVKIEVEELNVNKALYCRTTPEYFGKDF
                     MLISTTTPLIESARTVGFDYAGDLRWCITNLQSWDIKKLENGRLLYTSHRTVQKPYYN
                     VGVMEMDFCGKIYKEYRLPGGYHHDAVELENGNILAASDNDFNDSVEDFVVEIERATG
                     AVIKSWDLQKILPRGQGKAGDWNHHDWFHNNAVWYDKPTNSITMSGRHMDAVINFDYD
                     SGALNWILGDPEGWSEEWQKYFFKNVTKGDFDWQYEQHAARILPNGDVFLFDNGTYRS
                     KNEATRVDPEQNFSRGVIYRIDTDKMEIEQVWQYGKERGAEFYSPYICNVDYYGEGHY
                     MVHSGGIATYRGKHTDGLGAMLLNKYKDEHIHLTLESITVEVQNDQLKYELKVQGGNY
                     YRARRVSPYDEKTNLVLGKGELLGGFGVTPEFMKVNFKDAETELSEKHNLNVILEEDR
                     LAIRASFREGSQVFLELKGAEQSKFYNIPTEVHDVTAACVSFEEQNDNDFQFYVSREG
                     LSGEFGIYLNIDSKRYDTHLSVKL"
     misc_feature    251216..252571
                     /locus_tag="DSY0226"
                     /note="Arylsulfotransferase (ASST); Region:
                     Arylsulfotrans; pfam05935"
                     /db_xref="CDD:253465"
     gene            253185..254726
                     /locus_tag="DSY0227"
                     /db_xref="GeneID:3954083"
     CDS             253185..254726
                     /locus_tag="DSY0227"
                     /note="similarity to COG0665 Glycine/D-amino acid oxidases
                     (deaminating)(Evalue: 2E-93)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516460.1"
                     /db_xref="GI:89892973"
                     /db_xref="GeneID:3954083"
                     /translation="MKIDHTKGKYYLDKSQGTPPSFWLDSTPKTNYPSLTGDISVDAV
                     VIGGGMAGISSAYLLTQEGLKVAVLETDRILQGTTAYTTAKLTSQHGLIYDKLLGQMG
                     AEKAKQYAEANESAIEFVAKLVEREAIDCDFTRQPAYIYTQQNKSKEKLEKEMKAAQQ
                     CGIDAHYVTELDLPLAVKGALRFDQQAQFHPRKYLLALAGKIAEKGGHIFEQTKAVDI
                     RGDGPFIVLTQQGSRVKADYVVMACHYPFNILPGLYVSRIYQEREYAVVVKAKEAFPG
                     GMYINAEEPARSLRGLPIPDGERILIVGEKHRTGHGKNLTEHYKNLMEFAQGLFTVEE
                     FPYYWSTQDCTTLDDLPYIGPISRSKPNLLIATGFRKWGMTHGTVAALIIRDRIVRGA
                     SPWQEVYAPSRSISLNFAASFMANSSLLAFDLVAGKLMRGKEIYSLRPGEAVIANMDG
                     RRVGLYMDSEANLHRVDTTCPHLGCEVQWNDAELSWDCPCHGSRYDVDGNPIEGPTLK
                     PLAKY"
     misc_feature    253245..>253922
                     /locus_tag="DSY0227"
                     /note="putative aminophosphonate oxidoreductase; Region:
                     Phn_aa_oxid; TIGR03329"
                     /db_xref="CDD:132372"
     misc_feature    253308..254345
                     /locus_tag="DSY0227"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     misc_feature    254310..254723
                     /locus_tag="DSY0227"
                     /note="Rieske Fe-S protein [Energy production and
                     conversion]; Region: QcrA; COG0723"
                     /db_xref="CDD:223795"
     misc_feature    254481..254723
                     /locus_tag="DSY0227"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    order(254592..254594,254598..254603,254646..254648,
                     254652..254657,254661..254663,254667..254669)
                     /locus_tag="DSY0227"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    order(254592..254594,254598..254603,254646..254648,
                     254655..254657,254661..254663)
                     /locus_tag="DSY0227"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            254825..256522
                     /locus_tag="DSY0228"
                     /db_xref="GeneID:3954084"
     CDS             254825..256522
                     /locus_tag="DSY0228"
                     /note="similarity to COG1283 Na+/phosphate
                     symporter(Evalue: 1E-153)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516461.1"
                     /db_xref="GI:89892974"
                     /db_xref="GeneID:3954084"
                     /translation="MDVQTMLFHFLGGLGLFLYGIKSMSDGLQAVAGDRLRVILEKGT
                     KTPLRGVLTGLIVTGLIQSSSGTTVLTVGLVNAGLLNLRQAIGIIMGANIGTTVTAYL
                     IGIKLEDYALPIIAVGVLILFFIKNKRLTYFGQVLLGFGLLFYGMSIMGDGLGPLKES
                     AYFIGLMSNVDNNPLLGVLIGTVFTCIVQSSSATIGVLQELANQGVVTYQQAVPILFG
                     DNIGTTITALLAGIGASVSARRAAATHFLFNFIGTFIFLPLTILGIFPLMVEQFTNFI
                     AFLIPGGGGWETLAIKMKIAQTHGLFNMTNTLMQLPFVGVLAAIVTKLIPEKDEVVVD
                     ANAQYLDRRFFGNPSVALANASREVMHMGKVAGQAVDNAMNYFFKRQSANRQYVIQME
                     SATDRLENQITEYVLKATSGTNLTKEQSDQRYRVLQVIGDMERVGDHSVNLIELTDYA
                     LENKVKFSEEAQKDLMEMFANVQDIYQASLDALQKNDVELAKKVLEYKKVLEYDDVID
                     EMEAKLRDGHIHRLNEGTCNGSYGAVFLNIISNLERIGDHSVNIAKYAMAEPKHKLT"
     misc_feature    254879..256504
                     /locus_tag="DSY0228"
                     /note="Na+/phosphate symporter [Inorganic ion transport
                     and metabolism]; Region: NptA; COG1283"
                     /db_xref="CDD:224202"
     misc_feature    254879..255283
                     /locus_tag="DSY0228"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     misc_feature    255248..>255598
                     /locus_tag="DSY0228"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     misc_feature    255899..256165
                     /locus_tag="DSY0228"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    256217..256492
                     /locus_tag="DSY0228"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            complement(256838..257398)
                     /locus_tag="DSY0229"
                     /db_xref="GeneID:3954085"
     CDS             complement(256838..257398)
                     /locus_tag="DSY0229"
                     /note="similarity to COG0582 Integrase(Evalue: 5E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516462.1"
                     /db_xref="GI:89892975"
                     /db_xref="GeneID:3954085"
                     /translation="MTVEPIRDKAQIRTLYNHLNQSHPKYAMIFKFGINTGLRISDII
                     TLKVSDIYGSKKQFKDYLVLTEQKTGKLKKIKLNDTLRKALNIYIHKQNLELMDYLFP
                     SQKGGYIGRIQTYRVLKHSALTLGIENFGTHSLRKTWGYWTYKLSQYNIGLVMDIFNH
                     SSQSVTLRYIGINQDQRDQLYDIVQL"
     misc_feature    complement(256841..257392)
                     /locus_tag="DSY0229"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(256892..256894,257000..257008,
                     257195..257197,257279..257284))
                     /locus_tag="DSY0229"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(256892..256894,256919..256921,
                     256991..256993,257000..257002,257195..257197,
                     257282..257284))
                     /locus_tag="DSY0229"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(256892..256894,256919..256921,
                     256991..256993,257000..257002,257282..257284))
                     /locus_tag="DSY0229"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            257623..258468
                     /locus_tag="DSY0230"
                     /db_xref="GeneID:3954086"
     CDS             257623..258468
                     /locus_tag="DSY0230"
                     /note="similarity to COG2206 HD-GYP domain(Evalue: 2E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516463.1"
                     /db_xref="GI:89892976"
                     /db_xref="GeneID:3954086"
                     /translation="MKSNGGESADMKRIVCPKDYYNEQGLLLSAKGTKITLSQFLRLQ
                     RKYDFLSETEANERTLASYEKIKQKICREDERYKRADDQLLDQASALLVNIVFESKRK
                     PWYMYLTALGNHINWLYTHSIDVALLSLMMAIESGVSQRSLWDLGVGGILHDVGKLLI
                     PKKIIQKRTELSDIEKDILRQHCELGVECTTDCAFPILSQDIIAQHHERLDGSGYPNQ
                     LQEGQINEYVKIVMIADAFDTITAGRPYRKTVEVEEALAYLEDQEGAFSRMYLETLKN
                     ILVRP"
     misc_feature    257974..258366
                     /locus_tag="DSY0230"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(257983..257985,258079..258084,258325..258327)
                     /locus_tag="DSY0230"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    258082..258084
                     /locus_tag="DSY0230"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            258782..259099
                     /locus_tag="DSY0231"
                     /db_xref="GeneID:3954087"
     CDS             258782..259099
                     /locus_tag="DSY0231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516464.1"
                     /db_xref="GI:89892977"
                     /db_xref="GeneID:3954087"
                     /translation="MLNRLFRELRIEFYWVKKELTRRWHLDTPIGIVGVIVLLSGLGL
                     FLLIGQGIAKIFRAAIPWVTGNSVSTVYWSSIGLALKVSFVFLVFATSLLLLFWLKTH
                     YRR"
     gene            259288..260523
                     /locus_tag="DSY0232"
                     /db_xref="GeneID:3954088"
     CDS             259288..260523
                     /locus_tag="DSY0232"
                     /note="similarity to COG1215 Glycosyltransferases,
                     probably involved in cell wall biogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516465.1"
                     /db_xref="GI:89892978"
                     /db_xref="GeneID:3954088"
                     /translation="MIMIPVQLIIIFMTFYYFVLSMFGLFRRPDKKVLEPEKSFALVV
                     AAHNEEAVIGPLVDNLLNLDYPKELYDVFVVADNCTDKTALIAKNAGALVHQRFNNEK
                     RGKGYALEWMFHRLFKLERHYDAVIIFDADNLVNETFLVEMNSKLCQGHQIVQCYLDS
                     KNPYDTWVTNTFSITFWLSNRLLQLARYNTGFLNNVLGGTGMCISTKVLKDLGWGATS
                     LTEDLEFTMKALISGIKTTWAHDAIVYDEKPLTFIQAWNQRKRWAQGQVDVAGRYFFP
                     LIYKAFKERKLMYFDAAVHLFQPALVMIATFFMFVNLISGLQSSYTQVFNVVMPWSGW
                     QILSAFSLVFPVAALALERLPWRAYAGLILYPVFIYSWIPIVFLGFVNRKDKSWSHTK
                     HTRSIKYDDVVKEKKVSSS"
     misc_feature    259288..260487
                     /locus_tag="DSY0232"
                     /note="Glycosyltransferases, probably involved in cell
                     wall biogenesis [Cell envelope biogenesis, outer
                     membrane]; Region: COG1215"
                     /db_xref="CDD:224136"
     misc_feature    259414..259962
                     /locus_tag="DSY0232"
                     /note="EpsO protein participates in the methanolan
                     synthesis; Region: EpsO_like; cd06438"
                     /db_xref="CDD:133060"
     misc_feature    259675..259683
                     /locus_tag="DSY0232"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133060"
     gene            260717..261592
                     /locus_tag="DSY0233"
                     /db_xref="GeneID:3954089"
     CDS             260717..261592
                     /locus_tag="DSY0233"
                     /note="similarity to COG0010
                     Arginase/agmatinase/formimionoglutamate hydrolase,
                     arginase family(Evalue: 6E-94)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516466.1"
                     /db_xref="GI:89892979"
                     /db_xref="GeneID:3954089"
                     /translation="MSKETLMKMTESPGVFMGGETPYEEADAVILGIPMDYTVSFRPG
                     TRLGPLSIRNVSIGIEEYSVYLDKDLSDYAYCDCGDLSLPFGNVEKSLQVIEAAARQV
                     VEDGKFPIFLGGEHLVTYPLLKPFIEKYPELRVVHFDAHADLRTDYSGEPNSHATVMR
                     KISEALGPHRVYQFGIRSGTREEFLFAKEHNHLVVEEVLEPLKAVLPELKGKPVYVTL
                     DIDVVDPAFAPGTGTQEAGGCTSREIIKAVHALSELDVVGFDLVEVSPLMDTSERTAL
                     LAAKIVREAILSFVK"
     misc_feature    260798..261574
                     /locus_tag="DSY0233"
                     /note="Agmatinase and related proteins; Region:
                     Agmatinase-like_2; cd11593"
                     /db_xref="CDD:212539"
     misc_feature    order(261062..261064,261131..261133,261137..261145,
                     261179..261184,261371..261373,261377..261379,
                     261503..261505)
                     /locus_tag="DSY0233"
                     /note="putative active site [active]"
                     /db_xref="CDD:212539"
     misc_feature    order(261062..261064,261131..261133,261137..261139,
                     261143..261145,261371..261373,261377..261379)
                     /locus_tag="DSY0233"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:212539"
     gene            261673..261748
                     /locus_tag="DSY_tRNA6-Val"
                     /db_xref="GeneID:3958070"
     tRNA            261673..261748
                     /locus_tag="DSY_tRNA6-Val"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3958070"
     gene            261755..261830
                     /locus_tag="DSY_tRNA7-Asp"
                     /db_xref="GeneID:3958071"
     tRNA            261755..261830
                     /locus_tag="DSY_tRNA7-Asp"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:3958071"
     gene            261838..261913
                     /locus_tag="DSY_tRNA8-Phe"
                     /db_xref="GeneID:3958072"
     tRNA            261838..261913
                     /locus_tag="DSY_tRNA8-Phe"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:3958072"
     gene            261915..261989
                     /locus_tag="DSY_tRNA9-Gly"
                     /db_xref="GeneID:3958073"
     tRNA            261915..261989
                     /locus_tag="DSY_tRNA9-Gly"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3958073"
     gene            261997..262070
                     /locus_tag="DSY_tRNA10-Cys"
                     /db_xref="GeneID:3958016"
     tRNA            261997..262070
                     /locus_tag="DSY_tRNA10-Cys"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:3958016"
     gene            262088..262176
                     /locus_tag="DSY_tRNA11-Leu"
                     /db_xref="GeneID:3958017"
     tRNA            262088..262176
                     /locus_tag="DSY_tRNA11-Leu"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3958017"
     gene            262182..262258
                     /locus_tag="DSY_tRNA12-Val"
                     /db_xref="GeneID:3958018"
     tRNA            262182..262258
                     /locus_tag="DSY_tRNA12-Val"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3958018"
     gene            262408..263256
                     /locus_tag="DSY0234"
                     /db_xref="GeneID:3954090"
     CDS             262408..263256
                     /locus_tag="DSY0234"
                     /note="similarity to COG0338 Site-specific DNA
                     methylase(Evalue: 2E-63)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516467.1"
                     /db_xref="GI:89892980"
                     /db_xref="GeneID:3954090"
                     /translation="MRTMMHKDRLVAPVVKWVGGKRQLLEDLTPLFPKRVMSYCEPFC
                     GGGAVLFKLQPDTAWVNDINSELIRMYEVIRDDVEELIRALGEHPNEEEHYYRVRDWD
                     RDKEKYGNLSKVQKAARVIYLNKTCYNGLFRVNNAGEFNTPFGHYKTPNIVNEHTLRA
                     VSAYFQRAQITFSSTDYAEVLAGVAKGTFVYLDPPYDPVSSTANFTGYAKGGFDRAEQ
                     IRLRECCDELDRRGIKFMLSNSATEFIKEQYGAYQITIVKAKRAINSNAAKRGQIDEV
                     VVRNYK"
     misc_feature    262438..263247
                     /locus_tag="DSY0234"
                     /note="DNA adenine methylase (dam); Region: dam;
                     TIGR00571"
                     /db_xref="CDD:233028"
     gene            263294..264550
                     /locus_tag="DSY0235"
                     /db_xref="GeneID:3954091"
     CDS             263294..264550
                     /locus_tag="DSY0235"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516468.1"
                     /db_xref="GI:89892981"
                     /db_xref="REBASE:DhaYORF234P"
                     /db_xref="GeneID:3954091"
                     /translation="MFKKYDILSRIEAEGKFTISASQIKEYREPRLMAKFDHNINLPR
                     IFARNRLAILPISRGDYIISHFEAYQPFSSVDTSVTRVSLPPNLQSLSASHIPSEAIA
                     VNCALASGMLADFLEEKTLYATVSGRMGSGQFDFTIRNLRTQCPTEVAVSNSQIEIDA
                     ALEGVHSLSLLEAKRDLAEDFLVRQLYYPFRVWSGRVTKQVRPIFLVYSNGIFSLYEY
                     EFQDPNAYNSLVLVKHKNYSIEDTAIGAADLHDVAERTQLLQEPEIPFPQANSFERVI
                     NICELLSTQELSREQVTEEYAFDIRQTNYYTDAARYLGLVEKRYEEGRKPVYSLSSRG
                     KRIMQLSYQQRQLAFCEAILQHRVFRETFKLYMENGSLPDQNTIVSIMQQSDLYQIGS
                     MSTFVRRSTTVSGWLNWMLGLIGEEH"
     gene            264751..266202
                     /locus_tag="DSY0236"
                     /db_xref="GeneID:3954092"
     CDS             264751..266202
                     /locus_tag="DSY0236"
                     /note="similarity to COG1982 Arginine/lysine/ornithine
                     decarboxylases(Evalue: 1E-121)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516469.1"
                     /db_xref="GI:89892982"
                     /db_xref="GeneID:3954092"
                     /translation="MPSLRQSKAPVYEALLKYKSMRVVPFDVPGHKQGRGNPELTEFL
                     GEKCLSVDVNSMKPLDNLGHPVSVIKEGEELAAEAFGAHHAFFMVNGTTSAVQAMVMS
                     ACKLGEKIIMPRNVHRSAINALIISGAIPVYVNPGVNKELGIPLGMSVADVRKAIKEN
                     PDAKAILVNNPTYYGICSDLKTITELAHEHSMLVLVDEAHGTHFYFGENMPISAMAAG
                     ADMAAVSMHKTGGSLTQSSFLLIGKRLNVGRVRHMINLTQTTSASYLLLSSLDISRRN
                     LALNGQRIFDKALYLANYGRDEVNKLGGYYAFGKELNNGDSVYDFDCTKLSIHTRDIG
                     LAGIEVYDILRDDYGIQIEFGDIGNILAIISVGDRALALERLVSALAEIKRRYQRDKA
                     GMFDHEYINPVVVMGPQQAFYAQQRSLPIQESKGKVSGEFVMAYPPGIPILAPGEKIT
                     EDIIDYIAYSKAKGCFLTGTEDMDIENIKVVEE"
     misc_feature    264751..266196
                     /locus_tag="DSY0236"
                     /note="Arginine/lysine/ornithine decarboxylases [Amino
                     acid transport and metabolism]; Region: LdcC; COG1982"
                     /db_xref="CDD:224893"
     misc_feature    264778..265653
                     /locus_tag="DSY0236"
                     /note="Ornithine decarboxylase family. This family belongs
                     to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). The major groups in
                     this CD corresponds to ornithine decarboxylase (ODC),
                     arginine decarboxylase (ADC) and lysine...; Region:
                     Orn_deC_like; cd00615"
                     /db_xref="CDD:99739"
     misc_feature    order(264904..264906,264916..264918,264940..264942,
                     265015..265023,265027..265032,265039..265041,
                     265051..265059,265063..265068,265099..265104,
                     265429..265434,265441..265455,265504..265509,
                     265513..265521,265525..265527,265546..265548,
                     265555..265557,265564..265566,265600..265605)
                     /locus_tag="DSY0236"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99739"
     misc_feature    order(265021..265029,265099..265101,265105..265107,
                     265255..265257,265339..265341,265345..265350,
                     265423..265425,265429..265434)
                     /locus_tag="DSY0236"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99739"
     misc_feature    265432..265434
                     /locus_tag="DSY0236"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99739"
     misc_feature    <265930..>266121
                     /locus_tag="DSY0236"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            266205..267059
                     /locus_tag="DSY0237"
                     /db_xref="GeneID:3954093"
     CDS             266205..267059
                     /locus_tag="DSY0237"
                     /EC_number="2.5.1.16"
                     /note="catalyzes the formation of spermidine from
                     putrescine and S-adenosylmethioninamine"
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="YP_516470.1"
                     /db_xref="GI:89892983"
                     /db_xref="GeneID:3954093"
                     /translation="MELWYTEEHTENVRFSIKVDRQLYSGQSEFQRIDVFESKEFGTF
                     FTLDGLMMVTQKDEFIYHDMIVHVPMATNPQIKDVLVIGAGDGGTVRELTRYDSIVNI
                     DMVEIDKLVVDVCKEYLPQTACKLEDPRVRLFFEDGLRFIRTKENSYDLIIVDSTDPF
                     GPGEGLFTKEFYGNCYKALKDDGILVNQHESPYYETYAQNMGRAHQRIKEFFPVCRVY
                     QAHIPTYPSGHWLFGFASKKYDPLIDIDEQAWNDLGIKTQYYNTEIHKGCFALPNYVK
                     EQLADAVE"
     misc_feature    266436..266762
                     /locus_tag="DSY0237"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(266448..266468,266520..266525,266610..266618,
                     266667..266669)
                     /locus_tag="DSY0237"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            267289..267723
                     /locus_tag="DSY0238"
                     /db_xref="GeneID:3954094"
     CDS             267289..267723
                     /locus_tag="DSY0238"
                     /note="similarity to COG2703 Hemerythrin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516471.1"
                     /db_xref="GI:89892984"
                     /db_xref="GeneID:3954094"
                     /translation="MIVMLKWKDEYSIGVEEIDEQHKHLFEIGNEIYDLLENYLLPDK
                     YDKIIQIIAELKEYTVHHFQTEEELMLKIKYPGYFKQKVAHDDFIKEVESVDFSAIDQ
                     DQDGHTRKLLEFIFGWVLDHILKSDAILALRVLCRYTLVKGK"
     misc_feature    267334..267681
                     /locus_tag="DSY0238"
                     /note="Hemerythrin; Region: Hemerythrin; cd12107"
                     /db_xref="CDD:213982"
     misc_feature    order(267352..267354,267472..267474,267484..267486,
                     267529..267531,267541..267543,267652..267654,
                     267667..267669)
                     /locus_tag="DSY0238"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:213982"
     gene            267963..268838
                     /locus_tag="DSY0239"
                     /db_xref="GeneID:3954095"
     CDS             267963..268838
                     /locus_tag="DSY0239"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516472.1"
                     /db_xref="GI:89892985"
                     /db_xref="GeneID:3954095"
                     /translation="MEQHSVQVGTQYYRESIYERLRQLQEQEKLPVVLHEYQQGKHWL
                     IDCEFQLEAIEEDRETTKKIHSYYLANAIAETILQHWEKDHIRWLLKSKYKLKREEVV
                     QVFEKSLQYLNQESRQWKNYRIHRKASLVNQIVKCIEAQPFFDMEGFLRFRAKDYKEE
                     IYRAVNYVVNEHVIEAEYEEFINLLKRFVDSQKPRIHTLHVGITKHGKFNLYNEEGKK
                     ITKKYMDELSFMDTSQELTYEDLLVSALIAVAPRKIVLHIRYEGYQDTLQTICKVFEG
                     RVSYCTESCPICEKI"
     misc_feature    268161..268802
                     /locus_tag="DSY0239"
                     /note="YtxC-like family; Region: YtxC; pfam08812"
                     /db_xref="CDD:255052"
     gene            269169..271094
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /db_xref="GeneID:3954096"
     CDS             269169..271094
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /EC_number="6.1.1.3"
                     /note="catalyzes a two-step reaction, first charging a
                     threonine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; catalyzes the formation
                     of threonyl-tRNA(Thr) from threonine and tRNA(Thr)"
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="YP_516473.1"
                     /db_xref="GI:89892986"
                     /db_xref="GeneID:3954096"
                     /translation="MTMMVKITLKDGSIREIESGKSLMELAASISRGLAKAALAGKVN
                     GEVKDLSYALTQDAEVEIITADSEEGLKILRHSTSHLMAEAVRNLFPGTILGIGPAID
                     NGFYYDFDSEHVFTPEDLEKIEAEMRRLVKENKRYERKEISRSDALQYFSAEGEKYKV
                     ELIEDLPEDEVISMYTQGGFTDLCAGPHIPSTGVVKAFKLMNLAGAYWRGSEKNKMLQ
                     RIYGTVWAKKEDLDDYLFKLEEAKRRDHRKLGVELDLFSLHDEGPGFPFFHPKGMVLR
                     NQLEDFWRQEHRKRGYHEIKTPIILSRNLWENSGHWDHYKDNMYTTKIDDEDFAVKPM
                     NCPGGMIMYKQKLRSYRDLPLRMGELGLVHRHELSGALNGLLRVRNFTQDDAHIFMLP
                     SQIKAEISGVIDLVDRFYKVFGFEYHVELSTRPENSMGADETWEMATNALQEALEAKG
                     VNYKINPGDGAFYGPKIDFHLRDCLGRTWQCGTIQLDFQMPEKFDLTYIGEDGQKHRP
                     VMIHRVVYGSIERFIALLTEHYAGAFPTWLAPVQVRVLPISERHEDYAQDIVRRLNDL
                     DIRAEVDERREKISYKIREAQTHKIPFALVVGDQEAETDTVAVRRYGQANAGEKLSVA
                     EFIALIQEEICSKKQLV"
     misc_feature    269178..271085
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
                     PRK00413"
                     /db_xref="CDD:234752"
     misc_feature    269181..269363
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is
                     a class II tRNA synthetase that couples threonine to its
                     cognate tRNA.  In addition to its catalytic and
                     anticodon-binding domains, ThrRS has an N-terminal TGS
                     domain, named after the ThrRS, GTPase, and...; Region:
                     TGS_ThrRS_N; cd01667"
                     /db_xref="CDD:133437"
     misc_feature    269682..269828
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; smart00863"
                     /db_xref="CDD:197931"
     misc_feature    269901..270788
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="Threonyl-tRNA synthetase (ThrRS) class II core
                     catalytic domain. ThrRS is a homodimer. It is responsible
                     for the attachment of threonine to the 3' OH group of
                     ribose of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ThrRS_core;
                     cd00771"
                     /db_xref="CDD:238394"
     misc_feature    order(269910..269912,269949..269951,270099..270101,
                     270111..270113,270120..270125,270165..270167,
                     270261..270263,270267..270269,270273..270281,
                     270294..270302,270309..270311,270315..270317,
                     270597..270599,270606..270611,270621..270623,
                     270717..270722,270729..270731)
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="active site"
                     /db_xref="CDD:238394"
     misc_feature    order(269922..269924,269940..269942,269946..269951,
                     269955..269957,269961..269963,269967..269972,
                     269976..269978,269985..269987,270030..270035,
                     270045..270050,270054..270056,270060..270068,
                     270072..270074,270126..270134,270138..270149,
                     270153..270155,270189..270194,270201..270209,
                     270213..270221,270258..270260,270264..270266,
                     270273..270275,270303..270308,270387..270389,
                     270510..270518,270663..270665,270669..270671)
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238394"
     misc_feature    270045..270068
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="motif 1; other site"
                     /db_xref="CDD:238394"
     misc_feature    270258..270269
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="motif 2; other site"
                     /db_xref="CDD:238394"
     misc_feature    270717..270731
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="motif 3; other site"
                     /db_xref="CDD:238394"
     misc_feature    270786..271061
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="ThrRS Threonyl-anticodon binding domain. ThrRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     ThrRS_anticodon; cd00860"
                     /db_xref="CDD:238437"
     misc_feature    order(270810..270815,270918..270920,270936..270938,
                     270960..270962,270990..270992,270996..270998)
                     /gene="thrS"
                     /locus_tag="DSY0240"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238437"
     gene            271521..272384
                     /locus_tag="DSY0241"
                     /db_xref="GeneID:3953224"
     CDS             271521..272384
                     /locus_tag="DSY0241"
                     /note="similarity to COG2510 Predicted membrane
                     protein(Evalue: 2E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516474.1"
                     /db_xref="GI:89892987"
                     /db_xref="GeneID:3953224"
                     /translation="MWIVYAFGSAFFAGITAILAKCGIKKTDSNMATAIRTIVVLAFS
                     WLMVLMVESHTTIGDISGKTLLFLILSGLATGASWLCYFKALQMGDINKVVPIDKSST
                     VLTIILAFILLNEGISIGKGVGVVGIGIGTYLMIQKKATEAAQPKANQAWLIYALLSA
                     VFASLTAILGKIGIEGVESNLGTAIRTGVVLVMAWLVVFVTRKKGISREIPLKELGFI
                     ILSGLATGGSWLCYYKALQDGPASVVVPIDKLSILVTIAFSYVVFHEKLAKKAALGLV
                     LIVSGTLAMLI"
     misc_feature    271521..272381
                     /locus_tag="DSY0241"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    271524..271874
                     /locus_tag="DSY0241"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2510"
                     /db_xref="CDD:225308"
     misc_feature    271968..272369
                     /locus_tag="DSY0241"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2510"
                     /db_xref="CDD:225308"
     gene            complement(272432..273421)
                     /locus_tag="DSY0242"
                     /db_xref="GeneID:3953225"
     CDS             complement(272432..273421)
                     /locus_tag="DSY0242"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516475.1"
                     /db_xref="GI:89892988"
                     /db_xref="GeneID:3953225"
                     /translation="MNKIRIGIVGYGNLGKSVELGIRQNEDMELVGVFTRRDPSSIKT
                     VTPGVNVFTMDESKQMTEQIDVMVLCGGSMSDMPVQGPEFASLFNTVDGYDTHARIPE
                     YFAAMDKNALESQKVCIIASGWDPGMFSINRLYAEAILPAGDTYTFWGKGISQGHSDA
                     LRRIKGVKDAKQYTIPKDQAINAVRRGEMPELSTREKHWRECFVVLEEGADKERIKQE
                     IKTMPNYFADYDTEVHFITEEELIKDHPGLPHGGLVIHHGRTGLDEKHHHVIEYRLAL
                     DSNPDFTANVLVAFARAAYRLNREGVSGAKTVVDIAPAYLSSKSAEELRRSLI"
     misc_feature    complement(272435..273421)
                     /locus_tag="DSY0242"
                     /note="diaminopimelate dehydrogenase; Region: DAP-DH;
                     TIGR01921"
                     /db_xref="CDD:233638"
     misc_feature    complement(<273218..273412)
                     /locus_tag="DSY0242"
                     /note="Dihydrodipicolinate reductase, N-terminus; Region:
                     DapB_N; pfam01113"
                     /db_xref="CDD:250369"
     gene            273723..275459
                     /locus_tag="DSY0243"
                     /db_xref="GeneID:3953226"
     CDS             273723..275459
                     /locus_tag="DSY0243"
                     /note="catalyzes the formation of acetyl phosphate and
                     sulfite from 2-sulfoacetaldehyde; is active when grown on
                     taurine as a sole carbon source"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfoacetaldehyde acetyltransferase"
                     /protein_id="YP_516476.1"
                     /db_xref="GI:89892989"
                     /db_xref="GeneID:3953226"
                     /translation="MPKITMTPSEAICETLVAEGIDHVTGIVGSAFMDLLDLFPTAGI
                     RFIPVRHEQSAGHMEDAFCRVTGRAGVIIGQNGPGITNMVTSVAAANSAHTPMVVICP
                     SAGTPTVGWDGFQEADTVKIFEAITKETIRVPHPSRAADCLRTAFRIAYAERGPVLYD
                     IPRDYFYGEISEQILEPHQYRVDQRGCGDLASLDKAAELLISAQRPVIISGRGVVDTQ
                     SKDIVAKIAEILTAPVACTYLHNDAFPYDHPLWVGPIGYMGSKAAMNLVAEADVILAI
                     GTRLSVFGTTPQYDIDYFPESAKIIQVDINPRNIARTHPVEVGLIADAREAAREILKR
                     LEERIAEPKVSQSRLTQIKAQQNAWEEEIVQSAMVDGYPINPRRALYEIQKALPENAI
                     VATDIGNVSSTANSYLKFKGAGKHIAALTFGNTGFAYPAALGAQLAEPDSPVVAIIGD
                     GAWGMSLHEVSTAVEHNLPVVAIVFRNGAWCAEKKNQIDFYNNRFVGVDIPTPESFAP
                     VAIAMGAEGIRVSKAEEVGPALKRALDSRKPTVLEIVCDGTQLAPPFRKDALKLPTRL
                     LPKYKSLDVRNW"
     misc_feature    273723..275444
                     /locus_tag="DSY0243"
                     /note="sulfoacetaldehyde acetyltransferase; Validated;
                     Region: PRK07525"
                     /db_xref="CDD:236042"
     misc_feature    273750..274211
                     /locus_tag="DSY0243"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(273789..273791,273804..273809,273819..273821,
                     273831..273833,273855..273875,273882..273884,
                     273891..273896,273903..273908,273912..273920,
                     273954..273956,273975..273977,273987..273989,
                     273996..274001)
                     /locus_tag="DSY0243"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(273804..273812,273819..273821,273831..273833,
                     273858..273860,273864..273875,273879..273881,
                     273954..273956,273963..273968,273972..273977,
                     273984..273986,274086..274088,274095..274097)
                     /locus_tag="DSY0243"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(273804..273806,273876..273878,273954..273956,
                     273966..273968)
                     /locus_tag="DSY0243"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    274299..274715
                     /locus_tag="DSY0243"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    274833..275417
                     /locus_tag="DSY0243"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(274995..274997,275067..275078,275151..275153,
                     275157..275159)
                     /locus_tag="DSY0243"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            275641..277092
                     /locus_tag="DSY0244"
                     /db_xref="GeneID:3953227"
     CDS             275641..277092
                     /locus_tag="DSY0244"
                     /note="similarity to COG1012 NAD-dependent aldehyde
                     dehydrogenases(Evalue: 2E-58)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516477.1"
                     /db_xref="GI:89892990"
                     /db_xref="GeneID:3953227"
                     /translation="MGASTSANKNTSGETDAKIIVEELILKARKAMAEIQNYSQDQAN
                     TLVQAVAWAIYRQDHAEELARISVQDTGLGNVKDKITKNKRKTFGTLRDLLAPEAKSV
                     GIIKVDEAIGITEIAKPVGVIAAAVPSTNPGATPANVTMMGLKGRNAVIIAPSPKGAS
                     TTVKLLEYIHAELAKVGAPLDLVQSLPMPVSKELTTELMKQADMVTVTGSANNVRAGQ
                     TCGTPNACVSAGNVVTIVDASANLQDAAHKIMLSKTFDNATSCSSDNALVIEAAIYEQ
                     MIEALKKEGGYKCTVAEKEQMQKAMWDENGKRRGKTTAKDAGVMAQEAGLTNPAAQKA
                     SFFMVEETGVGKGYPFSGEKIALVLTLYKAGDFDEALELTKRILNHAGRGHSCGLHTT
                     NEEHIQRIGLEMEVCRLLINQIQCFGNGGSFNNGLNFTLSMGGGTWAGNNIKDNLSYQ
                     HFIQTTKVSRLIPEVIPEEEELFGSYWAKYGRS"
     misc_feature    275701..277020
                     /locus_tag="DSY0244"
                     /note="Coenzyme A acylating aldehyde dehydrogenase (ACDH),
                     ALDH family 20-like; Region: ALDH_F20_ACDH; cd07122"
                     /db_xref="CDD:143440"
     misc_feature    276421..276423
                     /locus_tag="DSY0244"
                     /note="putative catalytic cysteine [active]"
                     /db_xref="CDD:143440"
     gene            277107..278225
                     /locus_tag="DSY0245"
                     /db_xref="GeneID:3953228"
     CDS             277107..278225
                     /locus_tag="DSY0245"
                     /note="similarity to COG0045 Succinyl-CoA synthetase beta
                     subunit(Evalue: 1E-67)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516478.1"
                     /db_xref="GI:89892991"
                     /db_xref="GeneID:3953228"
                     /translation="MKLFEYQAKELFAESGIPIPQNALIGDISELNSALEKLGLPCVL
                     KAQVLQGGRGKAGLVKFVRTKEEAQKEAERILEATGKKLLVEEAVPYEREMYVSITVD
                     AASGLAMVMACLEGGVDIEQIARTTPEKIIKEKVDMSLGLMAYQADNIMYGLGLEQSA
                     AKEGSKILLKLYQLFVKYNAELVEINPLMILRDGTMAAADGKFNLDDNALYKQNRFSL
                     TRDHYKSDFEYEAALDGIPYIAFEGDIGMMVAGAGLANVVLDLIHYYGGTVANYLEFG
                     GPNYHKAQQCMKMMLKAKPKCILIATFGTIARADVMAQGIVEAVKELKPEIPIVAVIR
                     GTGEEDAQKLLRSAGLPSLSDTEEAVRKAVEIVGGAEN"
     misc_feature    277107..278216
                     /locus_tag="DSY0245"
                     /note="succinyl-CoA synthetase subunit beta; Provisional;
                     Region: sucC; PRK00696"
                     /db_xref="CDD:234813"
     misc_feature    277110..277676
                     /locus_tag="DSY0245"
                     /note="ATP-grasp domain; Region: ATP-grasp_2; pfam08442"
                     /db_xref="CDD:254804"
     misc_feature    277848..278195
                     /locus_tag="DSY0245"
                     /note="CoA-ligase; Region: Ligase_CoA; pfam00549"
                     /db_xref="CDD:249950"
     gene            278534..279100
                     /locus_tag="DSY0246"
                     /db_xref="GeneID:3953229"
     CDS             278534..279100
                     /locus_tag="DSY0246"
                     /note="similarity to COG0074 Succinyl-CoA synthetase alpha
                     subunit(Evalue: 3E-45)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516479.1"
                     /db_xref="GI:89892992"
                     /db_xref="GeneID:3953229"
                     /translation="MMQLRKIALEKQAMVIGGNTTGIISTGKAMMGFFPYWLDRVYKP
                     GRVGVMTRSGSLTNEVTAEIVKAGFGPSSIVGVGGDPVPLTRFAEILPLFEKDPDTDA
                     VVMIGEIGGTMEEDVAEAIEQRIFTKPLIGFMGGRTAPKGQKMGHAGAIITAGKGTVE
                     DKVEALAKAGALVADRPSMIGQLLQKVL"
     misc_feature    278681..279049
                     /locus_tag="DSY0246"
                     /note="CoA-ligase; Region: Ligase_CoA; pfam00549"
                     /db_xref="CDD:249950"
     gene            279253..280749
                     /locus_tag="DSY0247"
                     /db_xref="GeneID:3953230"
     CDS             279253..280749
                     /locus_tag="DSY0247"
                     /note="similarity to COG0471 Di- and tricarboxylate
                     transporters(Evalue: 4E-57)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516480.1"
                     /db_xref="GI:89892993"
                     /db_xref="GeneID:3953230"
                     /translation="MSINSPVVPSRPYVFNKRNALIFFAAIAVMLIIYLLPSPPSFYK
                     GTEEIPLTFEGKAVFAVLVYAVILWLTEAIPFPITALSMIIILHLMGVSTFTALVKTG
                     LGSSVLFFLMGAMGLSAAITVSGLANRIMLGVLSKVGTRTDRIVFTFMALGTFLSMWV
                     TDMAVAAMLLPLGVNILRQSGCKPLQSNFGRCLMIGIVYGALIGGTSTPAGCGANILA
                     ISYLRELTEADASFLQWMIVGVPGALMMLPAGWFLLMKVFPPEIRNVPIELDDVRRQN
                     KELGPLTRQERNTTIVFFTAVTMWLGAPLIKSLTGISIPEDFTALFAFLLLFLPGLQV
                     FGSWKEANEHIDWSGLMLIAGGIAAGMLLAETGTARYIAWGALNGIGALHPMLRVAAV
                     LVLVEALKIFFSSNSVTGAVVIPLVIALALDLGMNPWIVAGPAGIATSMAFIMVTSSP
                     TNVIPYSSGYFSIKDFAKCGVLMTVIGIVAVTLSVAIFGRFAGMNIWL"
     misc_feature    279361..280716
                     /locus_tag="DSY0247"
                     /note="anion transporter; Region: dass; TIGR00785"
                     /db_xref="CDD:233126"
     misc_feature    279427..280719
                     /locus_tag="DSY0247"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     misc_feature    order(279448..279459,279478..279519,279565..279618,
                     279688..279738,279742..279795,279823..279894,
                     279958..279975,279988..280014,280027..280029,
                     280120..280155,280186..280230,280285..280341,
                     280414..280461,280516..280575,280663..280701)
                     /locus_tag="DSY0247"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            280950..281666
                     /locus_tag="DSY0248"
                     /db_xref="GeneID:3953231"
     CDS             280950..281666
                     /locus_tag="DSY0248"
                     /note="similarity to COG2188 Transcriptional
                     regulators(Evalue: 4E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516481.1"
                     /db_xref="GI:89892994"
                     /db_xref="GeneID:3953231"
                     /translation="MVLDPHNPLPLHAQITNILRKRIFEENLTGKIPSERELMDYFAV
                     SRSTVREAIEALVRDGILEKKHGKGTFVAVRPIKEEWIGTFSSYTETIERAGMRSGAK
                     LLSCNIKREPAYIAEMFGGEEFYMIKRLRYANDQVIAIERKCFDLETGRRLLDYDLNA
                     NIYKIMESSLGIVLWEADEIVTSAIPSKEDALLLEVPKRSSVLVTERSSFDSDHKLIE
                     FVQTMFRADKYSFRIKMSRN"
     misc_feature    280971..281648
                     /locus_tag="DSY0248"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    280977..281168
                     /locus_tag="DSY0248"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(280977..280979,280983..280985,281046..281048,
                     281052..281057,281079..281093,281097..281102,
                     281109..281111,281139..281144,281148..281159)
                     /locus_tag="DSY0248"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    281229..281639
                     /locus_tag="DSY0248"
                     /note="The UbiC transcription regulator-associated (UTRA)
                     domain is a conserved ligand-binding domain; Region: UTRA;
                     smart00866"
                     /db_xref="CDD:214869"
     gene            281833..282489
                     /locus_tag="DSY0249"
                     /db_xref="GeneID:3953232"
     CDS             281833..282489
                     /locus_tag="DSY0249"
                     /note="similarity to COG1410 Methionine synthase I,
                     cobalamin-binding domain(Evalue: 1E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516482.1"
                     /db_xref="GI:89892995"
                     /db_xref="GeneID:3953232"
                     /translation="MHNVADLVENVIQGNAKESVSIARDLLAKGYRINQLVEGLTTAL
                     DSLDAKCNMNQFNLLEILLAARAMKEVVDEVVCPEMEKLPAEFGPLQLKGVFVMGTIQ
                     GDIHDLGKNIVTTLLRTVGYKVIDLGKDVSPAQFVMAAKAEKADFIGVSSLIFSSAAV
                     IREIKRLLREEKMSDIMVIAGGAAVKQLGKEDLDVDMIAKDAFELIRFLQAHEGNVAE
                     "
     misc_feature    281851..282465
                     /locus_tag="DSY0249"
                     /note="B12 binding domain (B12-BD). Most of the members
                     bind different cobalamid derivates, like B12
                     (adenosylcobamide) or methylcobalamin or methyl-Co(III)
                     5-hydroxybenzimidazolylcobamide. This domain is found in
                     several enzymes, such as glutamate mutase; Region:
                     B12-binding_like; cl00293"
                     /db_xref="CDD:260332"
     misc_feature    281851..282444
                     /locus_tag="DSY0249"
                     /note="methyltransferase cognate corrinoid proteins,
                     Methanosarcina family; Region: pyl_corrinoid; TIGR02370"
                     /db_xref="CDD:131423"
     misc_feature    order(282277..282285,282289..282297,282379..282381,
                     282427..282429,282436..282438,282445..282447)
                     /locus_tag="DSY0249"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239016"
     gene            282621..283490
                     /locus_tag="DSY0250"
                     /db_xref="GeneID:3953233"
     CDS             282621..283490
                     /locus_tag="DSY0250"
                     /note="similarity to COG0407 Uroporphyrinogen-III
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516483.1"
                     /db_xref="GI:89892996"
                     /db_xref="GeneID:3953233"
                     /translation="MAQCQLDSQQKFDYDAVFVYGDNCIEAEALGSRVYFPENAYPYI
                     EKYRLEDPRQLKDLPDFNPSTDGRMPELLRAVALLKTELGDSLPIAGVVLGPMSIASQ
                     LMGLERLLYLLLDSPCEFADIIRFASGITLKAGLALLAQGAHISAVIDPSASQSILPS
                     EMFGRYLLPTIRDIFSQFKGAGAMASWLVITGNSQGLLPYYRQCGVDIAGIDYEVPLA
                     EALKWEGDFLISGNIKPYRFVNQTPQEIIREGKELISLAAGRRFILSSGCEVPLDTKP
                     ENLAALIKAVRDV"
     misc_feature    282621..283484
                     /locus_tag="DSY0250"
                     /note="The URO-D _like protein superfamily includes
                     bacterial and eukaryotic uroporphyrinogen decarboxylases
                     (URO-D), coenzyme M methyltransferases and other putative
                     bacterial methyltransferases. Uroporphyrinogen
                     decarboxylase (URO-D) decarboxylates the four...; Region:
                     URO-D_like; cd03465"
                     /db_xref="CDD:239548"
     gene            283483..284793
                     /locus_tag="DSY0251"
                     /db_xref="GeneID:3953234"
     CDS             283483..284793
                     /locus_tag="DSY0251"
                     /note="similarity to COG0642 Signal transduction histidine
                     kinase(Evalue: 1E-33)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516484.1"
                     /db_xref="GI:89892997"
                     /db_xref="GeneID:3953234"
                     /translation="MCDRMDVKQNTALSSEEELKKQIAALHKINNMTGFLPIKIEELL
                     PAIKEVMEDIFADYQCNFNIFPKRHGCNRLELGDCKAIRDQLPMISDQDQTCPCCTGE
                     ACRGIFHSHVCVPLVSGKEVFGVMTLKSLLKVRLSRDSLEMLLAIANQVAATLQRSQL
                     LNRLAQEKNNLEEANQEITQLNRSLFDTIKELEKTQRQLIYSERLAAAGRLAANLTHE
                     INNPTGIILSRLEWLLLEAPETELPEEVVKDLLVIKKHTERIAQTTRGLLSFSRRTKN
                     ETTLVDLENLIKETVVWLERQFSRKDIIIVLNLSRLPTVIGNKDQLEQVLVNILTNAK
                     DALPEGGKIKITTKYDTEKNNVQIDIEDNGTGIPEDMMNSIFDPFFSTKEKELGTGLG
                     LPISLTIMKEHGGFLRMESTPHEGSCFSMILPCVPENQEGDLNE"
     misc_feature    <283717..283974
                     /locus_tag="DSY0251"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    283849..284775
                     /locus_tag="DSY0251"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    283906..284088
                     /locus_tag="DSY0251"
                     /note="Sec20; Region: Sec20; pfam03908"
                     /db_xref="CDD:112708"
     misc_feature    284122..284298
                     /locus_tag="DSY0251"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(284125..284127,284137..284139,284146..284148,
                     284158..284160,284167..284169,284218..284220,
                     284239..284241,284248..284250,284260..284262,
                     284269..284271,284281..284283)
                     /locus_tag="DSY0251"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    284131..284133
                     /locus_tag="DSY0251"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    284446..284751
                     /locus_tag="DSY0251"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(284464..284466,284476..284478,284485..284487,
                     284560..284562,284566..284568,284572..284574,
                     284578..284583,284650..284661,284707..284709,
                     284713..284715,284728..284733,284737..284739)
                     /locus_tag="DSY0251"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    284476..284478
                     /locus_tag="DSY0251"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(284572..284574,284578..284580,284650..284652,
                     284656..284658)
                     /locus_tag="DSY0251"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            284786..286171
                     /locus_tag="DSY0252"
                     /db_xref="GeneID:3953235"
     CDS             284786..286171
                     /locus_tag="DSY0252"
                     /note="similarity to COG2204 Response regulator containing
                     CheY-like receiver, AAA-type ATPase, and DNA-binding
                     domains(Evalue: 1E-101)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516485.1"
                     /db_xref="GI:89892998"
                     /db_xref="GeneID:3953235"
                     /translation="MSEDRHIVIIDDEPDMLETCARVIHRMGYKCTTYEDSCEALEEI
                     YRLQPDLIITDIKMPQCDGFEVLEKAKVCTPKARVIVITGYASVDSAVQAMKEGAYDY
                     LSKPFPIEQLQLTINKALQHIALTEENQLLRAQLQEGLNTDNIIGARGGLQDVFETIG
                     KISNSDASILILGESGTGKEVIARAIHKNSRRSTGPFIPVDCASLPENLLESELFGYE
                     RGAFTGANTTKQGLLEMAHGGTLFLDELGELTPAMQAKLLRTLEERAIRRVGGNRLIN
                     IDIRVLAATNRDLEKAIRAKEFREDLYYRINVITLKLPVLHERQQDIPLLVNHFCKKF
                     SQDMNKKVSGFTPEAMQAMKSYAWPGNIRELRNVVERAISLSGSEMVEISDLPEKVIG
                     GQKKILPEQENLGAFSFHEAKDICLKRFEMEYLKELLDKHHGNITQAAKSAGMDRKTI
                     HRLINKYDLQR"
     misc_feature    284786..286168
                     /locus_tag="DSY0252"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    284810..285145
                     /locus_tag="DSY0252"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(284816..284821,284948..284950,284972..284974,
                     285032..285034,285089..285091,285098..285103)
                     /locus_tag="DSY0252"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    284948..284950
                     /locus_tag="DSY0252"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(284957..284962,284966..284974)
                     /locus_tag="DSY0252"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    285098..285106
                     /locus_tag="DSY0252"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    285272..285712
                     /locus_tag="DSY0252"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    285302..285325
                     /locus_tag="DSY0252"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(285305..285328,285515..285517,285641..285643)
                     /locus_tag="DSY0252"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    285503..285520
                     /locus_tag="DSY0252"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    285698..285700
                     /locus_tag="DSY0252"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    286034..286156
                     /locus_tag="DSY0252"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(286172..286723)
                     /locus_tag="DSY0253"
                     /db_xref="GeneID:3953236"
     CDS             complement(286172..286723)
                     /locus_tag="DSY0253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516486.1"
                     /db_xref="GI:89892999"
                     /db_xref="GeneID:3953236"
                     /translation="MGKATIKIIFSLAASLVLFVSGCSSGQEPGSAPITPQEKPEIEV
                     FSKTMELNKIVDLDTMKLRIINVSLVRNTDPDPDAPLGKIALGIEIGNTSDKDVLFYP
                     EDFEMTIDGKEIASPDLTLTSSLGGTYPPQRVQQGFITFPIKEKEVTSVKELHLTIPP
                     TTDQDGIATEAKEYTILIDDLEA"
     gene            287109..288314
                     /locus_tag="DSY0254"
                     /db_xref="GeneID:3953237"
     CDS             287109..288314
                     /locus_tag="DSY0254"
                     /note="similarity to COG0577 ABC-type transport systems,
                     involved in lipoprotein release, permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516487.1"
                     /db_xref="GI:89893000"
                     /db_xref="GeneID:3953237"
                     /translation="MMFAKLIWRNAKRRPWQQGLTLFVVVACAAALTAGILLVWGIEK
                     GGQSAVDNLGADVMAIPADAHLEPGQVLFTGAPANIYMNSEVLKEIEKVPGVEAISAQ
                     FFSQTLNQGCCSLPEEYRLVGYDPQTDFLIRDLLAKGVGRDLKNTEVIVGGNVPAFLG
                     DRVVVLAEPFDVAGYLEPMGGSIDDTIFVPIATARRLAGKSPYLQEYWQEAGSPEQLV
                     SSVLIKTKDGADPNQVAKAIDRISGIKSVAAGKLFSELKEELLVIKEILRLLVVIICG
                     ITMASLASRYSSLVLERQQELALLRALGTERGNLFKLVMLETLCSGLAAAVMGCLAGY
                     GLVLYLAKSLSKHSSFPFMLPGAAQLCAAGLGIIAFVLLICCLAAFWPARSSSRLDPV
                     TALTEGELR"
     misc_feature    287130..287831
                     /locus_tag="DSY0254"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    287313..288293
                     /locus_tag="DSY0254"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     misc_feature    287913..288281
                     /locus_tag="DSY0254"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            288323..289036
                     /locus_tag="DSY0255"
                     /db_xref="GeneID:3953238"
     CDS             288323..289036
                     /locus_tag="DSY0255"
                     /note="similarity to COG1136 ABC-type transport systems,
                     involved in lipoprotein release, ATPase components(Evalue:
                     2E-44)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516488.1"
                     /db_xref="GI:89893001"
                     /db_xref="GeneID:3953238"
                     /translation="MEISLKNITHYYRDGTGDQVTPLRNIDLTMRSGDSLVLYGPSGC
                     GKSTLLFILGCLLRPSEGQVDIDGRSLLHYGEKELAELRNRKMGFMFQACYLLPTLTV
                     KENIMLPFWIQGGKARDGRTEKKTVELLLEQLELTERADFLPYQLSGGQRRRVAMARA
                     LANDPEVILADEPTAELDEEKKDFVGKWLGEQAGKKKIVVVATHDPQLAVYAGRVYSL
                     SQGQLQEKILGKGAVYSSG"
     misc_feature    288329..289006
                     /locus_tag="DSY0255"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    288329..288991
                     /locus_tag="DSY0255"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    288440..288463
                     /locus_tag="DSY0255"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(288449..288454,288458..288466,288596..288598,
                     288833..288838,288932..288934)
                     /locus_tag="DSY0255"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    288587..288598
                     /locus_tag="DSY0255"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    288761..288790
                     /locus_tag="DSY0255"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    288821..288838
                     /locus_tag="DSY0255"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    288845..288856
                     /locus_tag="DSY0255"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    288920..288940
                     /locus_tag="DSY0255"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            289068..289523
                     /locus_tag="DSY0256"
                     /db_xref="GeneID:3953239"
     CDS             289068..289523
                     /locus_tag="DSY0256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516489.1"
                     /db_xref="GI:89893002"
                     /db_xref="GeneID:3953239"
                     /translation="MEVKLLNGKVTKVIGGLGAALGLLIALTPFQLAPVCQRLLELTS
                     GKMTHMRCHYTGQGEVFLGIVVVLVSLIYLFNTSIPAQKALGGVLMILGCAVIILPTN
                     LGIGVCMNPMECHTTARVLYVLGSLTIIDGLVAVFQEKLPVSPSKDIKA"
     misc_feature    289149..289487
                     /locus_tag="DSY0256"
                     /note="Domain of unknown function (DUF4418); Region:
                     DUF4418; pfam14387"
                     /db_xref="CDD:258555"
     gene            290142..290588
                     /locus_tag="DSY0257"
                     /db_xref="GeneID:3953240"
     CDS             290142..290588
                     /locus_tag="DSY0257"
                     /note="similarity to COG0723 Rieske Fe-S protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516490.1"
                     /db_xref="GI:89893003"
                     /db_xref="GeneID:3953240"
                     /translation="MENNNKGEISRRKFLGIMTGVPLVLSVGTPAVAVGKMISPPEAL
                     RPLPPRMAILKEDELLEKPKEIIYDGLPAMIFKKGNEYRAFSRVCTHLGCTVMWNEAE
                     KRFECPCHGGIFDEDGNVLEGPPPKPLTRLRAWVEDGYVMVQREVV"
     misc_feature    <290403..290570
                     /locus_tag="DSY0257"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    order(290406..290408,290412..290417,290460..290462,
                     290466..290471,290475..290477,290481..290483)
                     /locus_tag="DSY0257"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    order(290406..290408,290412..290417,290460..290462,
                     290469..290471,290475..290477)
                     /locus_tag="DSY0257"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            290560..291228
                     /locus_tag="DSY0258"
                     /db_xref="GeneID:3953241"
     CDS             290560..291228
                     /locus_tag="DSY0258"
                     /note="similarity to COG1290 Cytochrome b subunit of the
                     bc complex(Evalue: 5E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516491.1"
                     /db_xref="GI:89893004"
                     /db_xref="GeneID:3953241"
                     /translation="MSWCKGRLFSVAIEPKEVGVKDMFKEIAEHPVPRHARNFIFCFG
                     GISFLLFLVQVVTGIVLAVYYNPTMEGAYQSVMFINDEVFMGKALRSVHNIAANLMLI
                     MVVLHFLRVVFTGAYKPPRQFNWVVGVLLLLLVILFCFIGYLLPLDQVGYWAAIIGTK
                     ILGSIPIVGDQLLLLGQAGTKITDHTLMRFFIIHIVVLPVVVIVLLIAHFLMIRKQGI
                     SGPL"
     misc_feature    290617..291225
                     /locus_tag="DSY0258"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     misc_feature    290617..>291225
                     /locus_tag="DSY0258"
                     /note="Cytochrome b subunit of the bc complex [Energy
                     production and conversion]; Region: QcrB; COG1290"
                     /db_xref="CDD:224209"
     misc_feature    order(290656..290658,290665..290667,290725..290727,
                     290737..290739,290746..290751,290776..290781,
                     290788..290793,290800..290814,290818..290826,
                     290833..290835,290917..290919,291199..291204)
                     /locus_tag="DSY0258"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    order(290659..290667,290680..290685,290692..290697,
                     290704..290706,290776..290778,290821..290823,
                     290830..290835,290842..290847,290851..290856,
                     290860..290865,290872..290874,290893..290910,
                     290920..290925,290932..290937,290944..290946,
                     290953..290958,290986..290988,290998..291018,
                     291028..291033,291055..291057,291214..291216)
                     /locus_tag="DSY0258"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(290680..290682,290689..290694,290698..290703,
                     290857..290859,290869..290871,290878..290883,
                     290887..290889,290929..290934,290941..290946,
                     290950..290955,291172..291174,291184..291189,
                     291196..291198,291211..291216)
                     /locus_tag="DSY0258"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(290692..290694,290701..290703,291187..291189,
                     291211..291213)
                     /locus_tag="DSY0258"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(290710..290712,290719..290724,290731..290736,
                     290740..290745,290752..290754,290785..290787,
                     290827..290829,290836..290841,290848..290850,
                     290971..290976,290983..290988,290992..290997,
                     291139..291144,291151..291153)
                     /locus_tag="DSY0258"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(290956..290958,290965..290970,290977..290982,
                     291019..291021,291028..291033,291043..291045,
                     291127..291129,291136..291138)
                     /locus_tag="DSY0258"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     gene            291262..291636
                     /locus_tag="DSY0259"
                     /db_xref="GeneID:3953242"
     CDS             291262..291636
                     /locus_tag="DSY0259"
                     /note="similarity to COG1290 Cytochrome b subunit of the
                     bc complex"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516492.1"
                     /db_xref="GI:89893005"
                     /db_xref="GeneID:3953242"
                     /translation="MDKDTVPFFPNHLTTEVSVALGILGVVFFLAGVIPKDLGPPANP
                     VMTPAHIEPDWYFMWLFGLLKIVPQLLGLLIPALLVVGVILLPWLDKSTSRRPEERPW
                     VIIGAEIVLILMVVLTYIALHF"
     misc_feature    291280..>291546
                     /locus_tag="DSY0259"
                     /note="Cytochrome b(C-terminus)/b6/petD:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: cytochrome_b_C;
                     cl00193"
                     /db_xref="CDD:260248"
     misc_feature    order(291280..291285,291289..291294,291301..291303,
                     291310..291315,291322..291324,291328..291333,
                     291340..291345,291349..291351,291367..291369,
                     291376..291381,291538..291543)
                     /locus_tag="DSY0259"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238179"
     misc_feature    order(291283..291285,291292..291297,291304..291309,
                     291316..291318,291325..291330,291334..291342,
                     291349..291351,291364..291366,291370..291375,
                     291379..291393,291397..291405,291412..291414,
                     291418..291429,291469..291471,291499..291501,
                     291508..291513,291517..291525,291529..291531)
                     /locus_tag="DSY0259"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    291295..291297
                     /locus_tag="DSY0259"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(291412..291414,291418..291423,291430..291432,
                     291439..291444,291487..291489)
                     /locus_tag="DSY0259"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     gene            291670..292233
                     /locus_tag="DSY0260"
                     /db_xref="GeneID:3953243"
     CDS             291670..292233
                     /locus_tag="DSY0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516493.1"
                     /db_xref="GI:89893006"
                     /db_xref="GeneID:3953243"
                     /translation="MDAFGGESMTGNGRNNPSFHLLSIFCIWLGMGFLVGITGSVIAA
                     PHYVLPDDREAKLVYASGLQPQQSAGTQSSEPSGASGTAREGELFLKKGCTQCHEVSY
                     YGIAGGVTGPDLTKAYGDVPDRFGKTLAEFLQEPEGTMAEMFVRMDITDDEKNQVLEL
                     LTAAGGETAQQPAGEENESTENTNNPE"
     gene            292286..294184
                     /locus_tag="DSY0261"
                     /db_xref="GeneID:3955032"
     CDS             292286..294184
                     /locus_tag="DSY0261"
                     /note="similarity to COG1622 Heme/copper-type
                     cytochrome/quinol oxidases, subunit 2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516494.1"
                     /db_xref="GI:89893007"
                     /db_xref="GeneID:3955032"
                     /translation="MEKGLFKKIVLSLAGLLVGLVIAVYLSAQLNPEAEAAAAFGGKN
                     ISVDGVPDDVVQAALKTYVPPGQLDEYYMFASGGHSGNVFVYGVPSMRRIRTIPVFTP
                     ESAVGYGWTTESKEMLGEWSWGDVHHPALSETKGDYDGRWLFVNDNANSRAARIDLDS
                     FRTSQILDIPNIYGPHSAVFMTPNSEYFMLGSRFAGPIPYGTYSPIENLSKDYNCVLA
                     AVAIDPNNGEMSVGWEVLMPPWSFDLSDAGKLDSEGWAFLTTYNTEEAYELLEVNASQ
                     REMDYVVALNWKMLEQAANEGKYKIVDGVKMIDPLDVPGSVYLVPAMKSPHGVDVTPD
                     GKYFIANGKVAPVATVFSFEKFKECIDNKDFQGEERGFPVVNYEKVRVAEVPVGLGPL
                     HTQFDGNGYAYTTLFIDSTIAKWSLDTFEVVDVTPVHYCPGHLCAAEGDTVSPDGKYL
                     VSLNKLAKDKFLSVGPSHPESAQLIDLTTDKMKILMDVPTDPEPHFAQMIKADKITTW
                     EVFEKDPSQPGAVYEKENARIERDGNNVTVYQMGFRSRYYPDHVEVNEGDHVTWYLTN
                     TDFDEDITHGFGICLYDLNAEAQPGETIKFEFVADKAGVYPFYCTNFCSALHQEMQGW
                     FIVKPKGL"
     misc_feature    292457..294172
                     /locus_tag="DSY0261"
                     /note="nitrous-oxide reductase, Sec-dependent; Region:
                     nitrous_NosZ_Gp; TIGR04246"
                     /db_xref="CDD:234520"
     misc_feature    293888..294172
                     /locus_tag="DSY0261"
                     /note="The C-terminal cupredoxin domain of Nitrous-oxide
                     reductase; Region: N2OR_C; cd04223"
                     /db_xref="CDD:259885"
     misc_feature    order(293996..294001,294005..294007,294023..294040,
                     294044..294046,294077..294082,294086..294088,
                     294092..294106,294110..294112,294116..294124,
                     294128..294136,294140..294145,294149..294151,
                     294155..294157,294161..294169)
                     /locus_tag="DSY0261"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259885"
     misc_feature    order(294008..294010,294113..294115,294125..294127,
                     294137..294139,294146..294148)
                     /locus_tag="DSY0261"
                     /note="CuA binuclear site [ion binding]; other site"
                     /db_xref="CDD:259885"
     gene            294271..294870
                     /locus_tag="DSY0262"
                     /db_xref="GeneID:3955033"
     CDS             294271..294870
                     /locus_tag="DSY0262"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516495.1"
                     /db_xref="GI:89893008"
                     /db_xref="GeneID:3955033"
                     /translation="MDFVRKLFKGNLNLIGRIMFGAAGLILLASLFLPWWHLDLVAPQ
                     YPEGLSVIVYPDKLDGRIDIINNINHYIGMKWISEEDFPEFQVITKVAYVIIGLALIT
                     ALVKKRWLAWLTAGLGAVGGMIGVYDLWRWLRDYGTQLDPMAAIKIDPFTPPIIGTNK
                     LANFITYTGFNSGGYLLGLSIILMLLAAWRFKEHEKQEE"
     misc_feature    <294556..294648
                     /locus_tag="DSY0262"
                     /note="Domain of unknown function (DUF4337); Region:
                     DUF4337; pfam14235"
                     /db_xref="CDD:258426"
     gene            294851..296356
                     /locus_tag="DSY0263"
                     /db_xref="GeneID:3955034"
     CDS             294851..296356
                     /locus_tag="DSY0263"
                     /note="similarity to COG3420 Nitrous oxidase accessory
                     protein(Evalue: 4E-44)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516496.1"
                     /db_xref="GI:89893009"
                     /db_xref="GeneID:3955034"
                     /translation="MKSKKNRRCFWLSLFLFLWIIPLSAHAATLEVQGGGSAESIQSA
                     LARAAPGDTIHVYSGTYVGKIVIDKAVSLIGIGMPILDGGGEGDVVSIKGDGVTFKGF
                     QVMGSGKRLQDSDAGIKLYSAGNVIEDNKLTNNLFGMYLLKSPHNTLRNNTIIGRPAK
                     NKLQASKKDEAGEAGTYDILPSFEGESGDGIHLFAASHNLIENNEITDTRDGIYFNYA
                     HDNRLLYNHIDGVRYAIHYMYSDDNYFEGNIATNNVAGAAPMYSKRITFRENVFAYNR
                     GHRSFGVLFSNCNDCLAEGNVFFGNTRGALFDVSYHNIFRNNLVAANDIGIDLISSSG
                     FNTFTENNFMDNMEQIAFRAGRIGEGNVFYEEGTGNYWNDYRGFDLDQNGIGDTPYLT
                     GDIFTYLMNKAPAVRLFLNSPAAKALEFAENMFPVIEIPKAEDAYPLIKPVAIEINGQ
                     FHIEKNQVSNKIFGAYSLLMLLIAGMITARAFGVSSQGIKRVENYLRGGQK"
     misc_feature    294971..296173
                     /locus_tag="DSY0263"
                     /note="nitrous oxide reductase family maturation protein
                     NosD; Region: NosD_copper_fam; TIGR04247"
                     /db_xref="CDD:234521"
     misc_feature    295199..295318
                     /locus_tag="DSY0263"
                     /note="parallel beta-helix repeat (two copies); Region:
                     para_beta_helix; TIGR03804"
                     /db_xref="CDD:234360"
     misc_feature    295418..295528
                     /locus_tag="DSY0263"
                     /note="parallel beta-helix repeat (two copies); Region:
                     para_beta_helix; TIGR03804"
                     /db_xref="CDD:234360"
     misc_feature    295484..295609
                     /locus_tag="DSY0263"
                     /note="parallel beta-helix repeat (two copies); Region:
                     para_beta_helix; TIGR03804"
                     /db_xref="CDD:234360"
     gene            296353..296895
                     /locus_tag="DSY0264"
                     /db_xref="GeneID:3955035"
     CDS             296353..296895
                     /locus_tag="DSY0264"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516497.1"
                     /db_xref="GI:89893010"
                     /db_xref="GeneID:3955035"
                     /translation="MSRKIMVVLLSLWCLSLIGCSSGGAAGTPREIDPTIDICPVCRM
                     SVIDEHFAAQIIDSQGQVEIFDDIGCMSIFMRRLEAGAQDSILATYVKDFESMEWIQA
                     QEAFYVQGRIDTPMSFGIVAFAAEETARKFAQEVGGKQLTWEQVLTEPLTIGLDIEFN
                     QEDFNVQDLDTGETREERGN"
     misc_feature    296437..296790
                     /locus_tag="DSY0264"
                     /note="NosL; Region: NosL; cl01769"
                     /db_xref="CDD:261061"
     gene            296896..297732
                     /locus_tag="DSY0265"
                     /db_xref="GeneID:3955036"
     CDS             296896..297732
                     /locus_tag="DSY0265"
                     /note="similarity to COG1277 ABC-type transport system
                     involved in multi-copper enzyme maturation, permease
                     component(Evalue: 2E-33)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516498.1"
                     /db_xref="GI:89893011"
                     /db_xref="GeneID:3955036"
                     /translation="MQLINVVTIAEKELLESIRSKWLGTFTVVFALIALLVSFFGLSS
                     LGVGGQQGFNRVTASLLNLVLYLLPLIALVMGSATVAGEKEAGSLHVLLTQPIDKAEV
                     IIGKFGGLALALIASILVGFGGAGVVIAWKTGSINITDYLMFVSLSMILAMVFLSIAI
                     LISVIVSRRAQGIGLGIFIWFLMILVYDFLAIGVAGLSNVSVIIPLLLLLLLANPADM
                     VRVLVILQLGGEETFGPTLVALTRMLTQGSGELLLYGALLIWMIIPLLIAAILFGRKQ
                     DY"
     misc_feature    296917..297720
                     /locus_tag="DSY0265"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_2; pfam12679"
                     /db_xref="CDD:257216"
     gene            297672..298655
                     /locus_tag="DSY0266"
                     /db_xref="GeneID:3955037"
     CDS             297672..298655
                     /locus_tag="DSY0266"
                     /note="similarity to COG1131 ABC-type multidrug transport
                     system, ATPase component(Evalue: 9E-52)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516499.1"
                     /db_xref="GI:89893012"
                     /db_xref="GeneID:3955037"
                     /translation="MDDHTSPDCGNFVRPQTGLLGGDPMEVINTLEVKYAQKFYGPFQ
                     AVKDINLTVEKGEIYALLGHNGAGKSTLIKMILGLVKASAGMIEIEGLNYDAKNKEIK
                     KRVGYLPERMNFYDNLTAWETISFYAKLKGITRKRCEEVLEQVGLREAEHRRVGTFSK
                     GMQQRLGLAQAIIHKPDLLVLDEPTTGLDPIGILELKAMIRNWNKEGTTILFSSHNLN
                     DVEELAQRIGIMNRGEMIAQGSLAELQDRLGLPTKIKIDLAVIPVDLEEILVGKRIKT
                     FQLEGKTVSIDCPKDKKTQVITAVMDGMLKVLDLRLEEPGLNSIYQNIMAE"
     misc_feature    297753..298646
                     /locus_tag="DSY0266"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    297762..298388
                     /locus_tag="DSY0266"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    297858..297881
                     /locus_tag="DSY0266"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(297867..297872,297876..297884,297999..298001,
                     298215..298220,298314..298316)
                     /locus_tag="DSY0266"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    297990..298001
                     /locus_tag="DSY0266"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    298143..298172
                     /locus_tag="DSY0266"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    298203..298220
                     /locus_tag="DSY0266"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    298227..298238
                     /locus_tag="DSY0266"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    298302..298322
                     /locus_tag="DSY0266"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            298789..299364
                     /locus_tag="DSY0267"
                     /db_xref="GeneID:3955038"
     CDS             298789..299364
                     /locus_tag="DSY0267"
                     /note="similarity to COG0290 Translation initiation factor
                     IF3(Evalue: 9E-59)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516500.1"
                     /db_xref="GI:89893013"
                     /db_xref="GeneID:3955038"
                     /translation="MEDGWNSARLFCDFFWRWFVISKDLRINDEIRAREVRLVGEEGE
                     QLGIVQLRDAQRIAAEKSLDLVEIAPTAKPPVCKIMDYGKYKYEQAKRDKEARKKQKT
                     MEIKEVKLRPNIEDHDFETKARNAQRFLNDGDKVKVTIMFRGREVTHPELGRTLCLRL
                     AEFCKAEANIERDPKLEGRNMIMILAPVKHD"
     misc_feature    298852..299355
                     /locus_tag="DSY0267"
                     /note="translation initiation factor IF-3; Reviewed;
                     Region: infC; PRK00028"
                     /db_xref="CDD:234582"
     misc_feature    298852..299079
                     /locus_tag="DSY0267"
                     /note="Translation initiation factor IF-3, N-terminal
                     domain; Region: IF3_N; pfam05198"
                     /db_xref="CDD:191228"
     misc_feature    299092..299355
                     /locus_tag="DSY0267"
                     /note="Translation initiation factor IF-3, C-terminal
                     domain; Region: IF3_C; pfam00707"
                     /db_xref="CDD:250071"
     gene            299385..299582
                     /gene="rpmI"
                     /locus_tag="DSY0268"
                     /db_xref="GeneID:3955039"
     CDS             299385..299582
                     /gene="rpmI"
                     /locus_tag="DSY0268"
                     /note="similarity to COG0291 Ribosomal protein L35"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="YP_516501.1"
                     /db_xref="GI:89893014"
                     /db_xref="GeneID:3955039"
                     /translation="MPKMKTHRGAAKRFKKTGTGKIVRHHAFTSHILEKKSPKRKRNL
                     RKGTVMHKTDAKRIARLVAYL"
     misc_feature    299385..299579
                     /gene="rpmI"
                     /locus_tag="DSY0268"
                     /note="50S ribosomal protein L35; Reviewed; Region: rpmI;
                     PRK00172"
                     /db_xref="CDD:234676"
     gene            299689..300051
                     /gene="rplT"
                     /locus_tag="DSY0269"
                     /db_xref="GeneID:3955040"
     CDS             299689..300051
                     /gene="rplT"
                     /locus_tag="DSY0269"
                     /note="binds directly to 23S ribosomal RNA prior to in
                     vitro assembly of the 50S ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="YP_516502.1"
                     /db_xref="GI:89893015"
                     /db_xref="GeneID:3955040"
                     /translation="MARVKRGVTKHQRHKKVLKLAKGFRGAKSKLYRPANEQVMKSLA
                     YAYAHRRDKKGDFRKLWIARINAAARLNGLSYSRMMNGLKIAGVSVNRKMLADLAIND
                     AAAFTELVNVAKAQVSAK"
     misc_feature    299704..300021
                     /gene="rplT"
                     /locus_tag="DSY0269"
                     /note="Ribosomal protein L20; Region: Ribosomal_L20;
                     cd07026"
                     /db_xref="CDD:197305"
     misc_feature    order(299704..299721,299725..299736,299749..299772,
                     299776..299787,299794..299799,299809..299814,
                     299821..299865,299869..299877,299884..299886,
                     299896..299898,299914..299919,299926..299931,
                     299938..299940,299962..299970)
                     /gene="rplT"
                     /locus_tag="DSY0269"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:197305"
     misc_feature    order(299794..299796,299806..299808,299815..299820,
                     299824..299829,299836..299838,299953..299964,
                     299971..299973,299989..299994,300010..300015)
                     /gene="rplT"
                     /locus_tag="DSY0269"
                     /note="L21 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     misc_feature    order(299857..299859,299866..299871,299878..299880,
                     299887..299892,299896..299898,299968..299970,
                     299977..299979,299986..299988)
                     /gene="rplT"
                     /locus_tag="DSY0269"
                     /note="L13 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     gene            300067..300924
                     /locus_tag="DSY0270"
                     /db_xref="GeneID:3955041"
     CDS             300067..300924
                     /locus_tag="DSY0270"
                     /note="similarity to COG0566 rRNA methylases(Evalue:
                     3E-33)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516503.1"
                     /db_xref="GI:89893016"
                     /db_xref="GeneID:3955041"
                     /translation="MLRHPFYIGVWGDDMLTSLQNEQVKYVVNLHKRKFREENGEFLI
                     EGWRFVEEGLARGAHLTKVFFCSECKNESWPQLAEALKVKGVPVIEVDERVLRKMSDT
                     ENPQGILAVVKQSRWTWDDFIEIVNPAGRSAIPMLLILDGVQDPGNCGTILRTALAAG
                     VTQVCLTEGTVDLYNLKVLRSTMGAIFSLNIATHCQPEEILKVCRSHKIPVFVGDAEG
                     TDLYETHFAQPMALVVGNEGNGPSAAFRGPGVKRITIPMSHQVESLNVAMATGIILYE
                     VRRRMTSTT"
     misc_feature    300115..300909
                     /locus_tag="DSY0270"
                     /note="rRNA methylases [Translation, ribosomal structure
                     and biogenesis]; Region: SpoU; COG0566"
                     /db_xref="CDD:223640"
     misc_feature    300196..300408
                     /locus_tag="DSY0270"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; smart00967"
                     /db_xref="CDD:214943"
     misc_feature    300469..300891
                     /locus_tag="DSY0270"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            301454..302476
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /db_xref="GeneID:3955042"
     CDS             301454..302476
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a heterotetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_516504.1"
                     /db_xref="GI:89893017"
                     /db_xref="GeneID:3955042"
                     /translation="MKQEVHRIQEETLAELQQVSTLEALQELKVKVLGKKGSLTAQLR
                     KMGGLSPEERPIFGQVVNETRDILEAAWIRREEELSQTAMLKQLEEEKLDISLPGVSL
                     PQGHQHPLTKVIEEIEEIFLGMGFQIAEGPEIESDYYNFEALNLPKDHPAREMQDSFY
                     ITEEILLRTQTSPVQIRTMEKQRPQLPVKIICPGKVYRNDDDATHSPMFHQVEGLMVD
                     RRIRMSDLKGILLSFSRMMFGESREIRLRPSFFPFTEPSAEVDVSCMLCGGAGCRICK
                     GTGWIEILGSGMVHPRVLEMGGYDSKELTGFAFGMGVERIAMLKYGIEDMRLLFDNDL
                     RFLQQF"
     misc_feature    301454..302473
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="phenylalanyl-tRNA synthetase subunit alpha;
                     Validated; Region: pheS; PRK00488"
                     /db_xref="CDD:234780"
     misc_feature    301502..301720
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="Aminoacyl tRNA synthetase class II, N-terminal
                     domain; Region: Phe_tRNA-synt_N; pfam02912"
                     /db_xref="CDD:111764"
     misc_feature    301775..302458
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) alpha chain
                     catalytic core domain. PheRS belongs to class II
                     aminoacyl-tRNA synthetases (aaRS) based upon its structure
                     and the presence of three characteristic sequence motifs.
                     This domain is primarily responsible...; Region:
                     PheRS_alpha_core; cd00496"
                     /db_xref="CDD:238277"
     misc_feature    order(301775..301777,301784..301786,301793..301798,
                     301817..301819,301832..301837,301841..301849,
                     301898..301900,301913..301915,301925..301942,
                     301985..301987,302012..302020,302030..302032,
                     302036..302038,302042..302044,302048..302050,
                     302069..302071,302120..302128,302132..302137,
                     302195..302197,302216..302224,302228..302230,
                     302321..302326,302441..302443,302447..302455)
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238277"
     misc_feature    301829..301849
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="motif 1; other site"
                     /db_xref="CDD:238277"
     misc_feature    order(301913..301921,301961..301963,301967..301969,
                     301976..301978,302045..302047,302051..302053,
                     302063..302071,302078..302080,302084..302086,
                     302090..302092,302204..302206,302210..302215,
                     302297..302314,302378..302389,302396..302398,
                     302429..302431)
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="active site"
                     /db_xref="CDD:238277"
     misc_feature    302042..302053
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="motif 2; other site"
                     /db_xref="CDD:238277"
     misc_feature    302381..302398
                     /gene="pheS"
                     /locus_tag="DSY0271"
                     /note="motif 3; other site"
                     /db_xref="CDD:238277"
     gene            302489..304894
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /db_xref="GeneID:3955043"
     CDS             302489..304894
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a tetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 2 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="YP_516505.1"
                     /db_xref="GI:89893018"
                     /db_xref="GeneID:3955043"
                     /translation="MKVSLEWLREYVDIAQTAEDLAESLTRGGIEVGGVEYLNQGLEA
                     VVVGEITRMEHHPNADKLWICEVNLGDRSTTIVTGAQNLLVGDRIPVALPGTTLPNGV
                     HIEVSKLRGVESSGMLCSTEELHLDSGLGDPRSEGGILILEKETPLGATMDTVLGEGD
                     CVLDLELYPNRPDCLGMVNVAREVASLTGEALHLPAWAEGSQGPDYPGDPKARIVLDD
                     PELCQRYAGLVVEDVNIEPSPEWMQKRLKAAGVRPISNIVDITNYIMLEMGQPLHAFD
                     RDAIAGAVHVRRARAGEKLVTLDGIERELDPEMLLIADDEKALGLAGVMGGLNSEITD
                     STKRIFVESAHFSSVSIRRTSRRLGLRSEASNRFEKGVNPHGVAATLGRVAELVIQLG
                     AGKPVGFVEQAGQLPKPAAVSLTVEKTNSLLGTVLTEEEITGVLKRLRFPYQEKDRGY
                     EVQIPTYRSDITIEEDLIEEVARLTGYDRIPTTLPQGDQTQGRRTPEQEFKRTLRHLL
                     VGLGLNEVMTYSFTRPDADRQFGDMDQAIPLLNPLREELSVMRTALLPSIMEIAARNI
                     SRRNLDIRLFEMGSIYKSKERPLVKLPQEELHLAGVIWGKSSRHWLTPVTEYDFYTVK
                     GILEEVAREFGLEFDYKLPNNQELTHPGRSADIYLNGEKIGLMGEIHPALGKEWELER
                     ALIFELAVTPLMEAGNRTIRAFSIPKFPAMQRDLAVVVPLEVSAQDVMKRIKELGGTL
                     LVQVNIFDVYTGKPIPEDRKSLAFALKYQALDRTLKDEEVNALNQQVLEGIEKEFGAA
                     WRK"
     misc_feature    302489..304891
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="phenylalanyl-tRNA synthetase subunit beta;
                     Reviewed; Region: pheT; PRK00629"
                     /db_xref="CDD:234804"
     misc_feature    302621..302935
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="tRNA-binding-domain-containing prokaryotic
                     phenylalanly tRNA synthetase (PheRS) beta chain.  PheRS
                     aminoacylate phenylalanine transfer RNAs (tRNAphe).
                     PheRSs belong structurally to class II aminoacyl tRNA
                     synthetases (aaRSs) but, as they aminoacylate...; Region:
                     tRNA_bind_bactPheRS; cd02796"
                     /db_xref="CDD:239196"
     misc_feature    order(302669..302671,302708..302710,302768..302770,
                     302807..302809,302828..302830,302837..302839)
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239196"
     misc_feature    303149..303664
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="B3/4 domain; Region: B3_4; pfam03483"
                     /db_xref="CDD:251992"
     misc_feature    303716..303919
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="tRNA synthetase B5 domain; Region: B5; smart00874"
                     /db_xref="CDD:197942"
     misc_feature    303974..304567
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) beta chain
                     core domain. PheRS belongs to class II aminoacyl-tRNA
                     synthetases (aaRS) based upon its structure. While class
                     II aaRSs generally aminoacylate the 3'-OH ribose of the
                     appropriate tRNA,  PheRS is an...; Region:
                     PheRS_beta_core; cd00769"
                     /db_xref="CDD:238392"
     misc_feature    order(303980..303985,304004..304006,304013..304015,
                     304025..304027,304031..304033,304037..304045,
                     304097..304108,304139..304141,304181..304183,
                     304211..304213,304226..304228,304232..304234,
                     304238..304240,304271..304273,304364..304366)
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238392"
     misc_feature    304025..304045
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="motif 1; other site"
                     /db_xref="CDD:238392"
     misc_feature    304157..304168
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="motif 3; other site"
                     /db_xref="CDD:238392"
     misc_feature    304232..304240
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="motif 2; other site"
                     /db_xref="CDD:238392"
     misc_feature    304607..304888
                     /gene="pheT"
                     /locus_tag="DSY0272"
                     /note="Ferredoxin-fold anticodon binding domain; Region:
                     FDX-ACB; pfam03147"
                     /db_xref="CDD:251758"
     gene            304872..305174
                     /locus_tag="DSY0273"
                     /db_xref="GeneID:3955044"
     CDS             304872..305174
                     /locus_tag="DSY0273"
                     /note="similarity to COG3027 Uncharacterized BCR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516506.1"
                     /db_xref="GI:89893019"
                     /db_xref="GeneID:3955044"
                     /translation="MELPGENSIVSGGCHMAEENEKVIVEIFGEKHVIRGQESPEHIL
                     KVAREVDKKMRLIAQRTPRLAIHQIAILAALNLADELEKIKEEQETLMQLIEAQEE"
     misc_feature    304917..305168
                     /locus_tag="DSY0273"
                     /note="Cell division protein ZapA; Region: ZapA; cl01146"
                     /db_xref="CDD:260811"
     gene            305346..305708
                     /locus_tag="DSY0274"
                     /db_xref="GeneID:3955045"
     CDS             305346..305708
                     /locus_tag="DSY0274"
                     /note="similarity to COG1433 Uncharacterized ACR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516507.1"
                     /db_xref="GI:89893020"
                     /db_xref="GeneID:3955045"
                     /translation="MKIALPSRQNRIDDHFGHCEYFTVFSVDEGKKELVDQETVSSPV
                     GCGCKSNIAQTLAEMGVTLMLAGNMGEGAVRVLSNSGISVIRGCSGEVKSVAQQWLEG
                     TLEDSGDSCHEHEHSCQH"
     misc_feature    305346..305645
                     /locus_tag="DSY0274"
                     /note="This uncharacterized conserved protein belongs to a
                     family of iron-molybdenum cluster-binding proteins that
                     includes NifX, NifB, and NifY, all of which are involved
                     in the synthesis of an iron-molybdenum cofactor (FeMo-co)
                     that binds the active site of...; Region: MTH1175;
                     cd00851"
                     /db_xref="CDD:238431"
     gene            complement(305852..306232)
                     /locus_tag="DSY0275"
                     /db_xref="GeneID:3955046"
     CDS             complement(305852..306232)
                     /locus_tag="DSY0275"
                     /note="similarity to COG0443 Molecular chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516508.1"
                     /db_xref="GI:89893021"
                     /db_xref="GeneID:3955046"
                     /translation="MNKKTSRFLLLMTLFLGLSLGIFFNAATTNAYPDMSEDGVTCTP
                     CHEEGEHGGSGEPATEPEPAPPAPAPVQPTPSPQEPAQESPQVAKEQPDSADTTGAVS
                     PALIVGVVVLLLLAVYLFAFKKHK"
     gene            complement(306268..307887)
                     /locus_tag="DSY0276"
                     /db_xref="GeneID:3955047"
     CDS             complement(306268..307887)
                     /locus_tag="DSY0276"
                     /note="similarity to COG1053 Succinate
                     dehydrogenase/fumarate reductase, flavoprotein subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="YP_516509.1"
                     /db_xref="GI:89893022"
                     /db_xref="GeneID:3955047"
                     /translation="MENMNRRNFLKKATVGAAALAGASMLTACGTPETVKPNSDASPA
                     GRSWDYEVDAVVVGGGHGGLCAAATAAERGKKVLLVEISGIVGGGSAWSGGILHTFGT
                     QTYEEYMEYSEGLHDPVLGKLFFETFKGEFMPWVQNTVGAPVYIMGPQAGPNGRPQDK
                     VPNSIGDKEWKMGTKEDKGYAGLRNYFKAIEDYVKAKGGTVLLKTRGLNLITDGEKVV
                     GLKIVTQGEEPKYVKAGAVILATGNFFANKGLLTQFVGPYAYRTKVMGVPYATGDGLR
                     MGQGVGAMLSEGLSTWSGTLVCVTHNNAVTDDPAAYEKIIETDPNSMAGINKGRPNPP
                     WFGTGTVLPELVPAIVVNLNGKRFKDEAHPIDSKYPRLTDAVLVQPEGMAFVIGDQAM
                     YDANPSTSAMMKIIKDEGVKVIEGATLEEFAANMEKAGVYKANLLKTIREYNAAIDKG
                     TTMELEVPREYNLNKISTPPFYGVPVTGQIYCNFGGLAINENVQVLDHQKQPIPGLYA
                     VPPAAGGVMRSIYTGSIALAGTFGWLAGKQI"
     misc_feature    complement(<307807..307878)
                     /locus_tag="DSY0276"
                     /note="Tat (twin-arginine translocation) pathway signal
                     sequence; Region: TAT_signal_seq; TIGR01409"
                     /db_xref="CDD:233399"
     misc_feature    complement(<307069..307701)
                     /locus_tag="DSY0276"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(306274..307698)
                     /locus_tag="DSY0276"
                     /note="tricarballylate dehydrogenase; Validated; Region:
                     PRK08274"
                     /db_xref="CDD:236214"
     misc_feature    complement(306274..>307218)
                     /locus_tag="DSY0276"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            308165..309529
                     /locus_tag="DSY0277"
                     /db_xref="GeneID:3955048"
     CDS             308165..309529
                     /locus_tag="DSY0277"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516510.1"
                     /db_xref="GI:89893023"
                     /db_xref="GeneID:3955048"
                     /translation="MRISMLQHNSLPEQHQNQLSLIFSSLKLSQLLRTAGIRKSYGIS
                     SFVVFQIIFQLVFQGRNLFRLLEGSRAESLPGKDVVYRFLNDSRYNWRRFYQLLSLKI
                     VGSFEKLTSAQRIRVFIVDDSVMDRERSKKVELLARVFDHVSGRFVRGYTLLTLGWSD
                     GFSFAPLDFTLMSSAKAKNRLCEMREDLDKRSVGYKRRMEAMIPKPDAVVQMLERALK
                     AGFSADYVLMDSWFTHAPLLQKLRDKELHVIGMVKELKQRYLFEGESLSLRELYARVP
                     KNSKAEILGSVRVHTPSGLALKIVFVQNRNNRREWLAILTTDLSLENAEIVRIYGMRW
                     SIETFFKMAKSHLKLGTEFQGRSFDMMISHTSIVFSRYLILEWERRENNDERSLGGLF
                     YLFADEVMDLDLKTAIRQLMAFVLNLLPNKPENNESLSQLHKWIAELPSYIRALFAQL
                     GCES"
     misc_feature    308201..>308920
                     /locus_tag="DSY0277"
                     /note="DDE superfamily endonuclease; Region: DDE_5;
                     cl17874"
                     /db_xref="CDD:266901"
     misc_feature    <308777..309238
                     /locus_tag="DSY0277"
                     /note="Archaeal putative transposase ISC1217; Region:
                     DDE_Tnp_2; pfam04693"
                     /db_xref="CDD:147046"
     gene            309559..310500
                     /locus_tag="DSY0278"
                     /db_xref="GeneID:3955049"
     CDS             309559..310500
                     /locus_tag="DSY0278"
                     /note="similarity to COG0583 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516511.1"
                     /db_xref="GI:89893024"
                     /db_xref="GeneID:3955049"
                     /translation="MRLEQMEYLISLAETGSITQTAKYFFMSQQGISYSIQQLEKELD
                     VKILHNHRNRVTFTAAGECVLVRARDFVKQYQELQEELQSFQKDKTPSYKARLFLYID
                     PFMANTFLPRILKKLHKQSKIKLATKEQNLTLLLQTLSDPSEVDGIGLVGLTEHYTTE
                     QFKQKFDFEPIHSCHLQVLVSETSPLAKLPALSFEEIAQYPICLFASDYNSEEVGKDL
                     FFGRTVKNLSVILQTTNVDMYRDMVNKNIAIGLTTDYLESFFHKSSLTGIPLKEPIQF
                     HVGFIRRKGRPFSVMDEEFMAIAKDVLNSQLAKKVSQ"
     misc_feature    309559..310485
                     /locus_tag="DSY0278"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    309565..309744
                     /locus_tag="DSY0278"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    309844..310455
                     /locus_tag="DSY0278"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(309889..309894,309898..309903,309910..309912,
                     309925..309945,310246..310263,310279..310284,
                     310288..310293)
                     /locus_tag="DSY0278"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            310632..311462
                     /locus_tag="DSY0279"
                     /db_xref="GeneID:3955050"
     CDS             310632..311462
                     /locus_tag="DSY0279"
                     /note="similarity to COG0789 Predicted transcriptional
                     regulators(Evalue: 8E-51)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516512.1"
                     /db_xref="GI:89893025"
                     /db_xref="GeneID:3955050"
                     /translation="MKEQYYSIGQVAKLSNISIPTLRYYDQIDLYKPAHVDTLTSYRY
                     YKESQLYILDMIKSLKYIGTPLTDIKTVLNYTPAELFCFLEHQEDVIEGKIQGLQEIH
                     KNLQQTKKQLQQQMKTALATDVFEKTEDLQIFTLPVENYAPQSIPNDCYGELIKLVEA
                     EGSRISSHYGCIYPLLDYNSMDEVRCTHIFTPLMTDRLNSHPAYRRNIRLISESRFIG
                     IAFQYHPDRYIEHYQRLYHYIRSKELPVADHVYDLFTPTRYSQHKEEEFMVELKVQLL
                     "
     misc_feature    310647..310937
                     /locus_tag="DSY0279"
                     /note="Helix-Turn-Helix DNA binding domain of the BmrR
                     transcription regulator; Region: HTH_BmrR; cd01107"
                     /db_xref="CDD:133382"
     misc_feature    310647..>310931
                     /locus_tag="DSY0279"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    order(310650..310658,310698..310700,310752..310760)
                     /locus_tag="DSY0279"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133382"
     misc_feature    310761..310763
                     /locus_tag="DSY0279"
                     /note="drug binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:133382"
     misc_feature    order(310794..310796,310803..310805,310815..310820,
                     310845..310847,310881..310883,310893..310895,
                     310911..310913,310923..310925,310932..310937)
                     /locus_tag="DSY0279"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133382"
     gene            311581..312753
                     /locus_tag="DSY0280"
                     /db_xref="GeneID:3955071"
     CDS             311581..312753
                     /locus_tag="DSY0280"
                     /note="similarity to COG0477 Permeases of the major
                     facilitator superfamily(Evalue: 1E-142)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516513.1"
                     /db_xref="GI:89893026"
                     /db_xref="GeneID:3955071"
                     /translation="MNEQKTVLALLLMNIFIAFLGIGLVIPVLPTLMRELGVNGTVVG
                     YLTAAFAIAQLICSPFAGKAADKIGRKKVLVTGLFLFGFSEVLFGLGQEIEVLFLARI
                     LGGVSSALIMPAVTAFIADITTLETRPKALGYMSAAINTGFIIGPGIGGFLADFGTRT
                     PFFFAGALGAVAAILSIIFLKEPDRSNEAAEEEVPKLKTSIKRMLAPMYFIAFALILI
                     ASFGLSAFESFFALFVDGKFFFTPKEIAFVITAGALLGALIQVLLFERLARRWGEIKL
                     IRYSLILSGILIFLLTAVHSYVWILVVTTLAFIGFDLFRPAVTSYLSKIAGNEQGFVG
                     GMNSMFTSLGNIFGPIIGGMLFDVDIDYPFYFSVAVMILGVIITLFWKEPSRILQQ"
     misc_feature    311602..312726
                     /locus_tag="DSY0280"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    311611..312627
                     /locus_tag="DSY0280"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(311644..311646,311653..311661,311665..311670,
                     311719..311721,311728..311733,311740..311742,
                     311752..311757,311761..311766,311902..311907,
                     311914..311919,311926..311931,311938..311940,
                     311974..311979,311986..311991,312007..312009,
                     312238..312240,312247..312252,312259..312264,
                     312271..312273,312313..312315,312325..312327,
                     312337..312339,312346..312348,312358..312360,
                     312502..312504,312511..312516,312523..312525,
                     312535..312540,312547..312549,312577..312582,
                     312589..312594,312601..312606,312613..312615)
                     /locus_tag="DSY0280"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            312992..313909
                     /locus_tag="DSY0281"
                     /db_xref="GeneID:3955072"
     CDS             312992..313909
                     /locus_tag="DSY0281"
                     /note="similarity to COG0696 Phosphoglyceromutase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516514.1"
                     /db_xref="GI:89893027"
                     /db_xref="GeneID:3955072"
                     /translation="MMHFVMIFLDGFGLGGDRDNPIMAAHTPYIDELLGGHYLWGQER
                     RIESEQLILIPLDASLDVTGIPQSATGQTTLWTGVNGAKALGFHLNAYPNEKLAEIIK
                     EKSIFKQLADQGKKVTFANTFTSHYDEMIASGKRRHTASTLSALAGGVPLRRIEDLLQ
                     GKGVYQDMTNEILRELEQEADIPLITSYEAGKNLGRLALDYDFTLYEFFQTDVRGHKQ
                     DWEKAVALIEQIDGFIGGFMSVVRHEDVTWLLTSDHGNIEDFRVKGHTQNPVPALGWS
                     SKPLEWPQWERLEDVTPGIVRMILGTREL"
     misc_feature    313004..>313093
                     /locus_tag="DSY0281"
                     /note="BPG-independent PGAM N-terminus (iPGM_N); Region:
                     iPGM_N; cl17463"
                     /db_xref="CDD:266704"
     misc_feature    <313169..313825
                     /locus_tag="DSY0281"
                     /note="Phosphopentomutase [Carbohydrate transport and
                     metabolism]; Region: DeoB; cl17415"
                     /db_xref="CDD:247969"
     misc_feature    <313589..313900
                     /locus_tag="DSY0281"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            313911..316529
                     /locus_tag="DSY0282"
                     /db_xref="GeneID:3955073"
     CDS             313911..316529
                     /locus_tag="DSY0282"
                     /note="similarity to COG0826 Collagenase and related
                     proteases(Evalue: 5E-90)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516515.1"
                     /db_xref="GI:89893028"
                     /db_xref="GeneID:3955073"
                     /translation="MSHIKDAELSSMELLAPAGSYESFKAAVENGADAVYLGGKSFNA
                     RASAANFGLDELRQVVQYAHERETKVYVTVNILIADQEFPELYDYIYSLYEIGVDALI
                     LQDIGVGSMIRSVLPEMERHASTQMTINTTWGVRHVERLGFQRVVLAREVSVEQMKTI
                     SAKTALEIEVFVHGALCICYSGQCLMSSYIGGRSGNRGRCAQPCRLTYQLMNEERKDL
                     LAEANLGNHLLSPRDLNFVEEIHTLKECGVYSLKVEGRMKRPEYVATVTRIYRRALDH
                     VLSQENGVNAGSAVTGEEKTELLQIFNRDFSRAYFHSHPGAELMSYARPNNRGIRLGR
                     IVQNRGNQLEIKLEAYLRPGDGIEVWTSRGREGITVQKVWQGKRESEEGKPGDIVQIE
                     FAGKSHPGDRVFKTHDEQLMEKARQSFQEGKERRKRPLKMRLSGSIGELMALEAWDQD
                     KHVRVDSATPAQQAMKRPLTQEYAFQQLNRLGTTPFWLEELDLEVEEGLMLPVSELNE
                     MRRLVVEGLLHKSFQQEKVTRGEYKQRLKEWQNRLKLEQEEQVQQAQQHKEPLPGSHS
                     KAASLAARRLTVAVSDLEGVKAALKAGARRIALGGERWRSRKGMSWEDIRAGVRLCKE
                     QGANCLLRLPRILNEEQSAWWYEALLKVKAWEDRPWIMVANLGELEMVKDIDPDWPFE
                     VDYPVNIFNEAAVAHLFRLGAQGVTLSTELEHSQIEPLARWPKTEVFAFGELEMMVSE
                     YCPVGATLGGKKGTKCTAPCVKEPHYLRDRLNYDFPIETDLDCRMHLYNVKRLNLYKE
                     LGSIAKMGVQRIRLQLDRANPVQIRDTVRVFLEGWERALAGERISEEQAEKVNGYLAE
                     RFPEGFTKGHYFRGVL"
     misc_feature    313944..314981
                     /locus_tag="DSY0282"
                     /note="Collagenase and related proteases
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0826"
                     /db_xref="CDD:223896"
     misc_feature    313947..315083
                     /locus_tag="DSY0282"
                     /note="putative protease; Provisional; Region: PRK15452"
                     /db_xref="CDD:237969"
     misc_feature    315117..315470
                     /locus_tag="DSY0282"
                     /note="Collagenase; Region: DUF3656; pfam12392"
                     /db_xref="CDD:257020"
     misc_feature    315891..316517
                     /locus_tag="DSY0282"
                     /note="Peptidase family U32; Region: Peptidase_U32;
                     pfam01136"
                     /db_xref="CDD:250390"
     gene            316567..318936
                     /locus_tag="DSY0283"
                     /db_xref="GeneID:3955074"
     CDS             316567..318936
                     /locus_tag="DSY0283"
                     /note="similarity to COG1193 MutS-like ATPases involved in
                     mismatch repair, family 1(Evalue: 1E-176)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516516.1"
                     /db_xref="GI:89893029"
                     /db_xref="GeneID:3955074"
                     /translation="MVLNERVIRKLDFDKILERLANQCIMPRARELAEQLEPHSHLDL
                     VREALEETGEGKDILRINPLFSVRGAREIRPLVERCLKGGTLTTDELLQIRDTLKAAR
                     IVKQGLQEGKAEVPHLKGIMEQVILPKGIEEEITRCITEDGQVADQASSVLADLRRSI
                     SRLQTRIRETLDGIIRNPAYQKILQDPIVTQRSERYVVPVKQEYRQSFQGIVHDQSAS
                     GATLYIEPMAVVNLGNELREVVLKEQREVQRILLLLSARVEGEAEAIADAHEALARVD
                     FILAKARLSEEMNAGAPILTEKQEISLVQARHPLLTGKVVPLTIQLGTRFDTVVVTGP
                     NTGGKTVALKTIGLLAAMAQCGLHIPAESDSRVGVFTQIFADIGDEQSVEQSLSTFSG
                     HMKNIVEIVEKADWRSLILLDEVGAGTDPTEGSALAMAIIAELHERGARIVATTHYGA
                     LKNFAYNTTRVENASVEFDSETLRPTYRLLIGIPGKSNAFYIAGRLGLPEGVLDRART
                     FVTEREMQVADLIENLEDTQREIDLEKRRAREERQAIEKESLGLKEKSQKLEDDYQEL
                     MAKARDQATEIVREARREAERLIDELKLALKEERKDQQAIEKTRQGIRKLSNKVGDQD
                     TPLRTPHGVEPQEIKLGQMVYMTKLRQKGQVLKLPNDSGEVFVQAGVIKLNVPLSEIR
                     LIQEEKAAKPTRSVGGQGKVGMKKAETIRTEIDLRGMMVEEAGYELDKYLDDAVLTGV
                     GQVYVIHGKGTGALRQGIHEFLRGHHHVKSFRLGQHGEGDLGVTVVELK"
     misc_feature    316576..318933
                     /locus_tag="DSY0283"
                     /note="recombination and DNA strand exchange inhibitor
                     protein; Reviewed; Region: PRK00409"
                     /db_xref="CDD:234750"
     misc_feature    316624..317415
                     /locus_tag="DSY0283"
                     /note="MutS domain III; Region: MutS_III; pfam05192"
                     /db_xref="CDD:253074"
     misc_feature    317473..318060
                     /locus_tag="DSY0283"
                     /note="ATP-binding cassette domain of MutS2; Region:
                     ABC_MutS2; cd03280"
                     /db_xref="CDD:213247"
     misc_feature    317563..317586
                     /locus_tag="DSY0283"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213247"
     misc_feature    order(317572..317577,317581..317589,317698..317700,
                     317803..317808,317905..317907)
                     /locus_tag="DSY0283"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213247"
     misc_feature    317689..317700
                     /locus_tag="DSY0283"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213247"
     misc_feature    317713..317754
                     /locus_tag="DSY0283"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213247"
     misc_feature    317791..317808
                     /locus_tag="DSY0283"
                     /note="Walker B; other site"
                     /db_xref="CDD:213247"
     misc_feature    317815..317826
                     /locus_tag="DSY0283"
                     /note="D-loop; other site"
                     /db_xref="CDD:213247"
     misc_feature    317893..317913
                     /locus_tag="DSY0283"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213247"
     misc_feature    <318175..>318405
                     /locus_tag="DSY0283"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    318706..318933
                     /locus_tag="DSY0283"
                     /note="Smr domain; Region: Smr; pfam01713"
                     /db_xref="CDD:250812"
     gene            319028..319258
                     /locus_tag="DSY0284"
                     /db_xref="GeneID:3955075"
     CDS             319028..319258
                     /locus_tag="DSY0284"
                     /note="similarity to COG1826 Sec-independent protein
                     secretion pathway components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516517.1"
                     /db_xref="GI:89893030"
                     /db_xref="GeneID:3955075"
                     /translation="MITPTVAVIALVIALILFGPGKLPELGKGLGKGIKEFKDATDLS
                     DDDGKKKKKEIAESKKEEPAESKKEEPVESKE"
     misc_feature    319049..319168
                     /locus_tag="DSY0284"
                     /note="mttA/Hcf106 family; Region: MttA_Hcf106; cl00788"
                     /db_xref="CDD:260623"
     gene            319711..321282
                     /locus_tag="DSY0285"
                     /db_xref="GeneID:3955076"
     CDS             319711..321282
                     /locus_tag="DSY0285"
                     /note="similarity to COG1053 Succinate
                     dehydrogenase/fumarate reductase, flavoprotein
                     subunits(Evalue: 3E-24)"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="YP_516518.1"
                     /db_xref="GI:89893031"
                     /db_xref="GeneID:3955076"
                     /translation="MTINRRDFIKRAAAGAAVVAGSSFLVGCNNTEAVAPASAPEAWD
                     QETDVVVVGGGNGGLSAAAAAVEEGKKVILCEISAFLGGGSAYSGGTIHSWGLDTWEK
                     YKEHTEDLHDPVLAKKYVETFRQVYLPWLEKNGIPLKKHPGGKGFNNDYGLGSGEAGY
                     LRHKAYFDALANFVTGKGGTIMTQTRVLRLVIDEAGMVCGVQAIKKGESKAIFIKAGS
                     VILATGGFQSNKGLMAKYIGPNGDVARNMGTPYNTGSGMLMAQGVGAMTQGSFSTFSG
                     TFSGIVPGPAVEDEPELYEEKRAGDPQSLPGIGGGRPAVPMWVNFLFPDETTGILVNL
                     QGKRFADETSPIEAKYARLPQEVLKQKRAMAFMIGDKAIYDKAAGSEAILKMYMDQGG
                     KVVEAATLEELAAKCQEIHGMHKGAFLKTVNEYNKAIDSGTTDSLEVPRVLNHNKIAQ
                     GPFYAVPVTANIYHTFGGVAINENAQVLDVQRTPIPNLYACPPCAGIFREVYTGGIAS
                     AGTFGYIAGKHIAGK"
     misc_feature    319885..321273
                     /locus_tag="DSY0285"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    319885..321273
                     /locus_tag="DSY0285"
                     /note="tricarballylate dehydrogenase; Validated; Region:
                     PRK08274"
                     /db_xref="CDD:236214"
     gene            321537..323510
                     /locus_tag="DSY0286"
                     /db_xref="GeneID:3955077"
     CDS             321537..323510
                     /locus_tag="DSY0286"
                     /note="similarity to COG3829 Transcriptional regulator
                     containing PAS, AAA-type ATPase, and DNA-binding
                     domains(Evalue: 2E-68)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516519.1"
                     /db_xref="GI:89893032"
                     /db_xref="GeneID:3955077"
                     /translation="MQRISQGTEKAYLEKCRDQRELFMEGKPVDPGIVPKVVYNSWVR
                     SQRYGVDPFEKPCHHPIDKSKSKELSRFIECLERYNFFIKQALELIDYQGFTFTFSAK
                     ESLTKHIYDDLGSPFANLIGECSERTVGTNATAIALAENVPVALVSSLSYQYWPAENG
                     VNTAAPIHNHQGEVMGGIHIGLKDIKRTQDAFWLVTYLAQVFDRLYLPMTQKHEKKIK
                     DIIDLLPQGVAYINNKKSIHYNEKFQTLVNLSKGKNSLKKVSEFFSQEDWTSIFACQE
                     IKADGKTLIINSNSLDYEDFETSKIFIVEEKQSLTQRLQENSQGSKTTVGLYSFDDIV
                     GNNAELNEAKSIGLNVAGTSVPVLIFGENGTGKEMFAQAIHAASPRREKPFIAINCGA
                     IPAELVESELFGYEEGSFTGALKGGKIGKIEAASGGTLFLDEIESMPVQDQIKLLRVI
                     STGKVQKVGSTKEIPVDIRLISATKKDLLEESDKGLFREDLYFRISTFIIELPALRQR
                     REDILLLTKEFISKFSRKYGLEQTVEMAQEFVEALENYSWRGNVRELEHSIERAIILM
                     GAGLTLKVDYLSKRIQESYQNYQVKGLVEDVLAKGLKKQEQGLLYTAEAMIIDHVLKS
                     VGGNVTAAAEKLGVTRKTIYNKLQEHPDLRVVK"
     misc_feature    321585..323486
                     /locus_tag="DSY0286"
                     /note="Transcriptional activator of acetoin/glycerol
                     metabolism [Secondary metabolites biosynthesis, transport,
                     and catabolism / Transcription]; Region: AcoR; COG3284"
                     /db_xref="CDD:225822"
     misc_feature    322536..323033
                     /locus_tag="DSY0286"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    322617..322640
                     /locus_tag="DSY0286"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(322620..322643,322833..322835,322959..322961)
                     /locus_tag="DSY0286"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    322821..322838
                     /locus_tag="DSY0286"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    323016..323018
                     /locus_tag="DSY0286"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    <323136..323477
                     /locus_tag="DSY0286"
                     /note="Protein of unknown function (DUF3150); Region:
                     DUF3150; pfam11348"
                     /db_xref="CDD:151789"
     misc_feature    323376..323486
                     /locus_tag="DSY0286"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            323618..324004
                     /locus_tag="DSY0287"
                     /db_xref="GeneID:3955078"
     CDS             323618..324004
                     /locus_tag="DSY0287"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516520.1"
                     /db_xref="GI:89893033"
                     /db_xref="GeneID:3955078"
                     /translation="MSKKGRFLLMFALFLSLSVGLFLSSAANTNAYPDLSPDGKTCTP
                     CHEEGTHGGEETPAETPGETPGETPAETPGETPAEQPAETPAEKPAETPAEQPAETHE
                     PMSPWIVVGGVIVILAVIYFLAIKKK"
     misc_feature    <323756..>323932
                     /locus_tag="DSY0287"
                     /note="Predicted coiled-coil domain-containing protein
                     (DUF2360); Region: DUF2360; pfam10152"
                     /db_xref="CDD:255793"
     gene            complement(324134..326776)
                     /locus_tag="DSY0288"
                     /db_xref="GeneID:3955079"
     CDS             complement(324134..326776)
                     /locus_tag="DSY0288"
                     /note="similarity to COG0744 Membrane carboxypeptidase
                     (penicillin-binding protein)(Evalue: 1E-114)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516521.1"
                     /db_xref="GI:89893034"
                     /db_xref="GeneID:3955079"
                     /translation="MASPPKRTPSKRPRKKKRVSKLRVFLVSFGSVFTLACIALLIYV
                     LYVVAGTPDWHPDTLTNQKQTSFVYDMDGNQIAELHAAENRQMVDSSEIPQLVKDTFV
                     AVEDKRFNDHFGVDPIRIVGSFIADLKSQSWKEGASTITMQLANNAFIENPREKTLVR
                     KLQQAALAIQLEREYTKDEILTFYLNRIFFGESSFGIQAAAKTYFGKDLKALNPDEIA
                     LLAGLPQAPSGYNPYYHPEEAKKRRTIVLGVMKDSGLITADEYDQYKDAPFEHVENVK
                     ANRAESEKPVVAGTNYQYPYFVDHVIEELINEHGLTEDQIFNGGLRIYTTVDTKIQAA
                     AEKEFANAANFPQSVDETLVQGAMTVLDPKTGAIRALVGGRDHNTARGFNRATRASRQ
                     PGSTVKPLVVYAPALEKGGFFPGTVLDDMPVKYNAGNGQVWAPVNYDTEYAGWRGLIT
                     MRFAVQNSVNVYAVKLMNLVGIEYSWNFAKNSLGLPLEEGDKVLSLALGTNQMSTLDM
                     ASAYGVFANNGVRVAPHAIEKVQDANGKEVLVPQVTKERTMKETTAYLMNSMLRSVVT
                     GGTGTRAQIGNWAVAGKTGTTSLDPDIYGYRTGNPDAWFAGYTPEYVGVVWMGYDKDD
                     ETLTHYLHKVYGGQYPAQIWKNVMTAAHEGLTVQTEFQQPSGIVGGDFDTKSGLIPSS
                     LTPKDFIRREIAAQGDFPTRVSDVWVEKEIDKDHPEYLAGTGTVNKEKKVFLNITGRD
                     SETPWPSDEQPYKMPEKEYNETPPPNETTSPPAGDPSIPIPTLGAVAYDAAQSSVTIP
                     VAYPEGSEGLHLIVYVKFPDHDFVQPFSPDAQPGGSNQIHIPLSIEGEPISPGNYSFW
                     ACLQSPETGATGNPSPVAVLTITD"
     misc_feature    complement(326024..326563)
                     /locus_tag="DSY0288"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     misc_feature    complement(324815..326527)
                     /locus_tag="DSY0288"
                     /note="penicillin-binding protein, 1A family; Region:
                     PBP_1a_fam; TIGR02074"
                     /db_xref="CDD:233710"
     misc_feature    complement(324833..325711)
                     /locus_tag="DSY0288"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; pfam00905"
                     /db_xref="CDD:250215"
     gene            327061..328323
                     /locus_tag="DSY0289"
                     /db_xref="GeneID:3955080"
     CDS             327061..328323
                     /locus_tag="DSY0289"
                     /note="similarity to COG0162 Tyrosyl-tRNA
                     synthetase(Evalue: 1E-154)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516522.1"
                     /db_xref="GI:89893035"
                     /db_xref="GeneID:3955080"
                     /translation="MNILDDLKARGLVYQTTDEEALYKRLESPMTLYCGFDPTADSLH
                     IGHLLPVLMLRRFQLAGHCPIALVGGGTGLIGDPSGKTSERTLNPTEVVQEWANRIKE
                     QLSCFLDFEGVGNPAIMANNYEWLGTINVIEFLRDIGKNFSLGSMLAKESVESRMSRG
                     ISFTEFSYQILQSYDFLKLNELYGCEMQIGGSDQWGNITSGTDLIRRMSVGEDRQVHG
                     LTVPLVTKSDGTKFGKTEGGAVWLDQDKTSPYKFYQFWINTDDRDVVKYLNFFTFLSI
                     EEIQGLAQEVESQPEKRNAQRMLAKEVTELVHGVEARERAEKISQALFTGGIANLTAK
                     EVEEGFSDVPSADVEDQEMLLVDALIKVGAVSSRRQARESMESGAVYVNGIRQTDTTL
                     TVAQLDKIESRFIVIRRGKKNYYLVKLV"
     misc_feature    327061..328317
                     /locus_tag="DSY0289"
                     /note="tyrosyl-tRNA synthetase; Validated; Region:
                     PRK05912"
                     /db_xref="CDD:235645"
     misc_feature    327151..327978
                     /locus_tag="DSY0289"
                     /note="catalytic core domain of tyrosinyl-tRNA and
                     tryptophanyl-tRNA synthetase; Region: Tyr_Trp_RS_core;
                     cd00395"
                     /db_xref="CDD:173893"
     misc_feature    order(327157..327171,327190..327192,327196..327201,
                     327208..327213,327259..327261,327274..327276,
                     327424..327426,327562..327564,327574..327576,
                     327583..327585,327622..327624,327628..327633,
                     327637..327642,327649..327651,327727..327729,
                     327751..327756,327760..327762)
                     /locus_tag="DSY0289"
                     /note="active site"
                     /db_xref="CDD:173893"
     misc_feature    327190..327201
                     /locus_tag="DSY0289"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173893"
     misc_feature    order(327271..327273,327280..327285,327451..327456,
                     327460..327468,327475..327480,327484..327495,
                     327499..327504,327550..327552,327556..327561,
                     327568..327573)
                     /locus_tag="DSY0289"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173893"
     misc_feature    327751..327765
                     /locus_tag="DSY0289"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173893"
     misc_feature    328123..328314
                     /locus_tag="DSY0289"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(328156..328161,328165..328170,328174..328179,
                     328186..328191,328195..328197,328216..328239,
                     328243..328245)
                     /locus_tag="DSY0289"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            328920..330587
                     /locus_tag="DSY_16SrRNA2"
                     /db_xref="GeneID:3957998"
     rRNA            join(328920..329056,329094..330587)
                     /locus_tag="DSY_16SrRNA2"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:3957998"
     gene            331109..333611
                     /locus_tag="DSY_23SrRNA2"
                     /db_xref="GeneID:3958004"
     rRNA            331109..333611
                     /locus_tag="DSY_23SrRNA2"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:3958004"
     gene            333997..334036
                     /locus_tag="DSY_5SrRNA2"
                     /db_xref="GeneID:3958010"
     rRNA            333997..334036
                     /locus_tag="DSY_5SrRNA2"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:3958010"
     gene            334904..335725
                     /locus_tag="DSY0290"
                     /db_xref="GeneID:3955081"
     CDS             334904..335725
                     /locus_tag="DSY0290"
                     /note="similarity to COG2207 AraC-type DNA-binding
                     domain-containing proteins(Evalue: 5E-50)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516523.1"
                     /db_xref="GI:89893036"
                     /db_xref="GeneID:3955081"
                     /translation="MEFELNELVERFTNISIRVEGVYNYKIDPGTAGWQKAAPFPGFI
                     FPLRGKAQYRFDGTPYTASIGRVVHGGASMGLDKQVLGDTKWEYISVLYDIRTSETKG
                     ICLPEVHFELTPGNSPRLQELLGRLYRTFNQPGSIPAFQAENLFRCVLEEVFVCARNQ
                     TNHGAQVLFEQVSSYIQDHFMDSLTVHGLAEQNEVTENRLFYVFSKYAGMGPGDYLIA
                     CRLNRAKELLTTIGAPISEVAKSIGYSDPLYFSRSFRKRFKMSPSEFREKFRNNP"
     misc_feature    335375..335722
                     /locus_tag="DSY0290"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    <335603..335701
                     /locus_tag="DSY0290"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            335817..336827
                     /locus_tag="DSY0291"
                     /db_xref="GeneID:3955082"
     CDS             335817..336827
                     /locus_tag="DSY0291"
                     /note="similarity to COG0614 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, periplasmic
                     components(Evalue: 2E-30)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516524.1"
                     /db_xref="GI:89893037"
                     /db_xref="GeneID:3955082"
                     /translation="MEEGKKMKRIIGMIVSLALLAGLLAGCSTSATGSNINTPAAQAE
                     KTPGAGGSGAEEAAWPRTIVDATGKEITLTEQPQRIAILHSLYLEYFLALGTPPIASA
                     GASTGDAMKALGEWETLKPYAGTAKIIDLGSARDLNLEAILGANPDVIVTFKGQGNLD
                     KIYEQLEQIAPVILVDFSAPWQEQILACAEIVNKEADAQKLIKEIEDSVQSAKEKLSR
                     HQDKTIAIFRTDGGKAFVTRGNKDYYDTFGIAKPEGYPDDYETLSLEAVAEMNPDYII
                     FQDFITTSQAFVKTQEASSVWQAMEAVKKGQVVYFDDSLNTFGPLATKLTAEKLIQII
                     SD"
     misc_feature    336039..336773
                     /locus_tag="DSY0291"
                     /note="Fe3+-siderophore binding domain FhuD.  These
                     proteins have been shown to function as initial receptors
                     in ABC transport of Fe3+-siderophores in many eubacterial
                     species. They belong to the TroA-like superfamily of
                     helical backbone metal receptor proteins...; Region: FhuD;
                     cd01146"
                     /db_xref="CDD:238566"
     misc_feature    336054..336761
                     /locus_tag="DSY0291"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    order(336144..336146,336216..336221,336282..336284,
                     336522..336524)
                     /locus_tag="DSY0291"
                     /note="siderophore binding site; other site"
                     /db_xref="CDD:238566"
     gene            337045..337545
                     /locus_tag="DSY0292"
                     /db_xref="GeneID:3955083"
     CDS             337045..337545
                     /locus_tag="DSY0292"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516525.1"
                     /db_xref="GI:89893038"
                     /db_xref="GeneID:3955083"
                     /translation="MSSSKNNNVIDFQQYKEKRELQRAIPSAETSLENDFQGKLRLTQ
                     EDAEMIIYCMRLGREYFMIEVEKTPDEGGQAQRDFETVNSLLDRIQYEVLKLQTEEGY
                     IVGLSILELAFIIDCVEMTRNAVGKGINVFQSEPGDKEDYAKWLDGTFFYLLDVYEKW
                     RFYQGH"
     gene            complement(337571..338374)
                     /locus_tag="DSY0293"
                     /db_xref="GeneID:3955084"
     CDS             complement(337571..338374)
                     /locus_tag="DSY0293"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516526.1"
                     /db_xref="GI:89893039"
                     /db_xref="GeneID:3955084"
                     /translation="MQNLIVLGTGHALVTQCYNTCFALADDDDYILIDGGGGNGILSQ
                     LQKAKIPYAKIHHAFVSHGHTDHLLGMVWVIRMIGSAMAAGKYEGDFKLYCHDELASA
                     LHALVKITMDKQIIDLISRRIHIISVADGQQEELLGHTFTFFDLHSAKAKQFGFKIHL
                     DCDKKLAFIGDEPYHPLCQKYVENSDWLLCEAFCLYAERELFKPYEKNHSTVKDSCQL
                     ATLLNIKNLILWHTEDKNIGKRKALYTAEGKQYYKGNLFVPDDFDVIAL"
     misc_feature    complement(337574..338374)
                     /locus_tag="DSY0293"
                     /note="Metal-dependent hydrolases of the beta-lactamase
                     superfamily III [General function prediction only];
                     Region: ElaC; COG1234"
                     /db_xref="CDD:224155"
     gene            338629..339420
                     /locus_tag="DSY0294"
                     /db_xref="GeneID:3955085"
     CDS             338629..339420
                     /locus_tag="DSY0294"
                     /note="With Mot B forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="YP_516527.1"
                     /db_xref="GI:89893040"
                     /db_xref="GeneID:3955085"
                     /translation="MELSTLIGLLLGFIAVGVGMILKGASLTALINPAAILIIIVGTI
                     ATIFIGFPMEDLKRVPKLFKILFTKQQLISKKELVKQFAEWTTVSRREGILSLENRLE
                     EINDDFLKKGMGMAIDGNDAEFIRDVLFEDISAMEERHRDGALVFTQMGTYAPTLGVL
                     GAVVGLISALSNLNEVEALGHLISAAFVATLLGIFTGYVLWHPMANKLKLFSRREAEI
                     KRMMLEGILSIQAGDNVNAIHNKLFAYLSAAERRELTEEMGNEKA"
     misc_feature    338629..339414
                     /locus_tag="DSY0294"
                     /note="flagellar motor protein MotA; Validated; Region:
                     PRK08124"
                     /db_xref="CDD:181238"
     gene            339407..340201
                     /locus_tag="DSY0295"
                     /db_xref="GeneID:3955086"
     CDS             339407..340201
                     /locus_tag="DSY0295"
                     /note="similarity to COG1360 Flagellar motor
                     protein(Evalue: 2E-57)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516528.1"
                     /db_xref="GI:89893041"
                     /db_xref="GeneID:3955086"
                     /translation="MKKHKKEHHEDHMDETWLVPYSDILTLLLALFIILFAAGQIDQK
                     KYERIMAGFNSAFTGGTSVFESTSELNIDITDDNMGKNNDPVTTETDSLLAAARARED
                     RDMSDMKAKIDQYIKENNLSAQLETRITEEMLMISIRDYALFDSGSALVKTEAQKLAY
                     IISDILRQYPGYNVEVAGHTDNLPINTAEFPTNWDLSSRRSLNFMKYLLQSDGLDQSR
                     FRSIGYGEFQPIATNTTEEGRAKNRRVEVNILRNFGQPTSIFSSER"
     misc_feature    339407..340156
                     /locus_tag="DSY0295"
                     /note="flagellar motor protein MotB; Reviewed; Region:
                     motB; PRK07734"
                     /db_xref="CDD:236080"
     misc_feature    339833..340153
                     /locus_tag="DSY0295"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(339842..339847,339944..339949,339968..339970,
                     339980..339985,339992..339994,340121..340123,
                     340133..340135)
                     /locus_tag="DSY0295"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            340548..342215
                     /locus_tag="DSY_16SrRNA3"
                     /db_xref="GeneID:3957999"
     rRNA            join(340548..340684,340722..342215)
                     /locus_tag="DSY_16SrRNA3"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:3957999"
     gene            342446..342521
                     /locus_tag="DSY_tRNA13-Ala"
                     /db_xref="GeneID:3958019"
     tRNA            342446..342521
                     /locus_tag="DSY_tRNA13-Ala"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3958019"
     gene            342812..345314
                     /locus_tag="DSY_23SrRNA3"
                     /db_xref="GeneID:3958005"
     rRNA            342812..345314
                     /locus_tag="DSY_23SrRNA3"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:3958005"
     gene            345701..345740
                     /locus_tag="DSY_5SrRNA3"
                     /db_xref="GeneID:3958011"
     rRNA            345701..345740
                     /locus_tag="DSY_5SrRNA3"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:3958011"
     gene            346059..346835
                     /locus_tag="DSY0296"
                     /db_xref="GeneID:3955087"
     CDS             346059..346835
                     /locus_tag="DSY0296"
                     /note="similarity to COG0730 Predicted permeases(Evalue:
                     5E-25)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516529.1"
                     /db_xref="GI:89893042"
                     /db_xref="GeneID:3955087"
                     /translation="MNIFMGLAIGLLSGFFGGLVGLGGGIIMIPLMVGLLKINQHMAH
                     GTSLVGVVFTGISGAITYSLSGSIELVPALLLASTAMITARLGARYATSLPEWKLKRS
                     FGYFLIFVTIVFLLKPYLGEFSLSSTVWIKTIILLGIGAFAGFLSGMMGVGGGSIMVP
                     AMVIFAGMGQQMAQGISLLAMIPASAIGAFTHNRNGNVHTKILPGLVVGILPGTFLGG
                     SLAHILPEVALRIIFAIVVVYTAIKNIRAKKPETAMEPST"
     misc_feature    346134..346787
                     /locus_tag="DSY0296"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            346832..347587
                     /locus_tag="DSY0297"
                     /db_xref="GeneID:3955088"
     CDS             346832..347587
                     /locus_tag="DSY0297"
                     /note="similarity to COG3022 Uncharacterized BCR(Evalue:
                     7E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516530.1"
                     /db_xref="GI:89893043"
                     /db_xref="GeneID:3955088"
                     /translation="MKIIISPAKKMNMDGDFLSPRNIPVYLEKAKKLQRHLQSLPYEE
                     LRKLLCCNDEIAGLNYERYQTMDLSGYTSPAILAYDGIQYKYMAPQVFEDDYFDYIEK
                     HLRILSGFYGILKPFDGVVPYRLEMQAKLKTDFCRNLYDYWQDDIYRELTQEDTTILN
                     LASAEYSKTIEKYLTAGINYVKCVFGELRDGRVIEKGVYVKMARGEMVRFMAEKAIKD
                     LEQIKEFNRLGFRYREQLSDNNTFVFVKAMAEK"
     misc_feature    346832..347578
                     /locus_tag="DSY0297"
                     /note="hypothetical protein; Validated; Region: PRK02101"
                     /db_xref="CDD:234999"
     gene            347622..348521
                     /locus_tag="DSY0298"
                     /db_xref="GeneID:3955089"
     CDS             347622..348521
                     /locus_tag="DSY0298"
                     /note="similarity to COG1670 Acetyltransferases, including
                     N-acetylases of ribosomal proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516531.1"
                     /db_xref="GI:89893044"
                     /db_xref="GeneID:3955089"
                     /translation="MINSLADPSINLRESLDAKSYTHINNLQRLCLEHDRTNLKLELD
                     YKLSRAEGKPGSLKTINEFMCYEGELLIGYMGICDFGGEEIEVNGMVHPDYRKKGIFK
                     TLFSFAKNEWSKRRASRMLLLSDRDSLTGQAFIKRVSGVKYKHTEYEMFLQSDTKQEL
                     NSCKVVLRKATGNDTREIARQNFIYFEQESQDENMLIPEEEARAGMIIYMAEVNNCVI
                     GKVHLDISSNVGGIYGLGVLPEYRRKGYGRDILTLGIKELKSNNFQEIMLQVNVKNEK
                     ALDLYRSCGFEVTSTMDYYELKK"
     misc_feature    347808..347987
                     /locus_tag="DSY0298"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(347889..347891,347892..347894,347922..347927)
                     /locus_tag="DSY0298"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    <348159..348509
                     /locus_tag="DSY0298"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    348243..348425
                     /locus_tag="DSY0298"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(348324..348332,348360..348365)
                     /locus_tag="DSY0298"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            348619..348975
                     /locus_tag="DSY0299"
                     /db_xref="GeneID:3955090"
     CDS             348619..348975
                     /locus_tag="DSY0299"
                     /note="similarity to COG0526 Thiol-disulfide isomerase and
                     thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516532.1"
                     /db_xref="GI:89893045"
                     /db_xref="GeneID:3955090"
                     /translation="MILIVRGVKIPMALKQLDSNSFEEIIYDNGEACLVLFSRKSCHV
                     CKEVGPMVEDLAPKYSGKFGFYYVDVEENMTLFQRFSLKGVPQILFFKDGEYQGKLSG
                     NVEEEVLEEKIAEIQA"
     misc_feature    348679..348960
                     /locus_tag="DSY0299"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(348742..348744,348751..348753)
                     /locus_tag="DSY0299"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            complement(349076..349528)
                     /locus_tag="DSY0300"
                     /db_xref="GeneID:3956963"
     CDS             complement(349076..349528)
                     /locus_tag="DSY0300"
                     /note="similarity to COG1395 Predicted transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516533.1"
                     /db_xref="GI:89893046"
                     /db_xref="GeneID:3956963"
                     /translation="MDKEKAIKLVSSKIKLIRVENGYSQDRMADIIGISKKTLVQIEK
                     GRDYASWGVVVATCAMFRESEIMQSIFGDDPLEVLRTIAHERIDSPKEKTMGGKIWWA
                     DVHKEGLFRLQQNLISKHYRILDDDGYRWFSSFDKEEALTRLFELSSS"
     misc_feature    complement(<349391..349501)
                     /locus_tag="DSY0300"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(349337..349498)
                     /locus_tag="DSY0300"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(349397..349399,349472..349474,
                     349484..349486))
                     /locus_tag="DSY0300"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(349400..349402,349475..349477))
                     /locus_tag="DSY0300"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(349394..349399,349409..349411,
                     349418..349420,349451..349456))
                     /locus_tag="DSY0300"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(349121..349396)
                     /locus_tag="DSY0300"
                     /note="H3TH domains of structure-specific 5' nucleases (or
                     flap endonuclease-1-like) involved in DNA replication,
                     repair, and recombination; Region:
                     H3TH_StructSpec-5'-nucleases; cl14815"
                     /db_xref="CDD:265460"
     misc_feature    complement(order(349337..349339,349352..349360,
                     349388..349390,349394..349396))
                     /locus_tag="DSY0300"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:188616"
     misc_feature    complement(349388..349390)
                     /locus_tag="DSY0300"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:188616"
     gene            349667..350272
                     /locus_tag="DSY0301"
                     /db_xref="GeneID:3956964"
     CDS             349667..350272
                     /locus_tag="DSY0301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516534.1"
                     /db_xref="GI:89893047"
                     /db_xref="GeneID:3956964"
                     /translation="MDMGKKRKIIIPAAVGLGLLIAGFAYLMQIRGEFKDYLSEKYPE
                     QTFQVGFIKIDPIYGSYFTTASCLNDDVSFPIRKSFRTENINESYLQTKSHNQYNAYI
                     KEVFNESGIKNHIISVTGGGKDHYQNDGHYDQINLYLTEEADLISVTKTALNLLREKG
                     VQADTVILTQEKDGHVYELYGSTADYALTEDQLREKIRKIK"
     gene            350481..351143
                     /locus_tag="DSY0302"
                     /db_xref="GeneID:3956965"
     CDS             350481..351143
                     /locus_tag="DSY0302"
                     /note="similarity to COG2206 HD-GYP domain(Evalue: 1E-38)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516535.1"
                     /db_xref="GI:89893048"
                     /db_xref="GeneID:3956965"
                     /translation="MLYRLMKRFSDYNILHDVIDCLTASLEAKDNYTSGHSNRVGDMA
                     FDICKSLKLSIVERDRIHIAAHLHDIGKIGIPDHILNKPGRLSPAEWAQIQGHPEIGY
                     TILSKSRKLKDIGQIVLSHHERWDGKGYPHGLKGEEIPLGARIIGVCDSIDAMTSDRA
                     YRKAFTWAECKAEIIANKGSQFDPEVVEAITDSLWSKWQMEYCKERERERSLGQGIQS
                     AT"
     misc_feature    <350556..351128
                     /locus_tag="DSY0302"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    350574..351005
                     /locus_tag="DSY0302"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(350586..350588,350682..350687,350928..350930)
                     /locus_tag="DSY0302"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    350685..350687
                     /locus_tag="DSY0302"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            351315..351764
                     /locus_tag="DSY0303"
                     /db_xref="GeneID:3956966"
     CDS             351315..351764
                     /locus_tag="DSY0303"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516536.1"
                     /db_xref="GI:89893049"
                     /db_xref="GeneID:3956966"
                     /translation="MDINYAIKEVIRHHRQAVQKSAWEFIDVDTLYTLRDIAITVEDE
                     KFHVVGDSDKYYVMVRKSSMDNDVIMFGRVDGGNLEKTLARDIPKVGLAILAIRHIED
                     DHYIDDLLSARREELLDQLILCFGSERFNLADGTSFTLQELKQAVSH"
     gene            complement(352064..353533)
                     /locus_tag="DSY0304"
                     /db_xref="GeneID:3956967"
     CDS             complement(352064..353533)
                     /locus_tag="DSY0304"
                     /note="similarity to COG2855 Uncharacterized membrane
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516537.1"
                     /db_xref="GI:89893050"
                     /db_xref="GeneID:3956967"
                     /translation="MSTNTYARKKALQNEDWWAAWLGLFIFALGLGPYFGADLLGWVT
                     KASVWIEPAKAFAPVSKATGLNGFTSLLVTFLFVLAITTVAAKFVGSNLKKYAIGFSI
                     IFWVTMGCLMLGNIAYIGATPDKTASYGIGWSLGLGEMGYIIAMVVGLIIGNFFIKQA
                     DFLKEAAKPELFIKIGIVVLGASIAIKTLDAFGLATTIIIRGLCAVVEAYLIYWPVVY
                     LIARKFFKFTPEWAAPLASGISICGVSAAIATGSAIRARPVIPVILSAVIIVFVALEL
                     LLLPWLAQAFLFKDPMVAGAWMGLAVKSDGGAIASGAITDSLIRGRALRELGINWEEG
                     WILMVATTTKVFIDIFIGVWAFILAIIWSVFPIDKNASANPGERNKVSAVDIWDRFPK
                     FIIGFVLTFLILFLVGVNNPDGVKALSTGVNEGNAFRTIFFGLCFFSIGLVTNVRKLW
                     AEGMGRIVAIYGIALFGFILWFGLFISWLFYHGITPPTV"
     misc_feature    complement(352187..353107)
                     /locus_tag="DSY0304"
                     /note="Conserved hypothetical protein 698; Region:
                     Cons_hypoth698; cl01075"
                     /db_xref="CDD:260777"
     gene            354352..355251
                     /locus_tag="DSY0305"
                     /db_xref="GeneID:3956968"
     CDS             354352..355251
                     /locus_tag="DSY0305"
                     /note="similarity to COG2181 Nitrate reductase gamma
                     subunit(Evalue: 2E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516538.1"
                     /db_xref="GI:89893051"
                     /db_xref="GeneID:3956968"
                     /translation="MFLVFYAILAMFLFLALSAYKAYEYTKMPMHGRLDLYPVPKEKG
                     HEHGGSYYEQAEWWAKPHETSTASEIVDMLKEILFIKKLFQNQKSLWWLSYSLHLGIY
                     FIIAWTVILVAAAATQLAGGTVAADGGLWGILLYYATPLVGWVGFFLASFGAVSLLVR
                     RVADPILKKYTTPQEYFNLLLLFVVTLTGVLVWSSDITMSNARDAMANVLSFQPLNGE
                     PLLTVHIILAGIMLIYIPISKMSHYVGKFFSFHMVIWDNDPNVAGSKVEEKIRQAAQY
                     RPQNKWSAPHIAGAPAPTEKSPK"
     misc_feature    354505..355200
                     /locus_tag="DSY0305"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; cl00959"
                     /db_xref="CDD:260721"
     gene            355285..356898
                     /locus_tag="DSY0306"
                     /db_xref="GeneID:3956969"
     CDS             355285..356898
                     /locus_tag="DSY0306"
                     /note="similarity to COG0247 Fe-S oxidoreductases(Evalue:
                     0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516539.1"
                     /db_xref="GI:89893052"
                     /db_xref="GeneID:3956969"
                     /translation="MINHKDLKPSDLNRPDEQLVKVEELMPLPRPYDKPGMEPDFMEV
                     KPAWREKYCTSLDGFVAIDTLTRPKSKEEEEEFVRKFLSGLEKLFTDANNGMRQPLML
                     SFEYCAKCDTCSNACHIYEGSGNNELYRPIFRVEALRKIYKKYFTTSGKLLGGLVGAD
                     LEATWESIARLGESAYRCNLCRRCAQTCPLGLDNGIMAKEIRKIFSMEMGIAPSPIHK
                     KGTENQLKTGSSTGLTKPAFLDIVEFLEEEMDEKFGLKIKFPIDKKGADILLMHNAGE
                     YRAWPENPIAFAILFEAAGIDWTISSEMMGYDSVNYGIWYDDAQAKKIALAQMKVAKD
                     LGVRRVVQGECGHAHKAAAVSADRMAPGSDKVPVESFFPLLRDIVKSGAIKFDPSRNN
                     FPVTLHDPCNVVRQMGIVMPQREVLHQLAPQFREMTPHGVDNYCCGGGSGFAIMHSQN
                     FGDFLKKISARKKFAQILNAFQDTIEDPQIVKYICAPCSNCKGTMRDILEYYEATDKF
                     NVQYGGLIELVVNAMADLKRPFFEFLEEE"
     misc_feature    355576..356808
                     /locus_tag="DSY0306"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    355591..355860
                     /locus_tag="DSY0306"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    356467..356772
                     /locus_tag="DSY0306"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            356945..358639
                     /locus_tag="DSY0307"
                     /db_xref="GeneID:3956970"
     CDS             356945..358639
                     /locus_tag="DSY0307"
                     /note="similarity to COG0446 Uncharacterized
                     NAD(FAD)-dependent dehydrogenases(Evalue: 1E-105)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516540.1"
                     /db_xref="GI:89893053"
                     /db_xref="GeneID:3956970"
                     /translation="MKVVIIGGVATGPKVAARLRRLSIDAEITVVEKGKIVSYGSCGL
                     PLFLGNLVPKIEDLMKTSAGLIRDTQYFEDTKGINVLTQTEALAIDRQQKKVRVRNLA
                     TGEERDLDYDHLVLATGAKEVVPPIPGIQYQNVYTLHSLDDAVNIKALIKEKKIQHAT
                     IIGAGLIGIEVADAIAGPRLKVTLFESQGSVVPKLLDPDMALLVEHKMRSRGIDLRLN
                     CPVKELTGDEDGKVNGVILENESITTGLVIVAVGVRPEVTLARQAGLTLGITGAIQVN
                     QYMQTDDTYIYAGGDCAEQVNMLSGRQVFVPLASTANKQGRVIADNIAGRASEFPAIC
                     ATSVFQAFELNVGRTGLGEPEARELGYDVITSLSTGLDAVHYYPVHGAVTIKLIAERT
                     SGRLLGAQVCGTGEAIKRLDVLITILRFNGTVKDISNLDLSYAPPFATAIDVLIHAAN
                     TLENKQLGIVDTVNPFELLERLKKDKSIIFVDVREGDETRANPVEGSQIIVIPLGELR
                     KRYTEIPQGSPVVTFCELGIRGYDAACFLKGVGFQDVSFLEGGMSTWGALQPALNM"
     misc_feature    356945..358294
                     /locus_tag="DSY0307"
                     /note="coenzyme A disulfide reductase; Reviewed; Region:
                     PRK09564"
                     /db_xref="CDD:181958"
     misc_feature    356954..357499
                     /locus_tag="DSY0307"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    357128..>357289
                     /locus_tag="DSY0307"
                     /note="Anticodon binding domain of tRNAs; Region:
                     HGTP_anticodon2; pfam12745"
                     /db_xref="CDD:257268"
     misc_feature    357416..357664
                     /locus_tag="DSY0307"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    <357632..357889
                     /locus_tag="DSY0307"
                     /note="MotA/TolQ/ExbB proton channel family; Region:
                     MotA_ExbB; cl00568"
                     /db_xref="CDD:260505"
     misc_feature    357947..358270
                     /locus_tag="DSY0307"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     misc_feature    358343..358609
                     /locus_tag="DSY0307"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    358514..358516
                     /locus_tag="DSY0307"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            358777..358965
                     /locus_tag="DSY0308"
                     /db_xref="GeneID:3956971"
     CDS             358777..358965
                     /locus_tag="DSY0308"
                     /note="similarity to COG1146 Ferredoxin 3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516541.1"
                     /db_xref="GI:89893054"
                     /db_xref="GeneID:3956971"
                     /translation="MFIITIDPDSCSGCDACADSCPAHLLKFNGEITEVVGDETECMG
                     CESCVSVCPTGAASIMEM"
     misc_feature    <358783..358944
                     /locus_tag="DSY0308"
                     /note="RPB11 and RPB3 subunits of RNA polymerase; Region:
                     RNAP_RPB11_RPB3; cl11409"
                     /db_xref="CDD:264356"
     misc_feature    358807..358944
                     /locus_tag="DSY0308"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     gene            359005..360198
                     /gene="dsrA"
                     /locus_tag="DSY0309"
                     /db_xref="GeneID:3958164"
     CDS             359005..360198
                     /gene="dsrA"
                     /locus_tag="DSY0309"
                     /EC_number="1.8.99.3"
                     /note="similarity to COG2221 Oxidoreductase related to
                     nitrite reductase(Evalue: 1E-140)"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase dissimilatory-type subunit
                     alpha"
                     /protein_id="YP_516542.1"
                     /db_xref="GI:89893055"
                     /db_xref="GeneID:3958164"
                     /translation="MAEKRTPQLDELEKGQWPSFVTEIKKAAVKNEASKELLHLLERS
                     YEEKRGHWKHGGIVGVKGYGGGVIGRYTDLPEDYPNLAAFHTVRINSPSGWFYNTKSL
                     RTICDIWEKRGSGLMNFHGATGDAILLGTTTDQLQPIFDELSEGGFDLGGSGSDLRSP
                     SCCVGPGRCEHACYDTLEACYNITNQYQDELHRPMWPYKFKIKFSGCANDCTAAIARS
                     DCAVIGTWRDTLTIDQEAVKAYVAEGLNIQAVVCDRCPTKCLKFDAETQELSVIAEEC
                     TRCMHCINRMPKAIAPGKERGATILLGGKSTIVQSAFMGWVIVPFMKMEVEDDFQEFK
                     DMIERIWEWWDENGKTRERIGETIYRLGMTNFLTSVGLPAVPQMVYRPRANPYVFWPE
                     DEIKK"
     misc_feature    359029..360195
                     /gene="dsrA"
                     /locus_tag="DSY0309"
                     /note="sulfite reductase, dissimilatory-type alpha
                     subunit; Region: dsrA; TIGR02064"
                     /db_xref="CDD:233704"
     misc_feature    359257..359430
                     /gene="dsrA"
                     /locus_tag="DSY0309"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:251971"
     misc_feature    359461..360126
                     /gene="dsrA"
                     /locus_tag="DSY0309"
                     /note="Nitrite and sulphite reductase 4Fe-4S domain;
                     Region: NIR_SIR; pfam01077"
                     /db_xref="CDD:250346"
     gene            360212..361270
                     /gene="dsrB"
                     /locus_tag="DSY0310"
                     /db_xref="GeneID:3958165"
     CDS             360212..361270
                     /gene="dsrB"
                     /locus_tag="DSY0310"
                     /EC_number="1.8.99.3"
                     /note="similarity to COG2221 Oxidoreductase related to
                     nitrite reductase(Evalue: 1E-124)"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase dissimilatory-type subunit
                     beta"
                     /protein_id="YP_516543.1"
                     /db_xref="GI:89893056"
                     /db_xref="GeneID:3958165"
                     /translation="MAILDQGPLNYKEQLPPIIKENYGKWRYHENPKAGVLKHVSESG
                     AELYSIRVGSPRLVSLDFIREICNLADEYCDGYLRFTARHNVEFLVSDAAKVEPLIAA
                     LGAKGLPVGGTGASVSNIVHTQGWVHCHTPATDASGVVKAVMDDLYEYFVSMKLPAQM
                     KISLACCLNMCGAAHCSDIAIVGVHRTPPRIDHDKIRKGTEIPSLVASCPTGAIRPNP
                     KEKSVVVNDAKCMYCGNCYTMAPGMEIIDPQNDGIAILVGGKVANARTNPMFSRMVIP
                     FLPNNPPRWPEVTDAIRNIVETWAANANKGEKMGEWIERIGWERFFSLTGIEFSDKLI
                     DDFIFSRETFRTSAAFKY"
     misc_feature    360263..361267
                     /gene="dsrB"
                     /locus_tag="DSY0310"
                     /note="sulfite reductase, dissimilatory-type beta subunit;
                     Region: dsrB; TIGR02066"
                     /db_xref="CDD:131121"
     misc_feature    360326..360517
                     /gene="dsrB"
                     /locus_tag="DSY0310"
                     /note="Nitrite/Sulfite reductase ferredoxin-like half
                     domain; Region: NIR_SIR_ferr; pfam03460"
                     /db_xref="CDD:251971"
     misc_feature    360548..361210
                     /gene="dsrB"
                     /locus_tag="DSY0310"
                     /note="Nitrite and sulphite reductase 4Fe-4S domain;
                     Region: NIR_SIR; pfam01077"
                     /db_xref="CDD:250346"
     gene            361637..362227
                     /locus_tag="DSY0311"
                     /db_xref="GeneID:3956972"
     CDS             361637..362227
                     /locus_tag="DSY0311"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516544.1"
                     /db_xref="GI:89893057"
                     /db_xref="GeneID:3956972"
                     /translation="MDKTLRSLLTEKQDLIIEKWCREIINTYPKETAKFLKEKRDEFA
                     NPIGNTISQGIEQTFTALIQESKENEVHLFLKDMIKVRAVQSFTASQAVSFVFLLKRI
                     IREELGKVAEEERIAKALLDFETQIDQLALASFDIYSECRDKLADLKTMEIRNQTYRL
                     LQQANLLTLRSDMEPEEPHSEPEPFRVNTKRKEVVT"
     misc_feature    361646..361963
                     /locus_tag="DSY0311"
                     /note="RsbT co-antagonist protein rsbRD N-terminal domain;
                     Region: RsbRD_N; pfam14361"
                     /db_xref="CDD:258533"
     gene            362224..363225
                     /gene="hmeC"
                     /locus_tag="DSY0312"
                     /db_xref="GeneID:3958179"
     CDS             362224..363225
                     /gene="hmeC"
                     /locus_tag="DSY0312"
                     /note="similarity to COG2181 Nitrate reductase gamma
                     subunit(Evalue: 8E-67)"
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr-like menaquinol oxidoreductase cytochrome b
                     like subunit"
                     /protein_id="YP_516545.1"
                     /db_xref="GI:89893058"
                     /db_xref="GeneID:3958179"
                     /translation="MKALFSLIAVLILMLIPLVGVGLANLQGLFGIVLPYLALILFLG
                     GFIYRIMGWARTPVPFRIPTTVGQGKSFDWIKQNKIENPTSNLGVIIRMAMEVLLFRS
                     LFRNSKTELRNGENGPQLAHGSNKWLWLFGLMFHWSLLIILIRHLRLFLEPVPAVISS
                     LDSLDSFFQIGLPALYITDMLIVAALTFLFLRRVVAPQVRYISLAADYFPLFLLMGIA
                     ATGILMRYIFRVDIASIKEFAVGLLTFTPHIPDGIGTIFYIHLFFVSCLFAYFPLSKL
                     MHMGGIFMNPTRNMKSNNRMVRHINPWNYPVEVHTYEEYEDDFRTKMIKAGIPVEKE"
     misc_feature    362593..363066
                     /gene="hmeC"
                     /locus_tag="DSY0312"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; cl00959"
                     /db_xref="CDD:260721"
     gene            363235..364863
                     /gene="hmeD"
                     /locus_tag="DSY0313"
                     /db_xref="GeneID:3958180"
     CDS             363235..364863
                     /gene="hmeD"
                     /locus_tag="DSY0313"
                     /note="similarity to COG0247 Fe-S oxidoreductases(Evalue:
                     1E-150)"
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr-like menaquinol oxidoreductase iron-sulfur
                     subunit 2"
                     /protein_id="YP_516546.1"
                     /db_xref="GI:89893059"
                     /db_xref="GeneID:3958180"
                     /translation="MAKYKLPKSEELSKIDYKPGSTEWMDTPVTTPFEPGTFCWGAKG
                     KNLETVGFPNARDWSPVDEDWQLPENWKSTVIEGIGERLTKYRSFKIMMDICVRCGAC
                     ADKCHFYIGSGDPKNMPVLRAELLRSVYRRYFTPSGKFLGRLAGARDLTPEVIKEWWY
                     YFYQCTECRRCSVFCPYGIDQAEITIIGRELLNLLGLNIDWIAGPVANCYMKGNHLGL
                     EPHAITGNIEMMCDDIEDITGVRVEPTFNRKGAEILFVTPSGDLMGDPGIYTCMGYLM
                     LFHELGLDYTWSTYASEGGNFGFFTSNEMAKRLNSKIYAEAKRLGVKYIIGGECGHMW
                     RVVNQYMGTWNEPADFLEVPVSPITGTRFDNAASTKMIHITEFTADLIKHGKLKLDPS
                     RNDHLKVTYHDSCNTSRGMGLLEEPRYIINNVCSNFYEMPESTIREKTFCCGSGSGLN
                     ASENMEERMRGGFPRANAVKYVQDKHGVNMLANICAVDRAALPALMDYWAPGVGVIGV
                     HELVANALVMTGEKERTTDLRGEDLPEKGVTADE"
     misc_feature    363508..363771
                     /gene="hmeD"
                     /locus_tag="DSY0313"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    363514..364782
                     /gene="hmeD"
                     /locus_tag="DSY0313"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    364429..364692
                     /gene="hmeD"
                     /locus_tag="DSY0313"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            364856..365299
                     /gene="hmeE"
                     /locus_tag="DSY0314"
                     /db_xref="GeneID:3958181"
     CDS             364856..365299
                     /gene="hmeE"
                     /locus_tag="DSY0314"
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr-like menaquinol oxidoreductase cytochrome c
                     subunit"
                     /protein_id="YP_516547.1"
                     /db_xref="GI:89893060"
                     /db_xref="GeneID:3958181"
                     /translation="MSKGGKTIGGLLIFVVIAIMPFLYNMGKADAKPEINTDTPVIRE
                     LGATQCIEGTEYMRENHMHLLLEWRDAVVREGKTTYTNSQGEQFEMSLQNTCLNCHND
                     TPETVYYTAETANQGDNQFCYSCHNYAAVEPDCWACHAGPREAEK"
     misc_feature    <365138..365272
                     /gene="hmeE"
                     /locus_tag="DSY0314"
                     /note="Cytochrome c7; Region: Cytochrome_C7; pfam14522"
                     /db_xref="CDD:258662"
     gene            365296..366090
                     /gene="hmeA"
                     /locus_tag="DSY0315"
                     /db_xref="GeneID:3958177"
     CDS             365296..366090
                     /gene="hmeA"
                     /locus_tag="DSY0315"
                     /note="similarity to COG0437 Fe-S-cluster-containing
                     hydrogenase components 1(Evalue: 1E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr-like menaquinol oxidoreductase iron-sulfur
                     subunit 1 precursor"
                     /protein_id="YP_516548.1"
                     /db_xref="GI:89893061"
                     /db_xref="GeneID:3958177"
                     /translation="MSINRREFLKKAGVIAALGLGGAVTLDAFELLEPLKAADFTSEN
                     KLAAQRWAMVIDMSKLSQADIDEIIKGCHELHNVPDMGNEKDEIKWIWTDTYEHVFPG
                     DENHYLDEKTKTMPFLTLCNHCDHPPCVRVCPTQATFRREDGVVGMDMHRCIGCRFCM
                     AACPYGARSFNYWDPKPHLAKINPEYPHRSKGVVEKCTFCMERLDQGLAPVCVEKSKG
                     AIVYGDLEDPNSAVRKVLSTHYSIRRKPELGSQPSVYYLIGGEERA"
     misc_feature    365443..366081
                     /gene="hmeA"
                     /locus_tag="DSY0315"
                     /note="Fe-S-cluster-containing hydrogenase components 1
                     [Energy production and conversion]; Region: HybA; COG0437"
                     /db_xref="CDD:223514"
     misc_feature    365650..365970
                     /gene="hmeA"
                     /locus_tag="DSY0315"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            366074..367234
                     /gene="hmeB"
                     /locus_tag="DSY0316"
                     /db_xref="GeneID:3958178"
     CDS             366074..367234
                     /gene="hmeB"
                     /locus_tag="DSY0316"
                     /note="similarity to COG3301 Formate-dependent nitrite
                     reductase, membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr-like menaquinol oxidoreductase integral
                     membrane subunit"
                     /protein_id="YP_516549.1"
                     /db_xref="GI:89893062"
                     /db_xref="GeneID:3958178"
                     /translation="MRSVLEKSLSGSKKYWLWVGFLLVVILGGFLAYLRQYNEGLGVT
                     GMSRDVSWGLYISQFTFLVGVAASAVMVAIPYYLHNYKKFGKIVILGEFLAVPSVIMC
                     ILFIFVDVGRPDRILNVLLHPTPHSVMFWDMCVLCGYLLLNLVIGWTALGSERKGFPP
                     PAWVKPLIYLSIPWAVSIHTVTAFLYSGMPGRHLWLTAIMAARFLASAFAAGPALLIL
                     LCMIVRKVSTFDPGKEAIQSLAKIVTYAMIANVFFYILEFFTAFYSNIPGHMHPLQYL
                     FAGLHGHGQLVPFMWVAVVLAFVGIFLLVVPKFRRNEKILPFALLSVFIAAWIDKGLG
                     LVLGGFVPTPLEHVVEYTPTATELAVTLMVYAIGALLITILYKVVIGVREEI"
     misc_feature    366137..367204
                     /gene="hmeB"
                     /locus_tag="DSY0316"
                     /note="Polysulphide reductase [Energy production and
                     conversion]; Region: COG5557; cl17901"
                     /db_xref="CDD:248455"
     gene            367281..367598
                     /locus_tag="DSY0317"
                     /db_xref="GeneID:3956973"
     CDS             367281..367598
                     /locus_tag="DSY0317"
                     /note="similarity to COG2920 Sulfite reductase, gamma
                     subunit(Evalue: 6E-29)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516550.1"
                     /db_xref="GI:89893063"
                     /db_xref="GeneID:3956973"
                     /translation="MADLVVNGVSYELDEDGFLEDAAEWNEDVAKALAPNEDVEELTE
                     EHWRVINYLRDYYDQYGVAPMVRKLLKDTGYDQKTIYNLFPTGPGKGACKIAGLPKPT
                     GCV"
     misc_feature    367290..367595
                     /locus_tag="DSY0317"
                     /note="DsrC like protein; Region: DsrC; pfam04358"
                     /db_xref="CDD:146805"
     gene            367765..369207
                     /gene="cobB"
                     /locus_tag="DSY0318"
                     /db_xref="GeneID:3958094"
     CDS             367765..369207
                     /gene="cobB"
                     /locus_tag="DSY0318"
                     /note="similarity to COG1797 Cobyrinic acid a,c-diamide
                     synthase(Evalue: 1E-99)"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_516551.1"
                     /db_xref="GI:89893064"
                     /db_xref="GeneID:3958094"
                     /translation="MSTLSTPRLVIGAPQGRSGKTTFTLGLLRALSRQGLPVQPYKKG
                     PDYIDTSWHTAAAGRVSRNLDSFMMSQEDICRSLAQHSQDCQFSLIEGAMGLFDGLDI
                     NGSASTAEIAKITSSPVLLVLDATRITRSLGAIVMGCQHFDPNINIVGVVLNKIARAR
                     HEKLARETIEQYCRIPVVGAIPKDSRILIPDRHLGLVTNGEWSETDTFLDNLADVVSE
                     NVDIAKIMELARTAAPLSYSTPTKFSVSQGYPLKTKPPAPRIGVIRDAAFSFYYPENL
                     AVLESKGAELVTVSALSHQHLPKDLDALYIGGGFPEVFAEQLANNRTLRQEIRLAGED
                     GLPIYAECGGLMFLGRSIITGDGSYDMVGLLPLDTRMEKKPQGHGYTVMKVLENNPWF
                     RQPKIRGHEFHNSSVLNLDRTKIEFGFEVERGHGIDGKYEGICYKGVMAAYNHIHALG
                     SPDWAECMVKLATQYKERRSKMVFELFKSS"
     misc_feature    367777..369159
                     /gene="cobB"
                     /locus_tag="DSY0318"
                     /note="cobyrinic acid a,c-diamide synthase; Validated;
                     Region: PRK01077"
                     /db_xref="CDD:234896"
     misc_feature    367819..368313
                     /gene="cobB"
                     /locus_tag="DSY0318"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    368542..369132
                     /gene="cobB"
                     /locus_tag="DSY0318"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyrinic Acid a,c-Diamide Synthase; Region:
                     GATase1_CobB; cd03130"
                     /db_xref="CDD:153224"
     misc_feature    order(368788..368790,369103..369105,369109..369111)
                     /gene="cobB"
                     /locus_tag="DSY0318"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153224"
     gene            369386..370375
                     /locus_tag="DSY0319"
                     /db_xref="GeneID:3956974"
     CDS             369386..370375
                     /locus_tag="DSY0319"
                     /note="similarity to COG0583 Transcriptional
                     regulator(Evalue: 3E-40)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516552.1"
                     /db_xref="GI:89893065"
                     /db_xref="GeneID:3956974"
                     /translation="MGKERRLLFEQQFVVFKEVADTKNITLAAKRLHMSQPSISLQIQ
                     NMENLYGARFFNRTNKGVTLTKAGEVFYDHVNNILNILTVAQQQISVLTEDQRALIYI
                     GATLTIGEYILPNILAYLYKIRPDVDFKVKIANTETISQEVIEKRIHIGLIEGPAPRN
                     KEIVVEKFWQDELVVVVPSFHPWAARHSITLAELAKERLIMREEGSGTRKVTELALKE
                     MGLDLSQINVTMELGSTQAIKKVVAAGIGITIISSLTVSRECENGLFKVLKVQDSPVY
                     RPLNMLTLAHTTQTKDERFLISMLHDRDLLEAIINGNCEDDKELYPCGDCLEA"
     misc_feature    369416..370294
                     /locus_tag="DSY0319"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    369416..369592
                     /locus_tag="DSY0319"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    369683..370285
                     /locus_tag="DSY0319"
                     /note="C-terminal substrate binding domain of LysR-type
                     transcriptional regulator CysL, which activates the
                     transcription of the cysJI operon encoding sulfite
                     reductase, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CysL_like; cd08420"
                     /db_xref="CDD:176112"
     misc_feature    order(369725..369730,369734..369739,369746..369748,
                     369758..369760,369764..369784,370070..370087,
                     370103..370108,370112..370117)
                     /locus_tag="DSY0319"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176112"
     gene            370423..371292
                     /locus_tag="DSY0320"
                     /db_xref="GeneID:3956975"
     CDS             370423..371292
                     /locus_tag="DSY0320"
                     /note="similarity to COG0388 Predicted
                     amidohydrolase(Evalue: 3E-29)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516553.1"
                     /db_xref="GI:89893066"
                     /db_xref="GeneID:3956975"
                     /translation="MLQDIRIGLAQFEAKVGDTERNLQEIIRTAEVASSQGVSLLCYP
                     ECALHGYSPKDASEIADPLDSMAVARLRECARDLGLILLVGMVEKSPEGKKPYISQLI
                     VFPDREPEVYRKVHLGRIEQHYFTAGDSFPIFAAGGVKFSIGICWDWHFPELSAICSL
                     KGAEIQFAPHASPVVSGDRKEIWKRYLGARAYDNSVYLCACNLVGTNNRDKEFSGGIL
                     VFGPKGEVLAENQDTQEQLFVVDLPAKPINTLRSPKRQSMRDTFFLADRRKELYKELL
                     ELEIEKMPQMSHD"
     misc_feature    370438..371226
                     /locus_tag="DSY0320"
                     /note="Uncharacterized subgroup of the nitrilase
                     superfamily (putative class 13 nitrilases); Region:
                     nitrilase_7; cd07585"
                     /db_xref="CDD:143609"
     misc_feature    order(370555..370557,370762..370764,370774..370776,
                     370786..370788,370858..370863,370867..370872,
                     370933..370935)
                     /locus_tag="DSY0320"
                     /note="putative active site [active]"
                     /db_xref="CDD:143609"
     misc_feature    order(370555..370557,370762..370764,370858..370860)
                     /locus_tag="DSY0320"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143609"
     misc_feature    order(370765..370776,370783..370785,370801..370809,
                     370861..370863,370867..370881,370888..370893,
                     370975..370980,370984..370992,370996..371001,
                     371065..371070,371215..371226)
                     /locus_tag="DSY0320"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143609"
     gene            371769..372233
                     /gene="nrdR"
                     /locus_tag="DSY0321"
                     /db_xref="GeneID:3956976"
     CDS             371769..372233
                     /gene="nrdR"
                     /locus_tag="DSY0321"
                     /note="similarity to COG1327 Predicted transcriptional
                     regulator, consists of a Zn-ribbon and ATP-cone
                     domains(Evalue: 8E-48)"
                     /codon_start=1
                     /transl_table=11
                     /product="NrdR family transcriptional regulator"
                     /protein_id="YP_516554.1"
                     /db_xref="GI:89893067"
                     /db_xref="GeneID:3956976"
                     /translation="MHCPFCGNDETKVLESRQVEEGTAVRRRRECERCARRFTTFEKF
                     EDTPLIVVKKDGRREEFSRGKLKAGILRACEKRPVSIEQIETLVYEIEKGLRNGSERE
                     VQSKAIGEAVMNALVHLDEVAYIRFASVYREFKDVQRFLEELHELVEKKSSR"
     misc_feature    371769..372230
                     /gene="nrdR"
                     /locus_tag="DSY0321"
                     /note="transcriptional regulator NrdR; Validated; Region:
                     nrdR; PRK00464"
                     /db_xref="CDD:234774"
     misc_feature    371913..372179
                     /gene="nrdR"
                     /locus_tag="DSY0321"
                     /note="ATP cone domain; Region: ATP-cone; pfam03477"
                     /db_xref="CDD:251987"
     gene            372378..375839
                     /locus_tag="DSY0322"
                     /db_xref="GeneID:3956977"
     CDS             372378..375839
                     /locus_tag="DSY0322"
                     /note="similarity to COG0209 Ribonucleotide reductase
                     alpha subunit(Evalue: 1E-137)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516555.1"
                     /db_xref="GI:89893068"
                     /db_xref="GeneID:3956977"
                     /translation="MSFQESAPKAWLKANLTPNARVILEKRYLKQENGEVAESPEDML
                     YRVASIIAQVEETFGKTKKEVKELAKSFYEMMAKLEFMPNSPTLMNAGRDLGQLSACF
                     VLPVEDSMEEIFDAIKSAAIIHKSGGGTGFSFSRLRPKNSTVRSTGGVASGPVSFMKV
                     FNAATEAVKQGGTRRGANMGILRVDHPDIREFITCKEDNKEITNFNISVGITEEFMKA
                     VQEKRHYNLIDPHTKEADGQLYAPEVFQLIVDHAWRNGEPGIIFLDRLNRDNPTPQLG
                     EIEATNPCVTGDTWVLTEEGAAQVRDLLGSQVKLALNGEYHETSKEGFFATGVKQVLT
                     LKTQQGYELKVTADHLVRVASDMTRYKVTQEWKPAGELKPGDTIVLSNNRSIQWQGKG
                     TKEEGYLLGLLLGDGTLKEEGAVISVWGEGEEAKSMMEAAEKAAFSLTHRQDFQGFQK
                     EISERHEHRMRFAALRDLAQQYGILPGSKAITQELEKTGQDFYQGLLRGLYDTDGTVT
                     GTQEKGVSVRLWQTDLAGLKVVQRMLQRLGIISTLYEERKPAGQKLMPDGQGGSKEYP
                     VQAGHELVISQDNIEIFAEKVGFSNSKKAQLLAEKLNVYQRSLNRERFVDNIVACVPG
                     DAEEVFDAQVPGINAFDANGIYVHNCGEQPLLPNEACNLGSINLKLMVTEKNGKVVVD
                     WERLGQITRLATRFLDNVIEANTYPLPSIEEMVKGNRKIGLGVMGFADMLILLQTSYA
                     SEDAVEYAEKVMNFIQTEARLESQRLAEERGTFPNYQGSIYDGVRPLRNATLTTIAPT
                     GTISMICGASSGVEPLFAVAYTKTVMDGTPLIEVNPIFQSLAEDYGFNSPELMRKIAE
                     KGTVLGFPEVPNWVQEVFVTAQEIEPEWHIRIQAAFQKYTDNAVSKTINFANEATHED
                     IAKAYELAHELNCKGLTVYRDGSREEQVLSTGITKKAEEKAEEAKTQVSIPKVPFIPE
                     VNTVLPRPRPTTTTGVTEKIRIGCGNLYVSVMADEKGICEIFTNTGRAGGCSSQSEAT
                     ARLISIALRSGISVDAIIEQVKGIRCPACIRREGVNVTSCPDAIARVIKEYVELGKGK
                     VNSVKVTSQPAVEEKPVQSKSASITNPQKTRATVAEGNACPECGMSINHESGCVVCTH
                     CGYSKCG"
     misc_feature    372420..372665
                     /locus_tag="DSY0322"
                     /note="Ribonucleotide reductase, all-alpha domain; Region:
                     Ribonuc_red_lgN; pfam00317"
                     /db_xref="CDD:249765"
     misc_feature    372582..>373229
                     /locus_tag="DSY0322"
                     /note="Class II ribonucleotide reductase, dimeric form;
                     Region: RNR_II_dimer; cd02888"
                     /db_xref="CDD:153089"
     misc_feature    order(372627..372632,372675..372677,372756..372764,
                     372897..372902,372906..372908,373221..373229)
                     /locus_tag="DSY0322"
                     /note="active site"
                     /db_xref="CDD:153089"
     misc_feature    order(372660..372662,372705..372710,372717..372722,
                     372726..372731,372738..372743,372750..372752,
                     372804..372806,372813..372824,372831..372833,
                     372846..372848,372855..372857,372864..372869,
                     372876..372878,372882..372890,372894..372896)
                     /locus_tag="DSY0322"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153089"
     misc_feature    order(372699..372701,372702..372707,372714..372716,
                     372750..372752,372789..372791,372807..372809,
                     372813..372815,372828..372833,372846..372848,
                     372876..372884)
                     /locus_tag="DSY0322"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153089"
     misc_feature    373218..374324
                     /locus_tag="DSY0322"
                     /note="Intein/homing endonuclease [DNA replication,
                     recombination, and repair]; Region: COG1372"
                     /db_xref="CDD:224291"
     misc_feature    373227..>373535
                     /locus_tag="DSY0322"
                     /note="Hedgehog/Intein domain, found in Hedgehog proteins
                     as well as proteins which contain inteins and undergo
                     protein splicing (e.g. DnaB, RIR1-2, GyrA and Pol). In
                     protein splicing an intervening polypeptide sequence - the
                     intein - is excised from a protein; Region: Hint; cd00081"
                     /db_xref="CDD:238035"
     misc_feature    order(373227..373229,373413..373415,373422..373424)
                     /locus_tag="DSY0322"
                     /note="thioester formation/cholesterol transfer; other
                     site"
                     /db_xref="CDD:238035"
     misc_feature    order(373227..373229,373422..373424)
                     /locus_tag="DSY0322"
                     /note="protein-splicing catalytic site; other site"
                     /db_xref="CDD:238035"
     misc_feature    373860..374141
                     /locus_tag="DSY0322"
                     /note="LAGLIDADG-like domain; Region: LAGLIDADG_3;
                     pfam14528"
                     /db_xref="CDD:258668"
     misc_feature    <374250..375185
                     /locus_tag="DSY0322"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:245211"
     misc_feature    375348..375623
                     /locus_tag="DSY0322"
                     /note="TSCPD domain; Region: TSCPD; pfam12637"
                     /db_xref="CDD:257182"
     gene            376074..377573
                     /locus_tag="DSY0323"
                     /db_xref="GeneID:3956978"
     CDS             376074..377573
                     /locus_tag="DSY0323"
                     /note="similarity to COG1620 L-lactate permease(Evalue:
                     6E-38)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516556.1"
                     /db_xref="GI:89893069"
                     /db_xref="GeneID:3956978"
                     /translation="MEIILAAMPFLIILVLLFILRQSAVRAGISAYLLTLLIGLVIPR
                     FQIERQEILHATVKAVLTSAIVAYVLLFGIFLYHIMNETGLIKRIASLISGSTQDPVR
                     QVILLVVAFSPLVESVSGYGIAIIVVAPILVELGFSSFKAVLLSLLGLSAVPWGALAT
                     GTYIGANLAGIPFQRLGTDVAVLSIPTFFYFAVTAVYLAGGWQGVRAKWAELMLVAGS
                     LAFSVWLFNAYVSIELAGVFASLVALGVEFAFIYFTAKSTPEEAAFSLAARNQSKADI
                     LKTMSPYLILTGVLFISRLVPPIKAFAGSHAVFSLPAYSFSLPVLYSPGFSIFLTCLL
                     TILLFKIQKHVIKRAVQLSLKQWLPVTLSTIAFIGTSEIMAAAGMTTTLAQAAAAAFG
                     SAFVLCSPLIGGFGGFLTGSNVASNAMLINLQVEVAKQIGMPAELFASMQNTSSSHMT
                     MASPSRVLLGASVCNIRSEENRLLQKIFPMALGSLVLVLAAVFLLNLRG"
     misc_feature    376074..377558
                     /locus_tag="DSY0323"
                     /note="L-lactate permease [Energy production and
                     conversion]; Region: LldP; COG1620"
                     /db_xref="CDD:224535"
     gene            377794..379251
                     /locus_tag="DSY0324"
                     /db_xref="GeneID:3956979"
     CDS             377794..379251
                     /locus_tag="DSY0324"
                     /note="similarity to COG0642 Signal transduction histidine
                     kinase(Evalue: 2E-33)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516557.1"
                     /db_xref="GI:89893070"
                     /db_xref="GeneID:3956979"
                     /translation="MGMERSMVVDNRHLSTKFTVLVTSVIIVAVVIYLAWSINMQQAA
                     TEDKVLAEARTLSIQMSAAWDYINDSQTAINYNSDGSYDFKGVYCSIAGKDIAQRFTR
                     QSEGYIIRYARENPRSGTDEPDVFERKALTLFATGESREQYGIEKYKGEMVFRYTSAI
                     EIRHNCLPCHGEPAGEKDETGFIKEGMKVGDIAGASSIIIPLDLYAKEARTRTLQTIG
                     FFLVLLFVVIAVVRFALRKWVTEPLTQANLELHDENEMKSNFLTIMSHELKTPLSSII
                     AFTDIWEKSSREKSEDEQRLVQEIKENSRTLLNMVNNTIDVARLEAGRFEITYDEVEL
                     VDIVSAVVSVAHPIAVKHNISLEKRISPDTPIIISDWEALRKILMNLVSNALKFTGAG
                     GKVDISVSYLSDRSRVVIQVADTGAGIPEKDHDQIFERFTQSTQPGDERINGSGLGLF
                     LVKTLTEKLGGEIEVDSVVERGSSFSVYVPIDSSK"
     misc_feature    377854..378399
                     /locus_tag="DSY0324"
                     /note="Protein of unknown function (DUF3365); Region:
                     DUF3365; pfam11845"
                     /db_xref="CDD:256666"
     misc_feature    <378490..379236
                     /locus_tag="DSY0324"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    378553..378750
                     /locus_tag="DSY0324"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(378571..378573,378583..378585,378595..378597,
                     378604..378606,378616..378618,378625..378627,
                     378679..378681,378691..378693,378700..378702,
                     378712..378714,378721..378723,378733..378735)
                     /locus_tag="DSY0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    378589..378591
                     /locus_tag="DSY0324"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    378913..379230
                     /locus_tag="DSY0324"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(378931..378933,378943..378945,378952..378954,
                     379027..379029,379033..379035,379039..379041,
                     379045..379050,379129..379140,379186..379188,
                     379192..379194,379207..379212,379216..379218)
                     /locus_tag="DSY0324"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    378943..378945
                     /locus_tag="DSY0324"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(379039..379041,379045..379047,379129..379131,
                     379135..379137)
                     /locus_tag="DSY0324"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            379749..381047
                     /locus_tag="DSY0325"
                     /db_xref="GeneID:3956980"
     CDS             379749..381047
                     /locus_tag="DSY0325"
                     /note="similarity to COG3303 Formate-dependent nitrite
                     reductase, periplasmic cytochrome c552 subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516558.1"
                     /db_xref="GI:89893071"
                     /db_xref="GeneID:3956980"
                     /translation="MNYLGEKGRGSDHMNAKKLLLLFMAAALSVVVGCSPQSQSVTTE
                     TKPIDWKSMYPAQYYSSLGSADHLDDVETVPKTGGYGHGSQSKYMPISIEQKNGEINA
                     TCISCKSSKFNELYEKYGNEVFNATPSAKYAEIMTAEDWWSCGTCHSDMTDPAGSVGA
                     QIVTAELFGKELFDKLDPKTAACSQCHNNLSPWSDSRIVNGSDILNSGKSPYRYGWDP
                     DALIKATLEDAVPDASRYPNGKTMELSAAAHAKVDESTGTYLIANGNHADAEMFQGSL
                     HEQLGVSCTDCHMPTLEDRSGEPYTSHDASKSVLNSEASMNYCLSCHSSQGLETVKDM
                     YNYVRNAQAELAEKDAAVADKLDETYGYIEAAVKGGTVSNEVLDKARFNYAVAAYYKE
                     YVYGNRGATPGEKVAHNPKMSHKYLERAIALLDETIEMLR"
     misc_feature    <380052..381011
                     /locus_tag="DSY0325"
                     /note="Cytochrome c7; Region: Cytochrome_C7; cl19206"
                     /db_xref="CDD:267559"
     gene            381377..382072
                     /locus_tag="DSY0326"
                     /db_xref="GeneID:3956981"
     CDS             381377..382072
                     /locus_tag="DSY0326"
                     /note="similarity to COG0745 Response regulators
                     consisting of a CheY-like receiver domain and a
                     winged-helix DNA-binding domain(Evalue: 2E-45)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516559.1"
                     /db_xref="GI:89893072"
                     /db_xref="GeneID:3956981"
                     /translation="MKIMLVDDEPSLCSALEIVITRAGYDFYCATDGIAALELFRSKK
                     PDLAILDLMVPWLNGFEICEEIRRTDSHIPILILSAKGDIVDKKMGFRAGADDYLTKP
                     FEEEELLLRIEALLRRRNKESGSLPINGLSQKVEIGELIIDPFRYEVTVRDRLVNLTP
                     KEYQIIALMANHPGKVFTREDLIDCIWGKEFETGSISIPVYIRRIREKIEQDPSEPTL
                     LKTVWRFGYKLGD"
     misc_feature    381377..382063
                     /locus_tag="DSY0326"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    381386..381685
                     /locus_tag="DSY0326"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(381395..381400,381527..381529,381551..381553,
                     381611..381613,381668..381670,381677..381682)
                     /locus_tag="DSY0326"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    381527..381529
                     /locus_tag="DSY0326"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(381536..381541,381545..381553)
                     /locus_tag="DSY0326"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    381677..381685
                     /locus_tag="DSY0326"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    381779..382063
                     /locus_tag="DSY0326"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(381851..381853,381908..381913,381965..381967,
                     381974..381976,381998..382003,382037..382039,
                     382052..382054)
                     /locus_tag="DSY0326"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(382173..382529)
                     /locus_tag="DSY0327"
                     /db_xref="GeneID:3955812"
     CDS             complement(382173..382529)
                     /locus_tag="DSY0327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516560.1"
                     /db_xref="GI:89893073"
                     /db_xref="GeneID:3955812"
                     /translation="MKRLKFRVWNKVSKKMHNPQAISFDIQNCNPFAVSIPAKSWDPA
                     EKYELLQWTGLRDESGTDVYEADLVLIDYEIYRVHWHESEAAFKLISLKGSLEKEAGL
                     LPTGKIIGNTYETENL"
     misc_feature    complement(382176..382517)
                     /locus_tag="DSY0327"
                     /note="YopX protein; Region: YopX; pfam09643"
                     /db_xref="CDD:255467"
     gene            complement(382635..383582)
                     /locus_tag="DSY0328"
                     /db_xref="GeneID:3955813"
     CDS             complement(382635..383582)
                     /locus_tag="DSY0328"
                     /note="similarity to COG0697 Permeases of the
                     drug/metabolite transporter (DMT) superfamily(Evalue:
                     1E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516561.1"
                     /db_xref="GI:89893074"
                     /db_xref="GeneID:3955813"
                     /translation="MSCSIGQHHDLLISATTEMETPMNRSYLKYITSLILFGFNGIVA
                     SHISLSSYEIVFTRTLIGSLFLVIVFGFSKQKMRFLSNKSHFLYLSLSGVAMGASWMF
                     LYEAYTQIGVSIATLAYYCGPVIVMILSPLLFKERMTSAKLIGFLAVLTGMLCVSGQA
                     MSEEKTLFGLICGLLSAVMYAVMVIFNKKAVSITGLENSMWQLMASFATVFLFLGLKQ
                     DFSINIASGDWLPILILGIVNTGIGCYFYFSSIGLLPVQTVAICGYLEPLSALLFSAA
                     LLGERLSLVQILGALLILGGAAFGELYRRKLPANSSLTT"
     misc_feature    complement(383112..383480)
                     /locus_tag="DSY0328"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(382692..383438)
                     /locus_tag="DSY0328"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:233205"
     misc_feature    complement(382686..383051)
                     /locus_tag="DSY0328"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(383635..384849)
                     /locus_tag="DSY0329"
                     /db_xref="GeneID:3955814"
     CDS             complement(383635..384849)
                     /locus_tag="DSY0329"
                     /note="similarity to COG2015 Alkyl sulfatase and related
                     hydrolases(Evalue: 5E-56)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516562.1"
                     /db_xref="GI:89893075"
                     /db_xref="GeneID:3955814"
                     /translation="MAEIIPGSVYHVIGYGHSNAGFIIAENSVILIDTLDSDERAQTL
                     KSLIARYTNKPVKTIIYTHGHPDHRGGSGAFMDSNPEIIAFAPCKPVLGRMNALQDVL
                     NQRGIRQFGYQLNNEEALTQGLGIREGKAQGEGQYAIMPPTTVYQEDSVLRSLDGIEL
                     ELAAAPGEADDQILIWLPAHKVLFCGDNYYGCWPNLYAIRGSQYRDVSAWVDTLNKLI
                     AYRAHYLLPGHTRPIIGETAVQETLTNFRDAIDYVLTETLKGMNQGLTMDEVAEAVKL
                     PEKWAKLPYLGEFYGTVSWSVRGIYAGYVGWFDGNPTHLNPLPPAVQAQKTVALMGGA
                     ETVLSAIRQALSEQDYQWSVVLADLLLAMDRSHKQAKEYKAQGLVELGHRETSANGRH
                     YYLAYAKELLAE"
     misc_feature    complement(384163..384795)
                     /locus_tag="DSY0329"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     misc_feature    complement(383647..384057)
                     /locus_tag="DSY0329"
                     /note="Alkyl sulfatase dimerization; Region:
                     Alkyl_sulf_dimr; pfam14863"
                     /db_xref="CDD:259000"
     gene            385197..386150
                     /locus_tag="DSY0330"
                     /db_xref="GeneID:3955815"
     CDS             385197..386150
                     /locus_tag="DSY0330"
                     /note="similarity to COG0472 UDP-N-acetylmuramyl
                     pentapeptide phosphotransferase/UDP-N-
                     acetylglucosamine-1-phosphate transferase(Evalue: 3E-54)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516563.1"
                     /db_xref="GI:89893076"
                     /db_xref="GeneID:3955815"
                     /translation="MMEFIIPFFFVFFIVFMSIPLLEKLAVKWNFVDKPTERKKHKHP
                     IPLLGGVGIFLGFMIGYLVFVRPINYQSLAIIIASVLVLGIGLIDDWYKTLGKEFPAL
                     PRLMVHILAAWMVFSAGIVFYGFTNPFTQQYIVLPYIIQLILSIMWIVGVTTVINWSD
                     GIDGLAGILSSIAGATLYVAALAKGQSDSALLSALLVGAALGFLRYNRHPARIFMGDS
                     GANFLGFILAIVALSGAFKQATLVSLSIPVLALGVPIFDNIIVVLKRFSRGESIYKAD
                     ATQIHHRLISSGLNPKQTVAFISLMSVCFSLLSIIILLLNI"
     misc_feature    385308..386063
                     /locus_tag="DSY0330"
                     /note="This subfamily contains Escherichia coli WecA,
                     Bacillus subtilis TagO and related proteins. WecA is an
                     UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate
                     (Und-P) GlcNAc-1-phosphate transferase that catalyzes the
                     formation of a phosphodiester bond...; Region:
                     GT_WecA_like; cd06853"
                     /db_xref="CDD:133463"
     misc_feature    385461..385466
                     /locus_tag="DSY0330"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133463"
     misc_feature    385836..385847
                     /locus_tag="DSY0330"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133463"
     misc_feature    order(385989..385991,386031..386042)
                     /locus_tag="DSY0330"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133463"
     gene            complement(386265..387098)
                     /locus_tag="DSY0331"
                     /db_xref="GeneID:3955816"
     CDS             complement(386265..387098)
                     /locus_tag="DSY0331"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516564.1"
                     /db_xref="GI:89893077"
                     /db_xref="GeneID:3955816"
                     /translation="MDSPIGATSPTHSSTLSQEEALRVLYQELLAKTEHTVAFLKEAR
                     VGNHTIYAFQHMINGRAPTIDFVHSKTGKVYYDSVELLLDIFINSEDKEPYKAANYIN
                     KDIYYLEMKSVNDPEPTTWSTYVFNEDAYTSAEAAKKAVVKVYAENHPTLSLLGKPLA
                     EVEKITKVESIKAPVETKDEETTEVTQIALDNILILFDKDSISSEIFLEGQQEILGVK
                     IGEPFNEISDKLGMPDSFGQDPEFENIYTMRYLFDGFQIEFYGENKDANTVSALIKKR
                     I"
     gene            387752..389053
                     /locus_tag="DSY0332"
                     /db_xref="GeneID:3955817"
     CDS             387752..389053
                     /locus_tag="DSY0332"
                     /note="similarity to COG2223 Nitrate/nitrite
                     transporter(Evalue: 1E-146)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate/nitrite transporter"
                     /protein_id="YP_516565.1"
                     /db_xref="GI:89893078"
                     /db_xref="GeneID:3955817"
                     /translation="MQKIERWDPEDQEFWETKGKKVANRNLWISIPALLLAFAVWQLW
                     SVVAVNLNSAGFQFTTDQLFTLAALPGLTGATMRFFYSFTVPVFGGRNWTVVSTASLL
                     IPTIGIGLAVQNPATSFTTMAILAAFCGLGAGNFASSMANISFFFPKKAKGTALGLNA
                     GLGNLGVSAVQFLAPLVITVGIFGSIGGAPQMMVQGGLQQQVFLQNALFIWVIPIVLT
                     VIAAFWGMNNLETAKASVREQMIVLKRKHTWLMSWLYTMCFGSFIGYSAAFPLLIKTQ
                     FPDVNGLQLAFLGPLVGALARPLGGWLGDKFGGARITTLDVLVMIASALGAIFFIGMN
                     SFVGFFTMFMLLFITAGIANGSTFRMIPVIFPPKEASAVLGITSAIAAYAAYFIPKAF
                     SWSLQATASPNGAMLAFVAFYVVSLGINWYYYDRRNAEIKC"
     misc_feature    387785..389032
                     /locus_tag="DSY0332"
                     /note="Nitrate/nitrite transporter [Inorganic ion
                     transport and metabolism]; Region: NarK; COG2223"
                     /db_xref="CDD:225133"
     misc_feature    387830..389023
                     /locus_tag="DSY0332"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(387872..387874,387881..387889,387893..387898,
                     387950..387952,387959..387964,387971..387973,
                     387983..387988,387992..387997,388148..388153,
                     388160..388162,388169..388174,388181..388183,
                     388217..388222,388292..388297,388313..388315,
                     388526..388528,388535..388540,388547..388552,
                     388559..388561,388595..388597,388607..388609,
                     388619..388621,388628..388630,388640..388642,
                     388790..388792,388799..388804,388811..388813,
                     388823..388828,388835..388837,388868..388873,
                     388880..388885,388892..388897,388904..388906)
                     /locus_tag="DSY0332"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            389089..390309
                     /locus_tag="DSY0333"
                     /db_xref="GeneID:3955818"
     CDS             389089..390309
                     /locus_tag="DSY0333"
                     /note="similarity to COG2223 Nitrate/nitrite
                     transporter(Evalue: 1E-107)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate/nitrite transporter"
                     /protein_id="YP_516566.1"
                     /db_xref="GI:89893079"
                     /db_xref="GeneID:3955818"
                     /translation="MTSGKGFLKSGHLGTLIASFFYFDISFMIWVLLGVTSTFVVGEF
                     QMTDAQKGLMVGLPVLGGAFLRIPMGLLADRFGGKKIGIIGMLVTMVPLLWGYLFGNG
                     IGEIYALGLLLGVSGASFAVALPLASRWYPPEHQGLAMGIAGAGNSGTVLATLFAPRL
                     AEQVGWHGVFGLALIPLTVALAVFIFLAKDNPNAPKPQGVSAYLQIVKHKETWLYSFF
                     YSLTFGGFVGMTSYLSLFFVDQYQLSKVTAGDFVTLIVFAGSFIRPIGGYLGDRLGGM
                     KMLIGLYLVLSMLLLLAGTLPSSAYVALGVLFLTMLFFGIGNGALFQVIPTEFPKEVG
                     IMTGFVGAAGGVGGFILPNILGNVKGLTGSYSYGFWWLAATFLAAALLVFVLRKSRSK
                     LSSLPEPGLAKNSV"
     misc_feature    389107..390198
                     /locus_tag="DSY0333"
                     /note="Nitrate/nitrite transporter [Inorganic ion
                     transport and metabolism]; Region: NarK; COG2223"
                     /db_xref="CDD:225133"
     misc_feature    389134..390087
                     /locus_tag="DSY0333"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(389176..389178,389185..389193,389197..389202,
                     389251..389253,389260..389265,389272..389274,
                     389284..389289,389293..389298,389437..389442,
                     389449..389454,389461..389463,389470..389472,
                     389506..389511,389518..389523,389536..389538,
                     389755..389757,389764..389769,389776..389781,
                     389788..389790,389830..389832,389842..389844,
                     389854..389856,389863..389865,389875..389877,
                     390019..390021,390028..390033,390040..390042,
                     390052..390057,390064..390066)
                     /locus_tag="DSY0333"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            390328..393999
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /db_xref="GeneID:3958213"
     CDS             390328..393999
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG0243 Anaerobic dehydrogenases,
                     typically selenocysteine-containing(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit alpha"
                     /protein_id="YP_516567.1"
                     /db_xref="GI:89893080"
                     /db_xref="GeneID:3958213"
                     /translation="MKLWKKMRFFQQATEKYADGWSSSAVKDRDWEDLYRQRWQHDKV
                     VRTTHGVNCTGSCSWKVFVKNGLITWEHQQRDYPGTDPDMPEFEPRGCPRGASYSWYV
                     YSPLRVRFPYIRRILLELWREALELHENPLEAWQSIVEDPEKAGQYKKARGKGGFLRC
                     TWSEVYRLIAAQMLYTIKTYGPDRIAGFTPIPAMSMVSYAAGARFISLVGGPMLSFYD
                     WYADLPPASPQIWGEQTDVPESSDWYNSGYLIMWGSNVPLTRTPDAHFMTEVRYKGTK
                     VVAVSPDYAENVKFADSWMAVKPGSDGALAQAMTHVILKEFYVDKSSPYFVEYAKRFT
                     DLPFLVTLNQWGDCYVTGRFLLASDLGWDIVNPEWQTVVCNEVTGEMTVPNGSIGTRW
                     GDHLKWNLKQEDVYGQSLEPLLSLAEQADERVMVAFPYFDNRSKGVKKRELPVRRIRK
                     GDKEFYVTTVYDLMLAHYGVSRKGLTRGYPQDYDDQESYTPAWQEQITGVPREQVIQI
                     AREFAENAEQTQGRSMIIMGAGANHWFNSDTIYRAILNLVLLTGCQGVNGGGWAHYVG
                     QEKCRPIEGWNAIAFARDWSAPPRLQNATSFYYFATDQWRYEELPMSQLTAATVGKPR
                     YEHPADYNVLAAQLGWLPSYPQFNVNNLQIADMARAAGAVSPQEVADYVVSSLQEKTI
                     RFAAENPDDPRNFPRTLWVWRSNLLSSSGKGHEYFMKHLLGASHGLLAEENISFKPEK
                     MVWQEAAEGKLDLLINLEFRMTGTALHSDILLPAATWYEKHDLSSTDMHPFVHPFNPA
                     IDPPWEAKTDWNIFRGMAEVFSDMAAKYFPGVHQDLVAVPLMHDSVDEIAQPFGRVRE
                     WSKGEVAPVPGKTMPKLVPVERDYGLIHEKYSSLGPLLEKNPVGAHGISFSVADQYHQ
                     LKAINGTVEAGLAAGRPKLETARQAAEAMLTLSSATNGKVAMKAWEAEEGKTGLLLKD
                     IAEERAGERLTFDGITAQPRQVIPTPVFTGSNKGNRRYSPFTTNIERLVAFRTLTGRQ
                     QFYLDHEVILEYGEGLPIFKPTLQLLVLADRDQQPSRKEKEIVLRYLTPHGKWNIHST
                     YQDNIHMLTLFRGGPHIWLNHQDAQEADIGDNDWVELYNRNGVVVARAVLTHRLPRGT
                     TFMYHAQDKHINMPGSTITGERGGTHNSPTRIHIKPTQCIGGYAQLSYGFNYYGPIGN
                     QRDVYVSIRKLNEVNWLEN"
     misc_feature    390331..393987
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="Nitrate reductase alpha subunit [Energy production
                     and conversion]; Region: NarG; COG5013"
                     /db_xref="CDD:227346"
     misc_feature    390331..390444
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="Respiratory nitrate reductase alpha N-terminal;
                     Region: Nitr_red_alph_N; pfam14710"
                     /db_xref="CDD:258847"
     misc_feature    390451..392775
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="Respiratory nitrate reductase A (NarGHI), alpha
                     chain (NarG) and related proteins. Under anaerobic
                     conditions in the presence of nitrate, E. coli synthesizes
                     the cytoplasmic membrane-bound quinol-nitrate
                     oxidoreductase (NarGHI), which reduces nitrate to...;
                     Region: MopB_Nitrate-R-NarG-like; cd02750"
                     /db_xref="CDD:239151"
     misc_feature    order(390472..390474,390484..390486,390496..390498,
                     390502..390504,390601..390603)
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239151"
     misc_feature    order(390475..390477,390481..390483,390607..390609,
                     390895..390897,390985..390987,390991..390993,
                     391084..391086,391090..391092,391099..391104,
                     391165..391167,391171..391176,391180..391182,
                     391225..391227,391231..391233,391909..391920,
                     391924..391929,392020..392022,392434..392442,
                     392452..392457,392596..392607,392656..392658,
                     392665..392667,392749..392751)
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="molybdopterin cofactor binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239151"
     misc_feature    393544..393966
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="Respiratory nitrate reductase A (NarGHI), alpha
                     chain (NarG) and related proteins. Under anaerobic
                     conditions in the presence of nitrate, E. coli synthesizes
                     the cytoplasmic membrane-bound quinol-nitrate
                     oxidoreductase (NarGHI), which reduces nitrate to...;
                     Region: MopB_CT_Nitrate-R-NarG-like; cd02776"
                     /db_xref="CDD:239177"
     misc_feature    order(393559..393570,393577..393591,393778..393780,
                     393844..393846,393940..393945)
                     /gene="narG"
                     /locus_tag="DSY0334"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239177"
     gene            393989..395440
                     /gene="narH"
                     /locus_tag="DSY0335"
                     /db_xref="GeneID:3958214"
     CDS             393989..395440
                     /gene="narH"
                     /locus_tag="DSY0335"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG1140 Nitrate reductase beta
                     chain(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit beta"
                     /protein_id="YP_516568.1"
                     /db_xref="GI:89893081"
                     /db_xref="GeneID:3958214"
                     /translation="MKIKAQIAMVINLDKCIGCHTCSVTCKNTWTNRSGAEYMWFNNV
                     ETKPGAGYPDQWEDQQRYKGGWHLRKGQLTLRSGFRWQGLSLSRIFYNPNSPTIDDYY
                     EPWTYDYQKLLKSPVRRHMPTARPQSLLTGEYIEKLRKGPNWDDDLAGGPQAGGRDPN
                     LRDLLGEEVRLEFEKAFMLYLPRLCEHCLNPGCVASCPSGAIYKRDEDGIVLVDQEKC
                     RGWRYCTSGCPYKKVYYNWKTYKAEKCTFCYPRVEEGVATVCSETCPGRLRYMGVLLY
                     DADRVPRAAAQPDEQALYQAQLELFLDPHDPAVIAQARRDGIQEDWLAAAQISPVYKL
                     AVQYGLALPLHPEFRTLPMVWYIPPLSPMVSVLESRTSGSVTTGFFPTLEQMRAPVQY
                     LANFLTGGNPQPVERALRRLLGMRHFMRSLETGQENQEQLLETIGLSEQTVRHMYRLL
                     AVAKYEDRIVIPLAHREESRKAHQEQGKVGYAL"
     misc_feature    393989..395431
                     /gene="narH"
                     /locus_tag="DSY0335"
                     /note="Nitrate reductase beta subunit [Energy production
                     and conversion]; Region: NarY; COG1140"
                     /db_xref="CDD:224063"
     misc_feature    394517..394810
                     /gene="narH"
                     /locus_tag="DSY0335"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     misc_feature    395066..395311
                     /gene="narH"
                     /locus_tag="DSY0335"
                     /note="Respiratory nitrate reductase beta C-terminal;
                     Region: Nitr_red_bet_C; pfam14711"
                     /db_xref="CDD:258848"
     gene            395454..395987
                     /gene="narJ"
                     /locus_tag="DSY0336"
                     /db_xref="GeneID:3958216"
     CDS             395454..395987
                     /gene="narJ"
                     /locus_tag="DSY0336"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG2180 Nitrate reductase delta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit delta"
                     /protein_id="YP_516569.1"
                     /db_xref="GI:89893082"
                     /db_xref="GeneID:3958216"
                     /translation="MNKKDVFCLLAYLLQYPQADWIDPEELRREAENWEEGDTRSRLN
                     LFVDYLQSAPLNVLQENFVETFDFSKKTTLYLLYPQYGEEPKRVEVLQELIQEYQKAG
                     LLIGQELPDYLPLVLEALSNVAIDRGRIILKPVYAGLQYLHDQLVKMNSPYALLLEVC
                     LSSIHSLFGEIGGVTAT"
     misc_feature    395469..395936
                     /gene="narJ"
                     /locus_tag="DSY0336"
                     /note="Nitrate reductase delta subunit; Region:
                     Nitrate_red_del; cl00958"
                     /db_xref="CDD:260720"
     gene            395984..396700
                     /gene="narI"
                     /locus_tag="DSY0337"
                     /db_xref="GeneID:3958215"
     CDS             395984..396700
                     /gene="narI"
                     /locus_tag="DSY0337"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG2181 Nitrate reductase gamma
                     subunit(Evalue: 5E-59)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit gamma"
                     /protein_id="YP_516570.1"
                     /db_xref="GI:89893083"
                     /db_xref="GeneID:3958215"
                     /translation="MMNQLLWVIFPYTMLTAFVVGHIYRYRSGQIGWTSRSSQLLEKK
                     ALKWGSTLFHFGVLAALCGHVGMLVPKEVMEAIGINEHMYHMAASWGGSTAGVITLIG
                     TIILLLRRLCVKRIRRNSSMGDLFVIVLIAGIVFTGLWNSLVINSFGAGHDYRETVGP
                     WLRGLITLQPRAELMGGVPLFFKLHILMAFAALGLWPFTRLVHVWSFPLTYLKRSRIL
                     YRKWNKAGGTEQERQNTPAA"
     misc_feature    395987..396649
                     /gene="narI"
                     /locus_tag="DSY0337"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; pfam02665"
                     /db_xref="CDD:251457"
     gene            396797..397255
                     /locus_tag="DSY0338"
                     /db_xref="GeneID:3955819"
     CDS             396797..397255
                     /locus_tag="DSY0338"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516571.1"
                     /db_xref="GI:89893084"
                     /db_xref="GeneID:3955819"
                     /translation="MGKQEQEIKIFLEKVRADIGSDFVGLACHDFDSHHIRWQYVAGN
                     LNNLYRKITLWPGRGIAGKVVASGRPMALEDFALKSGDDAREYPILLAEDLRSVMAAP
                     IIECDHVKGVLLIGFRTPHRFTEETLAQLVFFAGQCRELLAEPELNLPEV"
     misc_feature    396809..397210
                     /locus_tag="DSY0338"
                     /note="GAF domain; Region: GAF; pfam01590"
                     /db_xref="CDD:250726"
     gene            397212..398330
                     /locus_tag="DSY0339"
                     /db_xref="GeneID:3955820"
     CDS             397212..398330
                     /locus_tag="DSY0339"
                     /note="similarity to COG0642 Signal transduction histidine
                     kinase(Evalue: 2E-32)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516572.1"
                     /db_xref="GI:89893085"
                     /db_xref="GeneID:3955820"
                     /translation="MSCWRNRSLIYLRSEGGLLLRNQGRGVITLYWKCQKEAGSNELL
                     NQITEQIPNPVLVSNEAGWVIGANGAVMRLTGWSFQELTTGRMTVFRHNSPIDDWYNL
                     GGDEGHGLEVCLEKQDGMRLKLPIESVFTYRPPGQAVVAILREFSPQQEEYVQNLLTK
                     YIIRAQEDERKRVSRELHDELGQNIYSVLVGLQVLEKAMPEAVQIQNLQQMVARSLAM
                     LKNIAVELRPSTLDDLGLAAAIRSFLKHFEQTYGIEGQLTVSGEQHRYEPEIETALYR
                     ICQEAMLNVAKYAKVTEVQVFLQNYPDQLNLIVEDQGVGFDVGQLEIQGTGLGLYGMK
                     ERAQLVGGKVEIVSQVNLGTRVQATIPLTEKGGIWHAH"
     misc_feature    397335..>397457
                     /locus_tag="DSY0339"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    <397620..398297
                     /locus_tag="DSY0339"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    397716..397904
                     /locus_tag="DSY0339"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    398031..398291
                     /locus_tag="DSY0339"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(398049..398051,398061..398063,398070..398072,
                     398136..398138,398142..398144,398148..398150,
                     398154..398159,398190..398201,398247..398249,
                     398253..398255,398268..398273,398277..398279)
                     /locus_tag="DSY0339"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    398061..398063
                     /locus_tag="DSY0339"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(398148..398150,398154..398156,398190..398192,
                     398196..398198)
                     /locus_tag="DSY0339"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            398266..398970
                     /locus_tag="DSY0340"
                     /db_xref="GeneID:3955821"
     CDS             398266..398970
                     /locus_tag="DSY0340"
                     /note="similarity to COG2197 Response regulator containing
                     a CheY-like receiver domain and an HTH DNA-binding
                     domain(Evalue: 2E-41)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516573.1"
                     /db_xref="GI:89893086"
                     /db_xref="GeneID:3955821"
                     /translation="MEHVSRPQSPLPKKEGFGMPIRILIGDDHAIVRSGLTMLINSHD
                     DMEVVGTAADGRETFELAMKLKPDVILLDLSMPPGENGLSATLRIKDAAPEIQILILT
                     MHDDEEYIFKILQAGASGYILKSAYDNDLINAIRTIYHGNAYLGPSITKTLIHEFAQR
                     SLHGNESGTDLTVREQNFLSLMAMGYSNKEIAEELSVSVKTVESYRSKIKDKLNLKTR
                     HELVRYALKKGLMDLE"
     misc_feature    398326..398964
                     /locus_tag="DSY0340"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    398335..398679
                     /locus_tag="DSY0340"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(398344..398349,398482..398484,398509..398511,
                     398569..398571,398626..398628,398635..398640)
                     /locus_tag="DSY0340"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    398482..398484
                     /locus_tag="DSY0340"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(398491..398496,398503..398511)
                     /locus_tag="DSY0340"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    398635..398643
                     /locus_tag="DSY0340"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    398776..398946
                     /locus_tag="DSY0340"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(398779..398787,398824..398832,398854..398859,
                     398863..398868,398872..398886,398917..398919)
                     /locus_tag="DSY0340"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(398812..398814,398818..398820,398824..398826,
                     398917..398925,398932..398934,398941..398946)
                     /locus_tag="DSY0340"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            399249..399674
                     /locus_tag="DSY0341"
                     /db_xref="GeneID:3955822"
     CDS             399249..399674
                     /locus_tag="DSY0341"
                     /note="similarity to COG1725 Predicted transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516574.1"
                     /db_xref="GI:89893087"
                     /db_xref="GeneID:3955822"
                     /translation="MRAIILNSDSIKPIYIQIAEWLEAEILKGNLTEDERIYSQYQLA
                     EIFTINPATAAKGLNLLADEEIVYKKRGLGMFVSPHAKSYILQKRKNQILGQMIRDLV
                     DEAVRLGVRKTELLEMIELAHQEADDRDREAGGEEEEKQ"
     misc_feature    399258..399608
                     /locus_tag="DSY0341"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1725"
                     /db_xref="CDD:224639"
     misc_feature    399285..399482
                     /locus_tag="DSY0341"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(399285..399287,399291..399293,399360..399362,
                     399366..399371,399393..399407,399411..399416,
                     399423..399425,399453..399458,399462..399473)
                     /locus_tag="DSY0341"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     gene            399671..400585
                     /locus_tag="DSY0342"
                     /db_xref="GeneID:3955823"
     CDS             399671..400585
                     /locus_tag="DSY0342"
                     /note="similarity to COG1131 ABC-type multidrug transport
                     system, ATPase component(Evalue: 7E-40)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516575.1"
                     /db_xref="GI:89893088"
                     /db_xref="GeneID:3955823"
                     /translation="MSVVVGYELYKRYGKVQALGDVSFAIEENTITGLIGRNGTGKTT
                     LLKMMAGHLKPTQGKLRVFAQNPFDNLDVAGKVFLVDDTMAFPDSFTLQDILREVAVF
                     YPNWNSQIAQGLLEYFLLNPQQRHSNLSKGSKSTFNAILGIAARCPLTLLDEPTTGMD
                     SAVRKDFYRVLLKDYLEQPRTIILSSHLLGELEDILEDILLLNQGGLLMHKPILDLKQ
                     YALGFRGSAQALQESLLNRLSEEAVLHREEFVKGSLYLVIKTEELPEDFENIRSSGVE
                     ILPVALDDLCNILTAPRKGGIDDVYKRG"
     misc_feature    399671..400480
                     /locus_tag="DSY0342"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    399695..400291
                     /locus_tag="DSY0342"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    399776..399799
                     /locus_tag="DSY0342"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(399785..399790,399794..399802,399914..399916,
                     400127..400132,400229..400231)
                     /locus_tag="DSY0342"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    399905..399916
                     /locus_tag="DSY0342"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    400055..400084
                     /locus_tag="DSY0342"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    400115..400132
                     /locus_tag="DSY0342"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    400139..400150
                     /locus_tag="DSY0342"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    400217..400237
                     /locus_tag="DSY0342"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            400602..401327
                     /locus_tag="DSY0343"
                     /db_xref="GeneID:3955824"
     CDS             400602..401327
                     /locus_tag="DSY0343"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516576.1"
                     /db_xref="GI:89893089"
                     /db_xref="GeneID:3955824"
                     /translation="MSQMILKQYGYKLKGHSGLIYSLIIVQLLAILLSLGSSSGMSSN
                     SDLISIAVRTYTGDILLICSLLWLMVVASLLGSQPYRSMEFSVVNNRLVSHASNILLL
                     VTYAVYAGVTSTLAVIIHRLILSATLKEGEFLFGGLQIIPQDLLLGIFVATLYFILVA
                     ATVYLIQSFSLHSKGLGIILWICFFAFGFGTVRIFDFNLGKVLEFYAAETSLGVFVLK
                     VFCTAVLFFGSSMLITKGMEAKR"
     gene            401324..402082
                     /locus_tag="DSY0344"
                     /db_xref="GeneID:3955825"
     CDS             401324..402082
                     /locus_tag="DSY0344"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516577.1"
                     /db_xref="GI:89893090"
                     /db_xref="GeneID:3955825"
                     /translation="MTKLLFTNIIFLFLIIGLIYLLAKFVRPRLRRVYRWKTNLLIAG
                     AYLALLVVSIPLALFLDQGEFFQSRNAQAQGMLAEAPADWSEDGGRRYHIFENEPLER
                     QAGLVENSRQTYAADTPQLRIQTAGSTGYGRIFLERKKNADGLIEVSTYVAPHYARTD
                     TFKPIDFTKLVAPPQITWEAGVLKIGDPVKQSFEFKMYSDSFPVWQFKEEKQSNYIGG
                     GSMTFGEKGILVRIPPDMEVVDGDSGEFTWVSNQ"
     gene            complement(402145..402387)
                     /locus_tag="DSY0345"
                     /db_xref="GeneID:3955826"
     CDS             complement(402145..402387)
                     /locus_tag="DSY0345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516578.1"
                     /db_xref="GI:89893091"
                     /db_xref="GeneID:3955826"
                     /translation="MKKDATRIKLSKEQKEEMASAIQRYFLQERDEEIGALASSLMLD
                     FIIKELAPEFYNQGVSDSYQFMNERTEDLFSLQIYR"
     misc_feature    complement(402169..402366)
                     /locus_tag="DSY0345"
                     /note="Uncharacterized conserved protein (DUF2164);
                     Region: DUF2164; pfam09932"
                     /db_xref="CDD:204345"
     gene            complement(402384..403292)
                     /locus_tag="DSY0346"
                     /db_xref="GeneID:3955827"
     CDS             complement(402384..403292)
                     /locus_tag="DSY0346"
                     /note="similarity to COG0500 SAM-dependent
                     methyltransferases(Evalue: 1E-62)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516579.1"
                     /db_xref="GI:89893092"
                     /db_xref="GeneID:3955827"
                     /translation="MPKSVLLSDGLADKYAGLLKCPICHNSMALINKKSLICRDKHCF
                     DLAKQGYVNLLSHGIKTKYNKQLFEARKLLAQSGFFEPLNQLLCTLIGNLMNNSEGKA
                     QGPSLNIVDAGCGEGSHLATIQQKLLQSRGIQPLGVGMDLAKEGIQMAARDYGSILWC
                     VADLAQCPFGDQQFNVLLNILSPANYSEFARILTDDGLIIKVVPEKDYLKELREILYK
                     ETAKQDYSNAKTRELFENHLQLCKLVPLRYSVTLDQPLIGNLVQMTPLTWGAEETRIA
                     KVLKLESLEITIDLTIMVGQKREERS"
     misc_feature    complement(402402..403232)
                     /locus_tag="DSY0346"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            403398..403721
                     /locus_tag="DSY0347"
                     /db_xref="GeneID:3955828"
     CDS             403398..403721
                     /locus_tag="DSY0347"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516580.1"
                     /db_xref="GI:89893093"
                     /db_xref="GeneID:3955828"
                     /translation="MGSRGGRRMKMRKSMVFSGLALVLMLFILTGCIPGDGSYDFDKP
                     AGFLSGVWHGWIAPLSLIMGIFSETVRVYEVFNTGWWYDFGFYIAVISGFGGLSLSRK
                     KKKDK"
     misc_feature    403422..>403598
                     /locus_tag="DSY0347"
                     /note="OxaA-like protein precursor; Provisional; Region:
                     PRK02463"
                     /db_xref="CDD:235040"
     gene            403886..404185
                     /locus_tag="DSY0348"
                     /db_xref="GeneID:3955829"
     CDS             403886..404185
                     /locus_tag="DSY0348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516581.1"
                     /db_xref="GI:89893094"
                     /db_xref="GeneID:3955829"
                     /translation="MYQEKVITCKDCGAEFVFSVSEQEFYAEKGFTNEPGRCPSCRAA
                     RKQQSRGGNGGYQRQERQMYPAVCASCGVDTMVPFQPSGDKPVYCRDCFTPRSRY"
     misc_feature    403892..404038
                     /locus_tag="DSY0348"
                     /note="Probable zinc-binding domain; Region: zf-trcl;
                     pfam13451"
                     /db_xref="CDD:257776"
     misc_feature    404066..404173
                     /locus_tag="DSY0348"
                     /note="CxxC-x17-CxxC domain; Region: cxxc_cxxc_Mbark;
                     TIGR04272"
                     /db_xref="CDD:211995"
     gene            404366..405457
                     /locus_tag="DSY0349"
                     /db_xref="GeneID:3955830"
     CDS             404366..405457
                     /locus_tag="DSY0349"
                     /note="similarity to COG1680 Beta-lactamase class C and
                     other penicillin binding proteins(Evalue: 1E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516582.1"
                     /db_xref="GI:89893095"
                     /db_xref="GeneID:3955830"
                     /translation="MKSKILLLMAMLIGSVYLTGCGRIAEPEQGTVMEEREQQNPEQR
                     DVLVWEWQYGAPEDHGLNGDTLESLHATYDTTQILASVIFKDGHIVDEYYKDGYDKAS
                     LFLLHSCSKSVTSALIGIAIDKGYIESVDVPIAEYFPQILESDDNRLKQITLGHLLTN
                     TSGFDSSDTEYWREWRNSENWVDFVLNRPLTSTPGTVFSYSTGNTHLLAAILQKATGK
                     TAYEFGKEFLFDLIGMDSVQCNMDSQGISDGGNGFSMTVYDMVKFGLLYYHGGLWGEQ
                     QIISREWVEESTRLQFKRSSGTADYGYQWWVRTFGEEQYDTFFAQGHGGQYIFVIPEL
                     ELIIAFTSNHTGSSDMYWQFVNDIVAASD"
     misc_feature    404609..405403
                     /locus_tag="DSY0349"
                     /note="Beta-lactamase class C and other penicillin binding
                     proteins [Defense mechanisms]; Region: AmpC; COG1680"
                     /db_xref="CDD:224594"
     gene            405677..407308
                     /locus_tag="DSY0350"
                     /db_xref="GeneID:3955831"
     CDS             405677..407308
                     /locus_tag="DSY0350"
                     /note="similarity to COG0840 Methyl-accepting chemotaxis
                     protein(Evalue: 3E-53)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516583.1"
                     /db_xref="GI:89893096"
                     /db_xref="GeneID:3955831"
                     /translation="MELKGWGCRVTIRSTLRAIVVLLLLFSVTSTVVVFYQLEKMQQD
                     GAVINTAGVVRGATQRLIKLEMAKQPNDELIQKLDGIIEGLIQGDESLGLPKASDEVF
                     IQEMNKVKSEWQSLKGTIESAQRSGDMTALVQESESYFATTNAAVAAAEGFSAAKVKA
                     LKVIQSVLMVFNLILLIAIWFMSSNRISQPIQKLIGIVEHLNVSENIPEHFMNRKDEV
                     GGLSRAFQGVIHNIRDLVAGLALSSEKLADSAAFLGNISQESSTAAMEIAKTIEGIAL
                     GASDQANEIQNGVAQMDVLGHLVAEDQKKVEDLRQATDRVEQLKDEGTMILADLIKIT
                     DQNGKSAQEVQETILETNESAKNIVEASLKIKEIAAQTNLLALNAAIEAARAGEQGRG
                     FAVVAEEIRKLAEESNRFTTEIENITKVLTLKTREAVVKMGEMDSVVKIQSESVSATE
                     TKFAGIAEAIDRIQGYTEIISNSTDGIADKNQSIMNMIQSLSAISEESAASTQEVSAS
                     VQEQTAAMDQIAGASQELAALAEELESSMQQFTQR"
     misc_feature    405803..406087
                     /locus_tag="DSY0350"
                     /note="Type IV pili methyl-accepting chemotaxis transducer
                     N-term; Region: PilJ; pfam13675"
                     /db_xref="CDD:257980"
     misc_feature    406175..406378
                     /locus_tag="DSY0350"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    406472..407236
                     /locus_tag="DSY0350"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    406559..407209
                     /locus_tag="DSY0350"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    order(406577..406582,406589..406594,406601..406603,
                     406610..406615,406619..406624,406631..406633,
                     406640..406645,406652..406654,406661..406666,
                     406673..406678,406685..406687,406694..406699,
                     406703..406708,406718..406720,406724..406729,
                     406736..406738,406745..406750,406757..406762,
                     406769..406771,406778..406780,406787..406792,
                     406799..406801,406811..406813,406820..406822,
                     406841..406843,406853..406855,406862..406864,
                     406871..406876,406883..406885,406892..406897,
                     406904..406909,406913..406918,406925..406930,
                     406967..406972,406979..406981,406988..406993,
                     407000..407002,407009..407014,407018..407023,
                     407030..407035,407042..407044,407051..407056,
                     407126..407128,407135..407140,407144..407149,
                     407156..407161,407165..407170,407177..407179,
                     407186..407191,407198..407200,407207..407209)
                     /locus_tag="DSY0350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    406787..406888
                     /locus_tag="DSY0350"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            407438..408439
                     /locus_tag="DSY0351"
                     /db_xref="GeneID:3953616"
     CDS             407438..408439
                     /locus_tag="DSY0351"
                     /note="similarity to COG3458 Acetyl esterase
                     (deacetylase)(Evalue: 7E-46)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516584.1"
                     /db_xref="GI:89893097"
                     /db_xref="GeneID:3953616"
                     /translation="MTIIQDAIQQLETIPYRGVPPEDFKEFWLESLRRDAQTKARLEL
                     EAIAYPLSKVEVFSATVLSGDRTKLKGYYMRPRAIDLQEALPGLVRFHGYSGNRGQLS
                     ELLLWALQGYAVLALDVRGQCGETPDTRVYPSGAFSGWLTLGLESPHTHYLRQVYLDG
                     VRAVEALANQPEVDEKRIGCMGKSQGGGLAVIAGGVINALGQEVNLKGGVKAVSAAMP
                     FLADFRSSYQLQKGGPLEELAWYFQLHDPEHQREEGIFTTLDYFDGVHFAPWLGKKTA
                     CLVSMGLKDTVCPPATVYWLYKGICGEKKLLIYPEYEHESPDGFVDRQIEFFAKELL"
     misc_feature    407438..408433
                     /locus_tag="DSY0351"
                     /note="Acetyl xylan esterase (AXE1); Region: AXE1;
                     pfam05448"
                     /db_xref="CDD:253201"
     misc_feature    407741..408433
                     /locus_tag="DSY0351"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            408632..408949
                     /locus_tag="DSY0352"
                     /db_xref="GeneID:3953617"
     CDS             408632..408949
                     /locus_tag="DSY0352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516585.1"
                     /db_xref="GI:89893098"
                     /db_xref="GeneID:3953617"
                     /translation="MSYAAFFEPIFRRRFMEYQNAKNILPEKLIDEIQKYIQGQTLYI
                     PRKTSHKTGWGEMNGTKAALRERNQSIMRLYRVGSRIEDIAAQYYLSPDSVRKIVSTQ
                     NMD"
     gene            409012..410769
                     /locus_tag="DSY0353"
                     /db_xref="GeneID:3953618"
     CDS             409012..410769
                     /locus_tag="DSY0353"
                     /note="similarity to COG0642 Signal transduction histidine
                     kinase(Evalue: 8E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516586.1"
                     /db_xref="GI:89893099"
                     /db_xref="GeneID:3953618"
                     /translation="MVSVFFNESFFLLVFYSASFNVKIDRGVLLKVKKLKYQLIIPTV
                     IIVFILMSINIVLVFQIQQKQAVNELKEKGLALTQQLDSTWEFLSINQHRINTSAKGD
                     FDFKGLNCSTAGMSIGVIFAEKNGYKIRYVNTNPRNPLNEPDPFEKRVLEKFANDTAI
                     DSYWELVKEEGQRYFCYVTPMRIDETCLECHGEPAGEMDISGYAKEGMKIGDLAGAIS
                     ITMPTTIQDQALVFNMFWQCMTFTLLIIGCVLAIYYFVTKRVTKPIEHLETAVKQVGE
                     GDLNVDLQNFRAAEEIEGLADHFNNMAKQLKELYSDLEHKVELRTSELGKANEQLQIK
                     QIQLEKVNTLLKEDSQYKADFLAMVSHELRTPLTAIIIFAEILLKKKRFEDSSEEQIL
                     CEIKENSEVLLHMINNILDLARLETGRNSLSIETVDLVDVINNVECVIRPLAQRNDIH
                     LTARVERGVPLIQGDYEKVRRIIENLAGNAIKFTPLGGKVNIQASLAEDPHYVKITVQ
                     DDGIGISKENQAHIFEKFIQVDSSSSRQYNGSGLGLALAKELTELHGGVISVESDLNK
                     GSTFIVLLPIERPQRGDAE"
     misc_feature    409144..409677
                     /locus_tag="DSY0353"
                     /note="Protein of unknown function (DUF3365); Region:
                     DUF3365; pfam11845"
                     /db_xref="CDD:256666"
     misc_feature    409654..410766
                     /locus_tag="DSY0353"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: VicK; COG5002"
                     /db_xref="CDD:227335"
     misc_feature    409789..409935
                     /locus_tag="DSY0353"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(409789..409794,409801..409806,409810..409815,
                     409822..409827,409831..409833,409882..409887,
                     409891..409896,409903..409908,409912..409917,
                     409924..409929)
                     /locus_tag="DSY0353"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    410056..410253
                     /locus_tag="DSY0353"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(410074..410076,410086..410088,410098..410100,
                     410107..410109,410119..410121,410128..410130,
                     410179..410181,410194..410196,410203..410205,
                     410215..410217,410224..410226,410236..410238)
                     /locus_tag="DSY0353"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    410092..410094
                     /locus_tag="DSY0353"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    410419..410733
                     /locus_tag="DSY0353"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(410434..410436,410446..410448,410455..410457,
                     410530..410532,410536..410538,410542..410544,
                     410548..410553,410632..410643,410689..410691,
                     410695..410697,410710..410715,410719..410721)
                     /locus_tag="DSY0353"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    410446..410448
                     /locus_tag="DSY0353"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(410542..410544,410548..410550,410632..410634,
                     410638..410640)
                     /locus_tag="DSY0353"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            410766..411455
                     /locus_tag="DSY0354"
                     /db_xref="GeneID:3953619"
     CDS             410766..411455
                     /locus_tag="DSY0354"
                     /note="similarity to COG0745 Response regulators
                     consisting of a CheY-like receiver domain and a
                     winged-helix DNA-binding domain(Evalue: 1E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516587.1"
                     /db_xref="GI:89893100"
                     /db_xref="GeneID:3953619"
                     /translation="MKIMLVDDERSIQKAVEYIVRENGYQFCYVDNGLEALEVFAGEA
                     PDLLILDVMLPGLDGFAVCEKIRSFSDVPIIFLSAKGDIVDKGIGFKMGGDDYLVKPF
                     SSMELDFRIKALLRRPHRLEDEPNNSDEVLKIGDLELRLNEYEVYSGGEKVELTAKEF
                     EVLAFLAKNRGQVFTREQLLDRIWGLDFEGDTNTVTVFIRRIREKIEADPAKPQYILT
                     VWGVGYKFKSK"
     misc_feature    410766..411452
                     /locus_tag="DSY0354"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    410775..411110
                     /locus_tag="DSY0354"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(410784..410789,410916..410918,410940..410942,
                     410997..410999,411054..411056,411063..411068)
                     /locus_tag="DSY0354"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    410916..410918
                     /locus_tag="DSY0354"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(410925..410930,410934..410942)
                     /locus_tag="DSY0354"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    411063..411071
                     /locus_tag="DSY0354"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    411159..411443
                     /locus_tag="DSY0354"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(411231..411233,411288..411293,411345..411347,
                     411354..411356,411378..411383,411417..411419,
                     411432..411434)
                     /locus_tag="DSY0354"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(411577..412374)
                     /gene="dmsC"
                     /locus_tag="DSY0355"
                     /db_xref="GeneID:3958146"
     CDS             complement(411577..412374)
                     /gene="dmsC"
                     /locus_tag="DSY0355"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG3302 DMSO reductase anchor
                     subunit(Evalue: 2E-21)"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic DMSO reductase anchor subunit C"
                     /protein_id="YP_516588.1"
                     /db_xref="GI:89893101"
                     /db_xref="GeneID:3958146"
                     /translation="MHSWPLYLFTLAIQSAVGGCIMLMLYNILLKKVLAKDTLQKANL
                     KSLTALTVLSVLGLGFSFFDIGYPLNAVNAITNLGASWLSREILFTVLFIALVSVALA
                     ANWKTQHLSQALLAAAGIAGLAVIFAMGSLYSHTIFEPWNSFNTLIGFYGSTIILGAV
                     LINLIFFPVFKNTRGSFEAIKLPTLLAVLAAFIIQFAFIAALGSSLAILNPAMSLVRW
                     FCSALAALLLVYLYFKDPKKSELLYISFGLLLVGELIGRYLFYLPLS"
     misc_feature    complement(411592..412374)
                     /gene="dmsC"
                     /locus_tag="DSY0355"
                     /note="DMSO reductase anchor subunit (DmsC); Region: DmsC;
                     cl17519"
                     /db_xref="CDD:248073"
     gene            complement(412400..412972)
                     /gene="dmsB"
                     /locus_tag="DSY0356"
                     /db_xref="GeneID:3958130"
     CDS             complement(412400..412972)
                     /gene="dmsB"
                     /locus_tag="DSY0356"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG0437 Fe-S-cluster-containing
                     hydrogenase components 1(Evalue: 8E-60)"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic DMSO reductase iron-sulfur subunit B"
                     /protein_id="YP_516589.1"
                     /db_xref="GI:89893102"
                     /db_xref="GeneID:3958130"
                     /translation="MMSVQYGFYINQSRCSGCHACQTSCNDKNDLEPGRLFRRIKETD
                     GGEFTPFNQGYAHNAYAFFTSISCNHCEHPKCTEACPSGAMHKDPETGIVSVNQNRCI
                     GCRYCTWACPYGAPQYNKEAGRMSKCDFCADLLSQGETPVCVAACPYEALDYGPIEEL
                     RAKYGTLADSPDLPSSDETHPNIVLKPHKR"
     misc_feature    complement(412478..412960)
                     /gene="dmsB"
                     /locus_tag="DSY0356"
                     /note="DMSO reductase, iron-sulfur subunit; Region:
                     DMSO_dmsB; TIGR02951"
                     /db_xref="CDD:131996"
     misc_feature    complement(412508..412789)
                     /gene="dmsB"
                     /locus_tag="DSY0356"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     gene            complement(412997..415345)
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /db_xref="GeneID:3958114"
     CDS             complement(412997..415345)
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /EC_number="1.7.99.4"
                     /note="similarity to COG0243 Anaerobic dehydrogenases,
                     typically selenocysteine-containing(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic DMSO reductase subunit A"
                     /protein_id="YP_516590.1"
                     /db_xref="GI:89893103"
                     /db_xref="GeneID:3958114"
                     /translation="MMNLSRRSFLKWSATLGAMGTGLMSLTACSQNASLTGSEAASAG
                     EQIIPTASTQDCGGRCLIKAHVKDGVITRISTRGAYEEDEPGANMKACLRGRSYRKHL
                     YHPDRLKYPMKRVGKRGEGKFEQISWEEAIDTIAKETRRIFDQYGPESRYCNVGTGDT
                     GGVIYRMGLGGRFLSATGGHLPLYNSVSMGNTGTATPYVYGVAATASSLDSLKDTKLV
                     ILWGHNTTETIFGASNYYFRQMKNRGCKFICVDPRNSNTAVAFADEWIPLLPTTDNAL
                     MDAMAYVIVSENLHDQAFLDQYVQGFDEEHMPEGVPAHESLVSYLFGKKDGVEKTPEW
                     AEAICKVPAETIRRIAREYATTKPAALIQGWGPQRHSCGERTALGATMLASITGNVGV
                     LGGWAGGYIGLSRKGCVGLPDVPNPYPGAIPTLSWVDAIECPEKVTPAEGLLGVDKLN
                     SPIKMLLNLAGDFIANQNPDINRTIRVLEDESLVEFIVVSDLFMTPSARYADILLPGN
                     TFFERYNIGATWNNGDYFILSQKIVDNYYESRSEYDWLAEVADKLGAKDVFTGGKTEE
                     EWVRWIVDETRAKYPETLSWEELEKVGISKFHYDGPRVAFQDQIEDPVNNPFPTPSGK
                     IELFSKTLYDMHNPEIPAIPVYVPAWEGPEDELTEKYPLQLIGWKTKARDNSTFYNNP
                     WLQQAMVQEVWINPMDAKPRNIVTGDRVKVFNDRGTTMLQARVTSRVIPGVIAAPTGS
                     WFTPDGKGGCTNGNLNVLTTLRKTALSHGNTQHTSLVEISKL"
     misc_feature    complement(413003..415336)
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /note="anaerobic dimethyl sulfoxide reductase, A subunit,
                     DmsA/YnfE family; Region: dmsA_ynfE; TIGR02166"
                     /db_xref="CDD:233756"
     misc_feature    complement(413387..415201)
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /note="This CD (MopB_DmsA-EC) includes the DmsA enzyme of
                     the dmsABC operon encoding the anaerobic dimethylsulfoxide
                     reductase (DMSOR) of Escherichia coli and other related
                     DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this
                     group has a  predicted...; Region: MopB_DmsA-EC; cd02770"
                     /db_xref="CDD:239171"
     misc_feature    complement(order(415070..415072,415166..415168,
                     415178..415180,415190..415192))
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /note="putative [Fe4-S4] binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239171"
     misc_feature    complement(order(413720..413722,413807..413809,
                     413861..413863,413873..413878,413942..413944,
                     413948..413950,413960..413962,413966..413968,
                     414239..414241,414248..414253,414527..414529,
                     414533..414538,414590..414598,414662..414667,
                     414680..414682,414782..414784))
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239171"
     misc_feature    complement(413003..413365)
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /note="The MopB_CT_DmsA-EC CD includes the DmsA enzyme of
                     the dmsABC operon encoding the anaerobic dimethylsulfoxide
                     reductase (DMSOR) of Escherichia coli and other related
                     DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this
                     group has a  predicted...; Region: MopB_CT_DmsA-EC;
                     cd02794"
                     /db_xref="CDD:239195"
     misc_feature    complement(order(413027..413032,413078..413080,
                     413132..413134,413315..413323,413327..413329,
                     413336..413341,413345..413347))
                     /gene="dmsA"
                     /locus_tag="DSY0357"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239195"
     gene            complement(415345..415980)
                     /locus_tag="DSY0358"
                     /db_xref="GeneID:3953620"
     CDS             complement(415345..415980)
                     /locus_tag="DSY0358"
                     /note="similarity to COG3381 Uncharacterized component of
                     anaerobic dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic dehydrogenase"
                     /protein_id="YP_516591.1"
                     /db_xref="GI:89893104"
                     /db_xref="GeneID:3953620"
                     /translation="MGVHEGRLYVYQLLKHLFEQPLNREGLIELQEQPGLKELAQISS
                     GAQSINDFLVTNKDEYPETLCQALQAEYQRLFVGPGQVLVPIWESVYFDPEHLMFGER
                     TLAVREFYRKYHLESIHKNRQPEDHLAVELEFMTYLIGQYLASEDDVQQTKLLRDQKE
                     FIQKHLATWKDEFLQFLEKSTGCLLYRGGGQLLKEFLDMECETFEHLEEVS"
     misc_feature    complement(415390..415953)
                     /locus_tag="DSY0358"
                     /note="Nitrate reductase delta subunit; Region:
                     Nitrate_red_del; cl00958"
                     /db_xref="CDD:260720"
     gene            416909..419035
                     /locus_tag="DSY0359"
                     /db_xref="GeneID:3953621"
     CDS             416909..419035
                     /locus_tag="DSY0359"
                     /note="similarity to COG0370 Fe2+ transport system(Evalue:
                     1E-139)"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transport protein B"
                     /protein_id="YP_516592.1"
                     /db_xref="GI:89893105"
                     /db_xref="GeneID:3953621"
                     /translation="MEQLAEKSKKREFVKHPGLGETGIFHTKADGDPLPDSQLLTFAL
                     AGNQNCGKTTLFNQLTGSNQRVGNFPGVTVDRKDGVIKGHANTLVTDLPGIYSMSPYS
                     NEELVTRQFLLQDKPKGIINIVDATNIERNLYLTIQLMELNIPMVLALNMMDEVRENG
                     GSIHINEMENRLGIPVVPIAASKNEGIQELVDHAIHVAKNQERPGRMDFCDPDHDNGA
                     VHRCLHAIIHLIEDHAKRAQIPLRFAASKVAEGDEEILKALNLNQNELELLGHIIQQM
                     EDERGLDHGAAIADMRFKFIKEICDATVVKPKESKEYARSVAIDNVLTGKYTAIPAFV
                     GIMSLVFWLTFGVIGTWLADGLDLGITWLSELVDLGLTAYGINPVVHSLIIDGIFAGV
                     GSVLSFLPIIVTLFFFLSILEDSGYMARVAFVMDKLLRKIGLSGRSIVPMLIGFGCSV
                     PGVMASRTLPSERDRKMTILLTPFMSCSAKLPIYALFTAAFFPRYGALVMIGLYFTGI
                     VTGVVFALLLKGTMFKGEPVPFVMELPNYRMPGFKNVWQLLWDKAKDFITRAFTVIFV
                     ATIIIWFLQYFDPRLNAVSDSQDSLLALVSGIIAPIFVPLGFGDWRISTALITGFMAK
                     ESVVSTLTVLLGGSTASLSTMFTPFSAIVFLVFTLLYTPCVAAIASVRRELGGKWAVG
                     VAVMQCVIAWVVALFVNLLGIMMGWV"
     misc_feature    417017..419029
                     /locus_tag="DSY0359"
                     /note="Fe2+ transport system protein B [Inorganic ion
                     transport and metabolism]; Region: FeoB; COG0370"
                     /db_xref="CDD:223447"
     misc_feature    417035..417508
                     /locus_tag="DSY0359"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    417044..417067
                     /locus_tag="DSY0359"
                     /note="G1 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(417053..417055,417059..417070,417359..417364,
                     417368..417370,417446..417454)
                     /locus_tag="DSY0359"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    417122..417136
                     /locus_tag="DSY0359"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    417125..417127
                     /locus_tag="DSY0359"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    417179..417190
                     /locus_tag="DSY0359"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(417188..417244,417254..417259)
                     /locus_tag="DSY0359"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    417359..417370
                     /locus_tag="DSY0359"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    417446..417454
                     /locus_tag="DSY0359"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    418097..418372
                     /locus_tag="DSY0359"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     misc_feature    418403..418564
                     /locus_tag="DSY0359"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:254341"
     misc_feature    418583..418933
                     /locus_tag="DSY0359"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     gene            complement(419261..419722)
                     /locus_tag="DSY0360"
                     /db_xref="GeneID:3953622"
     CDS             complement(419261..419722)
                     /locus_tag="DSY0360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516593.1"
                     /db_xref="GI:89893106"
                     /db_xref="GeneID:3953622"
                     /translation="MNKKKGLLWVALLLILLAFTGCTGSDDQYAPDKAAIETLVNDYF
                     TAAFNIDYTTWTGENELPFLTPDQAKIMQGRFADFKQSFVDNQLTQAVDSVEIIRVNI
                     ETETSGNVYCIIKVSGYDNGSAYRETIEYSMPVKKIEGQWLIDDFKIQSIE"
     gene            419889..420851
                     /locus_tag="DSY0361"
                     /db_xref="GeneID:3953623"
     CDS             419889..420851
                     /locus_tag="DSY0361"
                     /note="similarity to COG1893 Ketopantoate
                     reductase(Evalue: 2E-48)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516594.1"
                     /db_xref="GI:89893107"
                     /db_xref="GeneID:3953623"
                     /translation="MNCQNSEKKGLETMNITIVGAGATGGYFGARLAASGLNVTFLVR
                     EKRAAQLREKGLVIKSVVEDLTLATPQIAINAEDIPACDLVLLGLKNYQLAASLPQLK
                     VLVNRGAKILPFLNGVEHFEILAKELGQENVLGGVCKIISTLDSEGTIHHTSKVHQII
                     FGELEPSGKEFCLGLEQAMAKANFKVKYTENILNEIWSKYAFIAVFSGVTSAGDLTTD
                     QICAHEATVKVYRRSLEEMKSLADAYGVALSEDFVEQNVEGLPKYAKGSTSSMHQDMR
                     KGLLLEVESLQGAAIRLAGRKNMELPTIETLYGLIKPYEMGSVE"
     misc_feature    419928..420833
                     /locus_tag="DSY0361"
                     /note="2-dehydropantoate 2-reductase; Provisional; Region:
                     PRK12921"
                     /db_xref="CDD:183829"
     misc_feature    419934..420386
                     /locus_tag="DSY0361"
                     /note="Ketopantoate reductase PanE/ApbA; Region: ApbA;
                     pfam02558"
                     /db_xref="CDD:251374"
     misc_feature    420459..420833
                     /locus_tag="DSY0361"
                     /note="Ketopantoate reductase PanE/ApbA C terminal;
                     Region: ApbA_C; pfam08546"
                     /db_xref="CDD:254871"
     gene            421247..422083
                     /locus_tag="DSY0362"
                     /db_xref="GeneID:3953624"
     CDS             421247..422083
                     /locus_tag="DSY0362"
                     /note="similarity to COG1348 Nitrogenase subunit NifH
                     (ATPase)(Evalue: 7E-62)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase subunit nifH"
                     /protein_id="YP_516595.1"
                     /db_xref="GI:89893108"
                     /db_xref="GeneID:3953624"
                     /translation="MCRRIALYGKGGIGKSTIASNLAAALAGSGLNVLLIGCDPKADS
                     TRNLTREGIPSVLETLARSEEVSIQNLLHTGDFGVSCVESGGPEAGIGCAGLGISTTL
                     EELTRLGVYDMDWDIILYDVLGDVVCGGFSVPMRKKHVDTVYIVTSADFMSLYAANNI
                     LKSVKRYSYTEKPLLGGILHNRADSAKERAVVQEFCRKTNSAYIAAMGQSTEIRLAEL
                     QRQTVLKAYSDGAAAQAFLELGRRMAGPGQASVPTPLCPQDMDAVGAAILRLLQDEEA
                     GE"
     misc_feature    421253..422035
                     /locus_tag="DSY0362"
                     /note="Nitrogenase subunit NifH (ATPase) [Inorganic ion
                     transport and metabolism]; Region: NifH; COG1348"
                     /db_xref="CDD:224267"
     misc_feature    421253..422032
                     /locus_tag="DSY0362"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            422080..423744
                     /locus_tag="DSY0363"
                     /db_xref="GeneID:3953625"
     CDS             422080..423744
                     /locus_tag="DSY0363"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516596.1"
                     /db_xref="GI:89893109"
                     /db_xref="GeneID:3953625"
                     /translation="MKTPLALCACTQETEEDTASSALFKRSDIAVVAVGPASCLRHLY
                     FLATRLQALQQLHLCCLTTREYALGNFRTKVRESLGRVLGKQAVRGVLVYGTCADILM
                     QVDFEELLAGIENPGDIPIKIFCRGPLAKRKMPAGKRLQMLYGELEEELSMASGQIYR
                     HGEKEFFLPPLAGDFAGVVSMLHAWQWELILYTPGGCRTGLQMDEPMGGPPCFYYTSY
                     NDIHAVLGSERKLVELMRESPRDQERIGRALIGTPVPHITGCDFEWVEQELANPEYPL
                     VCFPCNGFDTYAAGMSRALLTLGQTLFDSRKRESRQILLVGCSAMEPVSRGSLQRAVD
                     KVGEWGFSVSFLGDGDLESIRQAAAGSLCWCVSPAGEALAGWLEETFGTPWFTHLPIG
                     RSGMHRLWQLISERGEAPDGIMKGERAAAGGAAGAVVDVGDVPRILIISEPLTGLGIQ
                     QCLAEDFSYTGSTVAVHGLGGQSIVHFQNPEELQGLVCSADILIADPLYERLARSWGA
                     QPLFIAVPYPALSGNLYARSPIDLIGEAGYQYFASKLGKVRREKKQ"
     misc_feature    422593..423705
                     /locus_tag="DSY0363"
                     /note="The nitrogenase enzyme system catalyzes the
                     ATP-dependent reduction of dinitrogen to ammonia.  This
                     group contains both alpha and beta subunits of component 1
                     of the three known genetically distinct types of
                     nitrogenase systems: a molybdenum-dependent; Region:
                     Oxidoreductase_nitrogenase; cl02775"
                     /db_xref="CDD:261441"
     gene            423741..424847
                     /locus_tag="DSY0364"
                     /db_xref="GeneID:3953626"
     CDS             423741..424847
                     /locus_tag="DSY0364"
                     /note="similarity to COG0614 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, periplasmic
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516597.1"
                     /db_xref="GI:89893110"
                     /db_xref="GeneID:3953626"
                     /translation="MKRFCNGLLASALVLSLLLTGCGAAGGQQPAQASGPEQPAVRTV
                     TDAEGNVVEVPQDISRIAVTPLPWSSVVSAIDGGSQRLASINPGALKAYSGSFFAKLD
                     KNYATLDDTSIGSDFSINVEELLNRQVQVVIIWEYQTAEAAKLKDVGIVPVMVKNGNV
                     QELQDSFKAVGQLLGKEERAKWVNDEYAKAYEKMKSYGEQVKKADKPRVLYLKRSDLT
                     LQGNDNFIKESMELAGADNIAAEAKSITMEEILKLDPEIILLSDFDKFLPQDLYENRI
                     EGQDWSSVSAVVNKRVYKTPVGIYRWDAPGVETPLMMFWLGKMLQPEIFSEVDLKAEM
                     KAFYQDVFDYSLTDEDFGQIFNDKANAASERRIS"
     misc_feature    423798..424718
                     /locus_tag="DSY0364"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    423852..424730
                     /locus_tag="DSY0364"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(424164..424169,424176..424178,424254..424256)
                     /locus_tag="DSY0364"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            424859..425893
                     /locus_tag="DSY0365"
                     /db_xref="GeneID:3953627"
     CDS             424859..425893
                     /locus_tag="DSY0365"
                     /note="similarity to COG0609 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, permease
                     components(Evalue: 2E-70)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516598.1"
                     /db_xref="GI:89893111"
                     /db_xref="GeneID:3953627"
                     /translation="MHTNRKEGRAGAFPGLLILLFALLVILLLIAVGIGRYPLHPFTV
                     LQVLLAKWVAMEPTWPQQAEGVVFTLRLPRALAAILVGSALSLSGACYQGVFKNPLVA
                     PDVLGVSSGACIGASLGILLGWNASGIQLLAFTGGITAVALTTSIPKITRNQSMMMLV
                     LSGIIVGGLMSSIMGFIKYIADPETQLASITYWQMGSLAKVVSPDLVTVALPILTATG
                     ILLLLRWRINVLSLGDREAQSLGIPVIRSRRIVILCATVLTASAVCISGTIGWVGLVI
                     PHFGRMLVGPDNRKLLPVSCLLGGIFLLVIDTCARMMTSAELPLTILTGIVGAPFYFY
                     LLIKQRMKLS"
     misc_feature    425084..425866
                     /locus_tag="DSY0365"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(425135..425137,425147..425155,425519..425524,
                     425528..425536,425540..425545,425549..425566,
                     425570..425578,425699..425701,425720..425722)
                     /locus_tag="DSY0365"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(425150..425152,425156..425158,425171..425173,
                     425330..425332,425336..425341,425348..425353,
                     425360..425365,425372..425374,425381..425386,
                     425390..425392,425429..425434,425441..425443,
                     425669..425671,425822..425824,425831..425836,
                     425843..425845,425852..425857,425864..425866)
                     /locus_tag="DSY0365"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(425390..425392,425471..425473,425645..425647,
                     425657..425659,425789..425791,425813..425815)
                     /locus_tag="DSY0365"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            425890..426663
                     /locus_tag="DSY0366"
                     /db_xref="GeneID:3953628"
     CDS             425890..426663
                     /locus_tag="DSY0366"
                     /note="similarity to COG1120 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, ATPase
                     components(Evalue: 3E-47)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516599.1"
                     /db_xref="GI:89893112"
                     /db_xref="GeneID:3953628"
                     /translation="MILEVRDLCFAYGKGSRLLKNVCFTLKKGEIFSILGPNGAGKST
                     LLNCMMNLLTPESGSIQVHGQPLAAMDVREIAKTIGYVPQTHSLVYDYSVRDFVVMGR
                     TPYLAAFQQPGAQDYAMVDAALAQLGIARLSERPYTALSGGERQQVTIARTLVQRPQI
                     IILDEPTSYLDYGNQIRVLQLIKSLAADGYSIIMTTHMPDHALRLGGKVGILDRGGQF
                     SVGKTEEMLTTERLSDLYASDIRIVYVEELGRSICAAAQ"
     misc_feature    425890..426648
                     /locus_tag="DSY0366"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    425899..426552
                     /locus_tag="DSY0366"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    425995..426018
                     /locus_tag="DSY0366"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(426004..426009,426013..426021,426139..426141,
                     426379..426384,426478..426480)
                     /locus_tag="DSY0366"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    426130..426141
                     /locus_tag="DSY0366"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    426307..426336
                     /locus_tag="DSY0366"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    426367..426384
                     /locus_tag="DSY0366"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    426391..426402
                     /locus_tag="DSY0366"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    426466..426486
                     /locus_tag="DSY0366"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(426673..427626)
                     /locus_tag="DSY0367"
                     /db_xref="GeneID:3953629"
     CDS             complement(426673..427626)
                     /locus_tag="DSY0367"
                     /note="similarity to COG0583 Transcriptional
                     regulator(Evalue: 3E-56)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516600.1"
                     /db_xref="GI:89893113"
                     /db_xref="GeneID:3953629"
                     /translation="MTLQVLRYVIEVAACASISEAAKALFISQSTLSTAIKQLEEELG
                     IILFRRNNRGIALSPEGEDFLQFARQIVEQANYLENRYQQKKSSDMLFSVSTQRLPFS
                     VRAFVKLMETIGLEPFDIAIRECPTYEVIHDVEAGRSEIGVLAVQHRYLEIFRKLLHS
                     GGISQHKIHTLSPYVFVRKSHPLAQKNSLSIEELKEYPFITFDQGKNSGSHFTEEIVF
                     YSQLDKIVHVSDRCTKIALVRATDAFSIGPDLVNSNGDKMHAGQQEVCAIPLASQSEQ
                     LDILWIEKTSRPLTTTAELYVRLLADQVQHYFAAMPDKPDR"
     misc_feature    complement(426697..427626)
                     /locus_tag="DSY0367"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(427441..427620)
                     /locus_tag="DSY0367"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(426727..427350)
                     /locus_tag="DSY0367"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(426907..426912,426916..426921,
                     426937..426954,427255..427272,427288..427290,
                     427294..427296,427306..427308,427315..427320,
                     427324..427329))
                     /locus_tag="DSY0367"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            427875..429146
                     /locus_tag="DSY0368"
                     /db_xref="GeneID:3953630"
     CDS             427875..429146
                     /locus_tag="DSY0368"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516601.1"
                     /db_xref="GI:89893114"
                     /db_xref="GeneID:3953630"
                     /translation="MKQKYRLMITWALVAVMLGMTLTGCSGNAKVAAGDLMKGITKNP
                     VQLPQEMGGELNQALLDFTWKLFRESGADNGNVMISAPSVYLALGMALNGADGETREA
                     MLKALSAQNIKLEDFNAGLSAWSNSLMDEKNKTDVRIANSIWIRNGFEAAPAFLQTNG
                     DYYQAGIRSLDFADPSAPKIINQWVEEKTEGTIDKIIETMDDNLMMYLINAIYFKGDW
                     QEPFKAGRTYAGTFSAPAGSVETPFMRRSGNMDYIQGQGATGVILPYTDERFAFVGIL
                     PEEGKSPRDFINTTTATDMLKLISSKKIKNVDLSLPKFESSYENELQDELNALGMAIA
                     FDPSRADFSLMNKAHNKDLFIGGVKHKTYIKVDEKGTEAAAVTGVEVNTTSMPIDLTQ
                     VVFDRPFVYAIIDWQTNSPLFVGIMEDPTLR"
     misc_feature    428037..429125
                     /locus_tag="DSY0368"
                     /note="SERine Proteinase INhibitors (serpins), prokaryotic
                     subgroup. Little information about specific functions is
                     available for this subgroup, most likely they are
                     inhibitory members of the serpin superfamily. In general,
                     serpins exhibit conformational...; Region:
                     bacterial_SERPIN; cd02049"
                     /db_xref="CDD:239004"
     misc_feature    order(428982..429014,429051..429068)
                     /locus_tag="DSY0368"
                     /note="reactive center loop; other site"
                     /db_xref="CDD:239004"
     gene            429353..430015
                     /locus_tag="DSY0369"
                     /db_xref="GeneID:3953631"
     CDS             429353..430015
                     /locus_tag="DSY0369"
                     /note="similarity to COG1802 Transcriptional
                     regulators(Evalue: 3E-27)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516602.1"
                     /db_xref="GI:89893115"
                     /db_xref="GeneID:3953631"
                     /translation="MSAITKSLPFHLQIYEILKGKILNGEISRGERLYENKISQELGV
                     SRSPVREALRMLEQDELVVVTSTGLIVNPMEFSDMEEIYQCRMALEPFAAKISADKLT
                     NEDLAALRNLVIQARVYHNQKAYEKVVESNTQFHDIIIQSSGNSRLIGIIEKIRSLII
                     LSRKTEFECYQREEGYLDEHEGVLEALTQRNGDEAERLLRIHIMNDFEFYSLAYEKVL
                     KK"
     misc_feature    429353..429967
                     /locus_tag="DSY0369"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    429377..429544
                     /locus_tag="DSY0369"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(429377..429379,429383..429385,429452..429454,
                     429455..429460,429482..429496,429500..429505,
                     429512..429514,429542..429544)
                     /locus_tag="DSY0369"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    429593..429961
                     /locus_tag="DSY0369"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            430077..430298
                     /locus_tag="DSY0370"
                     /db_xref="GeneID:3953632"
     CDS             430077..430298
                     /locus_tag="DSY0370"
                     /note="similarity to COG0044 Dihydroorotase and related
                     cyclic amidohydrolases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516603.1"
                     /db_xref="GI:89893116"
                     /db_xref="GeneID:3953632"
                     /translation="MKTLIKNGTIITASEEQQQASDYTPYEGLRMKGGVAKVLLRGEV
                     IVDAGKYVGKPGDGKFIARQTLRSQNGKV"
     misc_feature    <430095..430250
                     /locus_tag="DSY0370"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            430638..431966
                     /locus_tag="DSY0371"
                     /db_xref="GeneID:3953633"
     CDS             430638..431966
                     /locus_tag="DSY0371"
                     /note="similarity to COG0477 Permeases of the major
                     facilitator superfamily(Evalue: 2E-92)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516604.1"
                     /db_xref="GI:89893117"
                     /db_xref="GeneID:3953633"
                     /translation="MSNASKQDHGPQNTLVGNVKRTNVRWYVFIAMLVLVTINYVDRA
                     VLSIAMPAIQKDLNLDPAIVGIILSSFFWGYALMQIPSGFLLDRVNPSKVVLGSAVGW
                     GIAQTLTGFVNSAGSLMFFRVLLGVTEAPIMPAGAKLQGIWLPSKERARGATIIDSGA
                     PLGTAVGGPIIIAFMAWFGGWRGALIGAGLMTIILGVICYYILKGNPATHKGVNQAER
                     EYIQTHLAQEQEEAQKETKTELKTSTYLSNKSFWGMCLGWFSFNTVFYGLLTWGPSFL
                     AQTQGIDIKAIGFSTLLIFGCGFVGELVGGQLVDKWRQVGGKYNTVMKTCIGIAGLAT
                     SASIFLLTRASSLTMAIALLSTALFFLRWAGIFWSVPAAIAQRHHVGVLGGCMNFAGN
                     IAGVITPIYIGLIVKFTGSFHAGLLIFVAAGVLLAVAGALINYEKKIGVV"
     misc_feature    430722..431936
                     /locus_tag="DSY0371"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    430737..431936
                     /locus_tag="DSY0371"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    order(430764..430766,430773..430781,430785..430790,
                     430839..430841,430848..430853,430860..430862,
                     430872..430877,430881..430886,431022..431027,
                     431034..431039,431046..431051,431058..431060,
                     431094..431099,431106..431111,431127..431129,
                     431421..431423,431430..431435,431442..431447,
                     431454..431456,431496..431498,431508..431510,
                     431520..431522,431529..431531,431541..431543,
                     431703..431705,431712..431717,431727..431729,
                     431739..431744,431751..431753,431784..431789,
                     431796..431801,431808..431813,431820..431822)
                     /locus_tag="DSY0371"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            432026..432772
                     /locus_tag="DSY0372"
                     /db_xref="GeneID:3953634"
     CDS             432026..432772
                     /locus_tag="DSY0372"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516605.1"
                     /db_xref="GI:89893118"
                     /db_xref="GeneID:3953634"
                     /translation="MRILVINPNISEIVTNLIAQESRRVASPGTELLFATAPFGVEYI
                     ETRMEALIGGYAAACVAAERQGEYDGVIIDAFGDPGLLGIKEMLNVPVVGMTEAALAS
                     ACLLGQRFSIIAISSRIKAWYLETVERSHLTTRLASIRSLNDTLRSIGTVQEDHAKRL
                     KELAMEAVEKDGADVIILAGAPLAGLARSLEGQLPVPVVDGVSSAVRHCESLIALNPG
                     CAVKGSFAQPPLKPNKGLPAALAALLDRTR"
     misc_feature    432026..432709
                     /locus_tag="DSY0372"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            433011..433808
                     /locus_tag="DSY0373"
                     /db_xref="GeneID:3955910"
     CDS             433011..433808
                     /locus_tag="DSY0373"
                     /note="similarity to COG0179 2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway)(Evalue: 3E-55)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516606.1"
                     /db_xref="GI:89893119"
                     /db_xref="GeneID:3955910"
                     /translation="MERYVRFNNGNKICFGLVKGDRVAELSGEEPADFKESGIEHELS
                     ALKLLAPCHPTKAVCVGLNYKDTVLEPGAQWPKEPLLFIKPSTSVANPGDDIIKWAMA
                     EELAFEAELAVVIGKKAHLVSEAEARDYIWGYTIANDVTAKDLQKADILWTRAKSFDT
                     FLPLGPWIVSGINADNLMITSSVNGQEKQKGTTADLIFGIEYLVSFISHITTLLPGDI
                     ILTGTPGGYGSSLDVNDKVEIEISEIGKLVNTCKVSSESWSLAPRHK"
     misc_feature    433017..433163
                     /locus_tag="DSY0373"
                     /note="Domain of unknown function (DUF2437); Region:
                     DUF2437; pfam10370"
                     /db_xref="CDD:255943"
     misc_feature    433077..433766
                     /locus_tag="DSY0373"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    433176..433760
                     /locus_tag="DSY0373"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            complement(433923..434720)
                     /locus_tag="DSY0374"
                     /db_xref="GeneID:3955911"
     CDS             complement(433923..434720)
                     /locus_tag="DSY0374"
                     /note="similarity to COG3473 Maleate cis-trans
                     isomerase(Evalue: 8E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516607.1"
                     /db_xref="GI:89893120"
                     /db_xref="GeneID:3955911"
                     /translation="MSALQPASYKWRDTHMQKTMFDPAEQKKIGMLTPSSNTALEPVC
                     SRMVSGLENLVAMHYSRLEVTKISLEKDALSQFDLDPFLRASEFLAHADVDAIAWNGT
                     SGGWTGFDFDRMVCEKITEATGIPATTSMLAMLEAFEENKVKTLHMVTPYIPAIDELI
                     AKQFEEKCGYQVINSRGLNQTVNRSFSLVTPEQIDGMCKEVSVDPADGISIICTNLRS
                     TWQIEQLERDYGITVYDSTAVTVWKTLKMVGVDPGVVKGWGRLFTGK"
     misc_feature    complement(433926..434663)
                     /locus_tag="DSY0374"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            complement(434842..435522)
                     /locus_tag="DSY0375"
                     /db_xref="GeneID:3955912"
     CDS             complement(434842..435522)
                     /locus_tag="DSY0375"
                     /note="similarity to COG0664 cAMP-binding domains -
                     Catabolite gene activator and regulatory subunit of
                     cAMP-dependent protein kinases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516608.1"
                     /db_xref="GI:89893121"
                     /db_xref="GeneID:3955912"
                     /translation="MSCIIPNIYSQPTDTNLWNILLSSGIPRHYQKGEFVFEKDQPSN
                     GLICLKKGKVKVSSFFSEGSEKIFGILVAPALFGETETLDQGPRMVSATALTHVEIVA
                     ISGNKTKELIYTYPDIALSIIQSIGVKLRWTTLQAEDLSTQKIEYRLARLLLDFKHYG
                     IFTSKNNDNCLMITHEELAHFIGTARSKVTTYLNEFAHKGLIRLRRGEIRILDTAGLN
                     KYTHKSQA"
     misc_feature    complement(434884..435468)
                     /locus_tag="DSY0375"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(435154..435462)
                     /locus_tag="DSY0375"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(435253..435261,435286..435291))
                     /locus_tag="DSY0375"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(435169..435177,435187..435195))
                     /locus_tag="DSY0375"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(434863..435081)
                     /locus_tag="DSY0375"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(435076..435081)
                     /locus_tag="DSY0375"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(434968..434970,434995..435003,
                     435007..435009))
                     /locus_tag="DSY0375"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(434950..434970)
                     /locus_tag="DSY0375"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(434950..434952,434962..434967))
                     /locus_tag="DSY0375"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(434962..434967)
                     /locus_tag="DSY0375"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            complement(435679..436749)
                     /locus_tag="DSY0376"
                     /db_xref="GeneID:3955913"
     CDS             complement(435679..436749)
                     /locus_tag="DSY0376"
                     /note="similarity to COG0388 Predicted amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516609.1"
                     /db_xref="GI:89893122"
                     /db_xref="GeneID:3955913"
                     /translation="MIEQYMALAIQPTMRGAEKREDIKRNIAHISDVIDAAVWLSGIE
                     MPVRLITIPEGALQGFTDELFDWDHQYYVDHMAIDIPGEETELLGKKAKEYNAYLIAQ
                     AKVKHPEFPGRFFNSAFLIDPKGEVILQSYKMQVFCQEHSTVPHDVWDKWIELYGYKL
                     DSFYSVADTEIGRIGLLVCQEGDYPEPARGLAMNGAEIIYRSSAPEPAVANGWWELQN
                     RARALDNTCYVVAPNVATYYPSQAAELSVDTFGGQSMIVNHHGEVISNHKYGSGSSYA
                     GAIIDVESLREYRERSLFGNWMKDLRTEQFKLIYEEPLFAKNLCLDRTPLKHKDTHEI
                     YRQHVRQLIERGIWVESTRSKK"
     misc_feature    complement(435841..436737)
                     /locus_tag="DSY0376"
                     /note="Uncharacterized subgroup of the nitrilase
                     superfamily (putative class 13 nitrilases); Region:
                     nitrilase_4; cd07582"
                     /db_xref="CDD:143606"
     misc_feature    complement(order(436138..436140,436201..436206,
                     436210..436215,436300..436302,436339..436341,
                     436351..436353,436588..436590))
                     /locus_tag="DSY0376"
                     /note="putative active site [active]"
                     /db_xref="CDD:143606"
     misc_feature    complement(order(436213..436215,436351..436353,
                     436588..436590))
                     /locus_tag="DSY0376"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143606"
     misc_feature    complement(order(435841..435855,435991..435996,
                     436078..436083,436087..436095,436099..436104,
                     436180..436185,436192..436206,436210..436212,
                     436276..436284,436303..436305,436339..436350))
                     /locus_tag="DSY0376"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143606"
     gene            437258..437596
                     /locus_tag="DSY0377"
                     /db_xref="GeneID:3955914"
     CDS             437258..437596
                     /locus_tag="DSY0377"
                     /note="similarity to COG1670 Acetyltransferases, including
                     N-acetylases of ribosomal proteins(Evalue: 5E-23)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516610.1"
                     /db_xref="GI:89893123"
                     /db_xref="GeneID:3955914"
                     /translation="MILETARLILREMTQEDFPALRKIFQDKEVMYAYEGAFSLIEAQ
                     VWLDRQIERYRKEGFGLWAVVLKESGEMIGQCGLTMQGYKGGQVLEVGYLFRKESWHY
                     GYASEAGYRL"
     misc_feature    437276..>437581
                     /locus_tag="DSY0377"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    437285..>437581
                     /locus_tag="DSY0377"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            437813..439369
                     /locus_tag="DSY0378"
                     /db_xref="GeneID:3955915"
     CDS             437813..439369
                     /locus_tag="DSY0378"
                     /note="similarity to COG3835 Sugar diacid utilization
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516611.1"
                     /db_xref="GI:89893124"
                     /db_xref="GeneID:3955915"
                     /translation="MKLNLAVFAYHLADYAPRLYDSEIHGLGVADVRFLDRQETFLSE
                     SVYIGMWDKLQALIKPPFYVVCIGRDETTDRWLEEHGVKALILDSEVELNEVFERLQD
                     IFQHYNRLESELLEAVLCKEPLNVLLNICAKFFANPTFITDAALCLVATCDNFAHPET
                     DRAWQETIESGRSSSELLLLMKRKKLTNLLNTSRKAEFVNVGENYSKIICANYFDQEV
                     RIATFTVSEAYTPLSPLQAGLVDHVAKLLTAEVRKQHKASSRYLFAIRSNISNLLHGQ
                     KIDEAILKTNFAHIGWTDQEDYRLLKIPLTTAELADGTAGHNRKIYESIFPHYVSLDL
                     NEVLILVIRCARDTEADKRRFAELKKHLKNENAACGVSKTFHDFDMLGEEYKLANAAL
                     EIGSWKYPKEALYFYEDMMLEHLFSEGSRIFNLRSLCHDSVLRIAEHDQQNNSSLLQT
                     LKVYLLQEKSLLAASQELHIHRNTLVYRLGKIEQISGLDLNSPLIRLQGILSCLILEY
                     LNGLEEKAPD"
     misc_feature    <438767..439336
                     /locus_tag="DSY0378"
                     /note="Sugar diacid utilization regulator [Transcription /
                     Signal transduction mechanisms]; Region: CdaR; COG3835"
                     /db_xref="CDD:226355"
     misc_feature    439160..439327
                     /locus_tag="DSY0378"
                     /note="PucR C-terminal helix-turn-helix domain; Region:
                     HTH_30; pfam13556"
                     /db_xref="CDD:257873"
     gene            439512..440921
                     /locus_tag="DSY0379"
                     /db_xref="GeneID:3955916"
     CDS             439512..440921
                     /locus_tag="DSY0379"
                     /note="similarity to COG0404 Glycine cleavage system T
                     protein (aminomethyltransferase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516612.1"
                     /db_xref="GI:89893125"
                     /db_xref="GeneID:3955916"
                     /translation="MSSDNQRAQFQVVTGNESPAIYHQFSPALETATLLFQMAPGLLV
                     PYEFGGVEYEIDGYRKSAWIGTTLMISPIYDVVGPDAVKFLNSICVNDFTNLTTKGLR
                     HAVICNDQGQVLTDGVVIRIGEDRYRTYWLNPPIDYFLKTSGMNVAGEDLSGTEYFIQ
                     IAGERSLEILEDAFASDLHDIKFATHRKASMDGKEVEIIRLGMSGNLAYEIHGPMAEF
                     DEVYRKIWNSGQKFGARKLGMHAYNLFNHTEAGFPNIHLHYPLPWFESGEDMAKYMLA
                     NPQYSMYNLNRKLVGSVGEELQARFVTPYDVGWGFLVKFNHEFRGRKALEEIANDPPR
                     TAVTLEWNGDDVGAVFATQFKPGEEACESIGAESEGMFTSNTFRGEMAYRSNRVLYNG
                     KDIGISSGRIVSYHYNSMISLGFIDPAYAKEGNELTLIWGTPGTRQMNIRVKVARYPY
                     NGDFVRNENKDVEEIPRHK"
     misc_feature    439632..440882
                     /locus_tag="DSY0379"
                     /note="glycine cleavage system T protein; Region: gcvT;
                     TIGR00528"
                     /db_xref="CDD:233010"
     misc_feature    439728..440270
                     /locus_tag="DSY0379"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    440460..440798
                     /locus_tag="DSY0379"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            441148..441687
                     /locus_tag="DSY0380"
                     /db_xref="GeneID:3955917"
     CDS             441148..441687
                     /locus_tag="DSY0380"
                     /note="similarity to COG3404 Methenyl tetrahydrofolate
                     cyclohydrolase(Evalue: 8E-22)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516613.1"
                     /db_xref="GI:89893126"
                     /db_xref="GeneID:3955917"
                     /translation="MEKVASLPSTPAGGSVAALNAASAAALAEMASRLTADKMEDGAL
                     AKELKGMAEVFHSYRVKFTDAIDEDAKVFSEVLSAYKLAADSAENRKIRDEKIQESYK
                     KAVIVPIKLAEDIWAMMQLIKMQHHHIGDSYITDSAQAYMLAEAALKSLLYHIKSNLM
                     YIRDKEFTEKIEEVLEQFG"
     misc_feature    441151..441657
                     /locus_tag="DSY0380"
                     /note="Formiminotransferase-cyclodeaminase; Region:
                     FTCD_C; cl01350"
                     /db_xref="CDD:260895"
     gene            441855..442157
                     /locus_tag="DSY0381"
                     /db_xref="GeneID:3955918"
     CDS             441855..442157
                     /locus_tag="DSY0381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516614.1"
                     /db_xref="GI:89893127"
                     /db_xref="GeneID:3955918"
                     /translation="MAKRHSYGVVQMKKKAILTIPKEVRLALHLADEGELFEIIVDNG
                     KIILEPKTLIPKEQEWFWTERWQAGEREAEEDIKAGRVSPAFDNVKDLLEALNNED"
     misc_feature    441882..442010
                     /locus_tag="DSY0381"
                     /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
                     smart00966"
                     /db_xref="CDD:198034"
     gene            442551..443171
                     /locus_tag="DSY0382"
                     /db_xref="GeneID:3955919"
     CDS             442551..443171
                     /locus_tag="DSY0382"
                     /note="similarity to COG1846 Transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516615.1"
                     /db_xref="GI:89893128"
                     /db_xref="GeneID:3955919"
                     /translation="MHHMGETKKEILGRFMRLQGLLHRYQAQNFMNFGPWGNPQRGQG
                     RVLALLKMKPEISQKELTYLLDMSKQGLAELLNKLEKNEFITRETSEEDRRSVNIKLT
                     EKGAAVAGEMGDMPPELEKLFDVLNDEELANLSDYLKRITERLEEQFTDGDGDLRKQM
                     MERLRQCHHHHGRNFGGHRGDFHGFYGGVFPHRRGGRRDDDGEREE"
     misc_feature    442671..442991
                     /locus_tag="DSY0382"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    442671..442958
                     /locus_tag="DSY0382"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            443332..443652
                     /locus_tag="DSY0383"
                     /db_xref="GeneID:3955920"
     CDS             443332..443652
                     /locus_tag="DSY0383"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516616.1"
                     /db_xref="GI:89893129"
                     /db_xref="GeneID:3955920"
                     /translation="MADPKFTQRNLRFRSPFFRSWSLIWVWFSKECEMFRASISFLSL
                     FSNPSLLDKRVFIYVGRDFFVHSLLGAGYEQGMAIVKICGFKCLEGAGWKFRHSPQSG
                     LGGY"
     gene            444274..444939
                     /locus_tag="DSY0384"
                     /db_xref="GeneID:3955921"
     CDS             444274..444939
                     /locus_tag="DSY0384"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516617.1"
                     /db_xref="GI:89893130"
                     /db_xref="GeneID:3955921"
                     /translation="MSYSRSTASRLMKIFREYGPILSSTDGEEGSNGAPVQHLNYTQG
                     IALFGISVEDRDQFIADNDVGKMSKRELQQTVKVRERTAEEEERREPENQGVQNQEKT
                     EEAADKAMDKPLELIPVERKIIKPKTVPTAQTELPQEDANPESMKYNAQYATHRDTML
                     SAYGELLKTLVALNRVDPVKKEANRKEALKITTNMAETLKQYPPAIKTNLKIKRTEPG
                     APN"
     misc_feature    <444277..444504
                     /locus_tag="DSY0384"
                     /note="Protein of unknown function (DUF3102); Region:
                     DUF3102; pfam11300"
                     /db_xref="CDD:256401"
     gene            complement(445132..445746)
                     /locus_tag="DSY0385"
                     /db_xref="GeneID:3955922"
     CDS             complement(445132..445746)
                     /locus_tag="DSY0385"
                     /note="similarity to COG1124 ABC-type
                     dipeptide/oligopeptide/nickel transport system, ATPase
                     component(Evalue: 5E-50)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516618.1"
                     /db_xref="GI:89893131"
                     /db_xref="GeneID:3955922"
                     /translation="MELEAKGICFRYMSKTAPILNNVDFTLKEGDKLALVGPSGCGKS
                     TLAKILAGYIRPSGGTVLLDGKPLPDQGYSPVQMIYQHPELAVNPRWKMSKIAHECWT
                     PNDELLKDMGIEKEWMSRWPTELSGGELQRFCVVRALGPETRFLICDEITTMLDVITQ
                     AQLWQTILDIAEKNKLGMIVVTHNNYLADKVCDRVIKLTDINHI"
     misc_feature    complement(445147..445746)
                     /locus_tag="DSY0385"
                     /note="ABC-type cobalt transport system, ATPase component
                     [Inorganic ion transport and metabolism]; Region: CbiO;
                     COG1122"
                     /db_xref="CDD:224047"
     misc_feature    complement(445159..445740)
                     /locus_tag="DSY0385"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(445615..445638)
                     /locus_tag="DSY0385"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(445198..445200,445297..445302,
                     445504..445506,445612..445620,445624..445629))
                     /locus_tag="DSY0385"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(445504..445515)
                     /locus_tag="DSY0385"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(445345..445374)
                     /locus_tag="DSY0385"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(445297..445314)
                     /locus_tag="DSY0385"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(445279..445290)
                     /locus_tag="DSY0385"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(445192..445212)
                     /locus_tag="DSY0385"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(445772..446635)
                     /locus_tag="DSY0386"
                     /db_xref="GeneID:3955923"
     CDS             complement(445772..446635)
                     /locus_tag="DSY0386"
                     /note="similarity to COG1173 ABC-type
                     dipeptide/oligopeptide/nickel transport systems, permease
                     components(Evalue: 2E-65)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516619.1"
                     /db_xref="GI:89893132"
                     /db_xref="GeneID:3955923"
                     /translation="MYDNKLTPVGKLRLPGINIRTRMLILIFISAIYLFGILIWGFYM
                     EESLYEVSYTHKFIPPGLEHPFGTDFMGRDMFYRSIKGLSTSLVIGVLASAVSSILAL
                     LLGIAAATIGGKFDQFVNWCVDCCMGLPHLVLLVLISFMLDRGVKGVAIAVALTHWPE
                     LTRIVRAEVLQIRSSQYVQLSYKAGKSKFWVAKEHMVPHVLPTYLIGLVLLFPHAIMH
                     EAALTFLGFGLPAESPAIGAILSEAMVHIATGKWWLALFPGLLLLIAVILFDVIGENL
                     KNLLNPNSGNE"
     misc_feature    complement(445790..446587)
                     /locus_tag="DSY0386"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(445946..446389)
                     /locus_tag="DSY0386"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(445964..445969,445976..445987,
                     446006..446008,446015..446020,446060..446062,
                     446111..446113,446120..446125,446135..446137,
                     446141..446146,446153..446155,446159..446161,
                     446165..446170,446219..446221,446225..446230,
                     446237..446266,446270..446281,446309..446311,
                     446324..446329,446336..446341))
                     /locus_tag="DSY0386"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(445970..445987,446219..446263))
                     /locus_tag="DSY0386"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(445967..445969,446183..446185,
                     446219..446221))
                     /locus_tag="DSY0386"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(446039..446041,446051..446056,
                     446072..446110))
                     /locus_tag="DSY0386"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(446628..447611)
                     /locus_tag="DSY0387"
                     /db_xref="GeneID:3955924"
     CDS             complement(446628..447611)
                     /locus_tag="DSY0387"
                     /note="similarity to COG0601 ABC-type
                     dipeptide/oligopeptide/nickel transport systems, permease
                     components(Evalue: 2E-81)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516620.1"
                     /db_xref="GI:89893133"
                     /db_xref="GeneID:3955924"
                     /translation="MTSAKHIVSILVRMVLLLMAVCVIAFVLITSSPIDPLVSYIGTN
                     STLSEEAKQEISDYWGLNDPLPERFSAWTANVLQGDFGDSITYKKPVRDVIWERFSYS
                     AVLMLVAWAASGVLGFLIGIAAGMRKGSVFDRSVKMFCLGLQSAPTFWLGLLILSLFA
                     VTLGWFPIGMAAPMGKLASEVTLGDRAYHLVLPALTLTVVSISKITLYTRQKLIETMG
                     NDYILFAKARGENERQLVTRHVLRNIALPAITIQFASFSELFGGMALAETVFAYPGIG
                     TATTAAALNGDVPLLLGIAIFSALFVFSGNLIANILYGVLDPRVKEGGDYV"
     misc_feature    complement(446640..447599)
                     /locus_tag="DSY0387"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(446691..447317)
                     /locus_tag="DSY0387"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(446691..446696,446703..446708,
                     446715..446720,446724..446729,446736..446741,
                     446769..446774,446808..446813,446820..446831,
                     446850..446852,446859..446864,446904..446906,
                     446955..446957,446964..446969,446979..446981,
                     446985..446990,446997..446999,447003..447005,
                     447009..447014,447144..447146,447150..447155,
                     447162..447191,447195..447206,447237..447239,
                     447252..447257,447264..447269))
                     /locus_tag="DSY0387"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(446814..446831,447144..447188))
                     /locus_tag="DSY0387"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(446739..446741,446769..446771,
                     446775..446777,446811..446813,447027..447029,
                     447144..447146))
                     /locus_tag="DSY0387"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(446883..446885,446895..446900,
                     446916..446954))
                     /locus_tag="DSY0387"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(447725..449383)
                     /locus_tag="DSY0388"
                     /db_xref="GeneID:3955925"
     CDS             complement(447725..449383)
                     /locus_tag="DSY0388"
                     /note="similarity to COG0747 ABC-type
                     dipeptide/oligopeptide/nickel transport systems,
                     periplasmic components(Evalue: 3E-67)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516621.1"
                     /db_xref="GI:89893134"
                     /db_xref="GeneID:3955925"
                     /translation="MILRRRILMKKKLALVLSILLMLLVTACSSGTGAGKPAETTPSQ
                     EGAVPPPADGIVAYVGGTIFDSSLDPIKGAMSYGYSFTNCALLRMNPDSEYEGDMATK
                     WSISEDSLVYTYKLRENVKFSDGSDFTADDVVFTYTTVKENQAHNENVDLTKLASVKA
                     LNDYTVEFTLSEPYSPFLDATACLGIVPSDSYDSKKFDQYPIGTGAWIVTQYDANQQI
                     IVKANENYYEGAPAIKKVTFVSMNSEAAFSNAKSGQLDIVMIGPNYTSEKVAHMMTER
                     FATMDIRMINLPVLKEQTMKNPDGKDIKVGNNVTSDINVRKALAIGIDRQTIINHAFN
                     GVGKPAVSFTANLQWASTDTYADNRKVEASALLQDAGWVDTDGDGIREKNGLKCEFDV
                     YAPGSDNDRFLLANAVAEDALKLGVKINVKTASWDEVANLQSTSGIVWGWGQYSPTVL
                     NSLFNSQLFLKGAYDNVSGYANPQVDADIQKAFTSTTHDGAVAAWKAVQATANQDYPY
                     LYIVNIEHCYLVKDSLDLSLDTQIAHPHGHGSPIICNMKDWNYK"
     misc_feature    complement(447824..449311)
                     /locus_tag="DSY0388"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(447803..449227)
                     /locus_tag="DSY0388"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_19; cd08518"
                     /db_xref="CDD:173883"
     gene            449625..449924
                     /locus_tag="DSY0389"
                     /db_xref="GeneID:3955926"
     CDS             449625..449924
                     /locus_tag="DSY0389"
                     /note="similarity to COG1937 Uncharacterized BCR(Evalue:
                     2E-28)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516622.1"
                     /db_xref="GI:89893135"
                     /db_xref="GeneID:3955926"
                     /translation="MSEKGHSHTQHHHHHHHTKAVLNRLSRAIGHLESVKRMVEEEKD
                     CSEVLIQLSAVIAALNNTGKVILKDHIEHCIVDAWEHSDEEAMENLNKAIDRFIK"
     misc_feature    449679..449918
                     /locus_tag="DSY0389"
                     /note="Uncharacterized family 1; belongs to a superfamily
                     containing the transcriptional regulators CsoR
                     (copper-sensitive operon repressor), RcnR, and FrmR, and
                     related domains; this family was previously known as part
                     of DUF156; Region: CsoR-like_DUF156_1; cd10158"
                     /db_xref="CDD:197393"
     misc_feature    order(449685..449690,449697..449702,449709..449711,
                     449718..449723,449727..449732,449739..449750,
                     449754..449762,449766..449774,449778..449783,
                     449787..449792,449799..449804,449811..449816,
                     449820..449828,449832..449840,449847..449849,
                     449871..449876,449880..449909)
                     /locus_tag="DSY0389"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197393"
     misc_feature    order(449685..449690,449697..449702,449709..449711,
                     449718..449723,449727..449732,449739..449750,
                     449754..449762,449766..449774,449778..449783,
                     449787..449792,449799..449804,449811..449813,
                     449820..449822,449832..449834,449889..449891,
                     449898..449909)
                     /locus_tag="DSY0389"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197393"
     misc_feature    order(449757..449759,449832..449834,449844..449846)
                     /locus_tag="DSY0389"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197393"
     misc_feature    order(449814..449816,449823..449828,449835..449840,
                     449844..449849,449871..449876,449880..449888,
                     449892..449897)
                     /locus_tag="DSY0389"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197393"
     misc_feature    order(449832..449834,449889..449891)
                     /locus_tag="DSY0389"
                     /note="putative allosteric switch controlling residues;
                     other site"
                     /db_xref="CDD:197393"
     gene            450702..451823
                     /locus_tag="DSY0390"
                     /db_xref="GeneID:3955927"
     CDS             450702..451823
                     /locus_tag="DSY0390"
                     /note="similarity to COG0614 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, periplasmic
                     components(Evalue: 7E-77)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516623.1"
                     /db_xref="GI:89893136"
                     /db_xref="GeneID:3955927"
                     /translation="MRKWLLFLMIPMLILMGCTSQVSQSSGQTDGGKENSAEKSTQVI
                     TDMMGRDVEVPTKINSIICTGAGALRLIAYAQATDLVIGIEDTDKSGVIGRPYNYVYH
                     DQFKDLPSIGKGGGRGYTAYEEQIIALQPDVIFCSYTSDALDQLAVKTGIPVVSTAIQ
                     GNLFEENTVQSLKLIGEILGREERCAEVIAYLDQYEADLNNRTKDIPEADKPTVYAGA
                     ISNQGGRGFAGTYGGLGPLKAIHISGVADEVGKKEGFEVDWEQIQVWDPDIIFLDPGN
                     LSLVNEEYVKKPDYFNSLRGVKEGNVYSIISFNNYTTNIEMAIADAYYAGKVLFPEKF
                     ADIDIEAKTDEIFEKFLGKGIYTEMKEAGLAFGKITLGQ"
     misc_feature    450702..451709
                     /locus_tag="DSY0390"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    450861..451643
                     /locus_tag="DSY0390"
                     /note="Metal binding protein HemV-2.  These proteins are
                     predicted to function as initial receptors in ABC
                     transport of metal ions.  They belong to the TroA
                     superfamily of helical backbone metal receptor proteins
                     that share a distinct fold and ligand binding...; Region:
                     HemV-2; cd01147"
                     /db_xref="CDD:238567"
     misc_feature    451017..451019
                     /locus_tag="DSY0390"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238567"
     gene            451813..452889
                     /locus_tag="DSY0391"
                     /db_xref="GeneID:3955928"
     CDS             451813..452889
                     /locus_tag="DSY0391"
                     /note="similarity to COG0609 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, permease
                     components(Evalue: 3E-98)"
                     /codon_start=1
                     /transl_table=11
                     /product="permease component of ABC-type
                     cobalamin/Fe3+-siderophores transport systems"
                     /protein_id="YP_516624.1"
                     /db_xref="GI:89893137"
                     /db_xref="GeneID:3955928"
                     /translation="MVNKRSRLHYREAYGNYMAGKRLVLLALIALLIGVALFSITAGS
                     AGLTLGEVFRTFMGTGTTQAQAIVWNVRLPRIFTAIVVGGALALAGCVMQSVLRNPLA
                     SSSTLGISHGAAFGAAIAIVYFSAGSQHNAAGSGAISITNPYLVTACAFMGGMISVFV
                     ILVLSRIKTVTPAAMVLAGVALSSLFRGGVALVQYFADDVALASVVYWTFGDLGRTSW
                     HEIGLILIILGPTFVYFMFNSWSYNGIQSGSQTARSLGIHVDQLIIVSMVLAALLAAS
                     AVSFVGIIDFVGLVAPHMVRKFVGSDYRFLLPASMLAGACILLLSDLCSRTIIAPIVL
                     PIGAITSFLGAPLFIYLIYKGAKK"
     misc_feature    452038..452868
                     /locus_tag="DSY0391"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(452092..452094,452104..452112,452518..452523,
                     452527..452535,452539..452544,452548..452565,
                     452569..452577,452698..452700,452719..452721)
                     /locus_tag="DSY0391"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(452107..452109,452113..452115,452128..452130,
                     452332..452334,452338..452343,452350..452355,
                     452362..452367,452374..452376,452383..452388,
                     452392..452394,452428..452433,452440..452442,
                     452668..452670,452824..452826,452833..452838,
                     452845..452847,452854..452859,452866..452868)
                     /locus_tag="DSY0391"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(452392..452394,452470..452472,452644..452646,
                     452656..452658,452788..452790,452815..452817)
                     /locus_tag="DSY0391"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            452892..453671
                     /locus_tag="DSY0392"
                     /db_xref="GeneID:3955929"
     CDS             452892..453671
                     /locus_tag="DSY0392"
                     /note="similarity to COG1120 ABC-type
                     cobalamin/Fe3+-siderophores transport systems, ATPase
                     components(Evalue: 5E-67)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516625.1"
                     /db_xref="GI:89893138"
                     /db_xref="GeneID:3955929"
                     /translation="MLKVQELSFQYGSHPVLEDVHFEAPYGQCVAILGNNGAGKSTLI
                     KCLNRILPPRSGQVLLDEQDLCSMSRTNVAKEMAYVAQHSETARFTVYDAVMLGRKPY
                     IRFSPTEADYEIVHGMIEKLELSQMSLAYIDELSGGELQKVMLARALTQQPKVLLLDE
                     PTSNLDLKNQHDMLGLVGKIAKEENICVLMVIHDLNLALRYCDRFLFIKDGGIYAYGD
                     EEIMNAKVIGEVYGIPVAIEYAHGAKIVVPFPEQGVKANKA"
     misc_feature    452892..453641
                     /locus_tag="DSY0392"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    452898..453542
                     /locus_tag="DSY0392"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    452991..453014
                     /locus_tag="DSY0392"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(453000..453005,453009..453017,453135..453137,
                     453366..453371,453468..453470)
                     /locus_tag="DSY0392"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    453126..453137
                     /locus_tag="DSY0392"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    453294..453323
                     /locus_tag="DSY0392"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    453354..453371
                     /locus_tag="DSY0392"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    453378..453389
                     /locus_tag="DSY0392"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    453456..453476
                     /locus_tag="DSY0392"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            453723..454253
                     /locus_tag="DSY0393"
                     /db_xref="GeneID:3953747"
     CDS             453723..454253
                     /locus_tag="DSY0393"
                     /note="similarity to COG2191 Formylmethanofuran
                     dehydrogenase subunit E(Evalue: 2E-38)"
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran dehydrogenase subunit E"
                     /protein_id="YP_516626.1"
                     /db_xref="GI:89893139"
                     /db_xref="GeneID:3953747"
                     /translation="MIMDKQLWEKAVAFHGHECPGLAIGFRACEAVQEKMGLKFSQDE
                     EVVCVTENDACGADAVQVITGCSFGKGNLIYRGTGKMAFSFFSRNTGESMRIVLKPSS
                     SEMDRQERQNYILTAPMDDVFEFKKPGFTLPKQARLFKTVICEVCGEGAPEHKMRLQE
                     GKKVCLDCFEDYSRGY"
     misc_feature    453741..454247
                     /locus_tag="DSY0393"
                     /note="Formylmethanofuran dehydrogenase subunit E [Energy
                     production and conversion]; Region: COG2191"
                     /db_xref="CDD:225102"
     misc_feature    453759..454103
                     /locus_tag="DSY0393"
                     /note="FmdE, Molybdenum formylmethanofuran dehydrogenase
                     operon; Region: FmdE; pfam02663"
                     /db_xref="CDD:251455"
     misc_feature    454149..454244
                     /locus_tag="DSY0393"
                     /note="Prokaryotic dksA/traR C4-type zinc finger; Region:
                     zf-dskA_traR; pfam01258"
                     /db_xref="CDD:250482"
     gene            complement(454513..454794)
                     /locus_tag="DSY0394"
                     /db_xref="GeneID:3953748"
     CDS             complement(454513..454794)
                     /locus_tag="DSY0394"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516627.1"
                     /db_xref="GI:89893140"
                     /db_xref="GeneID:3953748"
                     /translation="MIFSSKRESICLSWNKISNFKRVLRSSNSLRRLPRLSNSGSGKM
                     TKSISLSPLLSPLAREPKRIILSTAYFCPMFWILSTSLLSKFTLTIPYT"
     gene            complement(455341..455607)
                     /locus_tag="DSY0395"
                     /db_xref="GeneID:3953749"
     CDS             complement(455341..455607)
                     /locus_tag="DSY0395"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516628.1"
                     /db_xref="GI:89893141"
                     /db_xref="GeneID:3953749"
                     /translation="MLIEKGLAKPLGCAIVKPEEGLPMDIAALSVVSNQVQLKQQASL
                     SVMKMVMNASQEQTNSLLAMTAGMSGEMESSVNPHLGSKLDVLV"
     misc_feature    complement(455344..455532)
                     /locus_tag="DSY0395"
                     /note="Putative motility protein; Region: YjfB_motility;
                     pfam14070"
                     /db_xref="CDD:258297"
     gene            complement(455652..456164)
                     /locus_tag="DSY0396"
                     /db_xref="GeneID:3953750"
     CDS             complement(455652..456164)
                     /locus_tag="DSY0396"
                     /note="similarity to COG0602 Organic radical activating
                     enzymes(Evalue: 8E-24)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516629.1"
                     /db_xref="GI:89893142"
                     /db_xref="GeneID:3953750"
                     /translation="MMDSCIRIAGIIGESIVDGPGIRLVVFAQGCPHHCPGCHNPETH
                     AYEGGKSVAIAEILQRLAMNPLLDGITLSGGEPFAQAAGFALLAQSARQRGFHVMTYS
                     GYTYEELTASSEQNPAWALLLEQTDLLVDGPFQLAERNLLLPFRGSENQRVIDVQESL
                     RQGKVVLASV"
     misc_feature    complement(455697..456146)
                     /locus_tag="DSY0396"
                     /note="anaerobic ribonucleoside-triphosphate reductase
                     activating protein; Region: NrdG; TIGR02491"
                     /db_xref="CDD:233893"
     misc_feature    complement(<455841..456092)
                     /locus_tag="DSY0396"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(455859..455867,455937..455942,
                     455946..455948,456048..456056,456060..456062,
                     456066..456068,456072..456074))
                     /locus_tag="DSY0396"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(456164..458533)
                     /locus_tag="DSY0397"
                     /db_xref="GeneID:3953751"
     CDS             complement(456164..458533)
                     /locus_tag="DSY0397"
                     /EC_number="1.17.4.2"
                     /note="Catalyzes the reduction of nucleoside
                     5'-triphosphates to 2'-deoxynucleoside 5'-triphosphates"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside triphosphate reductase"
                     /protein_id="YP_516630.1"
                     /db_xref="GI:89893143"
                     /db_xref="GeneID:3953751"
                     /translation="MITKIRKRDGREAPFNIEKIANAIFKAASATGGKDYQSSLLLAE
                     EVVNYLEVNLHKKVPSVEEIQDAVEKILIERGHARTAQEFILYRAERTRVREMDTRLM
                     KVYEELTFKEAKDNDMKRENANIDGDTAMGTMLRYGSEGAKQFNEMFVLKPEHSKAHK
                     EGDIHIHDMDFLTLTTTCCQIDIIKLFKEGFGTGHGFLREPNDIQSYSALACIAIQSN
                     QNDQHGGQSIPNFDYGMAPGVAKTYIKLYRQNLLKACELLIHQDVDQEELEAHLKDVF
                     SALPNQGHTPTLSSDPDYFEQEAALLQTLPNLKLDMPTIRKAQEFAVKKALAETDKKT
                     YQAMEALVHNLNTMHSRAGAQIPFSSLNYGTDTTPEGRMVVKNLLLATEAGLGNGETP
                     IFPIHIFKVKEGVNYNPSDPNYDLFQLACRVSAKRLFPNFSFIDAPFNLQYYVPGRPE
                     TEIAYMGCRTRVIGNIYDPSRETIFGRGNLSFTTINLPRLAIKSHQSRTEFFAMLDEK
                     IDLVINQLLERFEIQARKKVKNFPFLMGQGIWLDSDQLGWDDEIREVLKHGTLSMGFI
                     GLAECLMVLTGQHHGESEEARELGLEIVQQLRRRMDEAGREYGLNFSLLATPAEGLSG
                     RFIKMDRELFGSIPGITDKEYYTNSFHIPVSFPISAFRKITIEAPYHELTNAGHITYV
                     EVDGDPTQNLEAFEKIVRCMKESGIGFGAVNHPVDRDPVCGYTGIIGNECPRCGREES
                     TAPFERIRRITGYLVGTLDRFNDAKKAEVRDRIKHLNCLDSSFGEKGTL"
     misc_feature    complement(456206..458533)
                     /locus_tag="DSY0397"
                     /note="anaerobic ribonucleoside triphosphate reductase;
                     Provisional; Region: PRK07111"
                     /db_xref="CDD:235937"
     misc_feature    complement(458255..458524)
                     /locus_tag="DSY0397"
                     /note="ATP cone domain; Region: ATP-cone; pfam03477"
                     /db_xref="CDD:251987"
     misc_feature    complement(456266..458173)
                     /locus_tag="DSY0397"
                     /note="Class III ribonucleotide reductase; Region:
                     RNR_III; cd01675"
                     /db_xref="CDD:153084"
     misc_feature    complement(order(456659..456661,456668..456679,
                     457799..457801,457895..457897,457904..457909,
                     457916..457918,457928..457942,458030..458035,
                     458039..458041))
                     /locus_tag="DSY0397"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153084"
     misc_feature    complement(order(456674..456676,456683..456685,
                     457091..457093,457160..457165,457460..457462,
                     457859..457861,458000..458002))
                     /locus_tag="DSY0397"
                     /note="active site"
                     /db_xref="CDD:153084"
     misc_feature    complement(order(456329..456331,456338..456340,
                     456368..456370,456377..456379))
                     /locus_tag="DSY0397"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:153084"
     misc_feature    complement(456275..456289)
                     /locus_tag="DSY0397"
                     /note="glycine loop; other site"
                     /db_xref="CDD:153084"
     gene            complement(459079..462306)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /db_xref="GeneID:3953752"
     CDS             complement(459079..462306)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /EC_number="6.3.5.5"
                     /note="four CarB-CarA dimers form the carbamoyl phosphate
                     synthetase holoenzyme that catalyzes the production of
                     carbamoyl phosphate; CarB is responsible for the
                     amidotransferase activity"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl phosphate synthase large subunit"
                     /protein_id="YP_516631.1"
                     /db_xref="GI:89893144"
                     /db_xref="GeneID:3953752"
                     /translation="MPKREDIKKIMIIGSGPIVIGQAAEFDYSGTQACKALKNLGYEV
                     VLVNSNPATIMTDAGTADATYIEPLNVQRITEIIEKERPDALLPNLGGQSGLNLSSEL
                     AKAGVLDHYGVKVIGVQLDAIERGEDRIAFKETMERLGIDMPKSSPAYTVEEAEKIAQ
                     ELGYPVVIRPAYTLGGTGGGLVYNVEELKTIVNRGISASMIGQVLVEESVLGWEELEL
                     EVVRDSKNQMITVCFIENIDAIGVHTGDSFCSAPMLTISQELQERLQKYAYSIVEAIE
                     VIGGTNVQFAHDPKTDRVVIIEINPRTSRSSALASKATGFPIALISSLLAAGLTLDEI
                     PYWREGTLDKYTPWGDYVVIKFARWAFEKFKGVEDKLGTQMRAVGEVMSIGKNYKEAF
                     QKAIRSLEIGRYGLGFAKDFNTKTLPELLELLKTPTSERHFMMYEALRQGADPAELAA
                     ITYVKTWFIEQMKELVDLEEKILEYQGRELPAELLIQAKKDGFADRYLAQLLGISETQ
                     VRRQRLGLGLTQAWDAVPVSGVNNASYYYSTYNAPDKVTTSQREKVLILGGGPNRIGQ
                     GIEFDYCCVHAAFALKNLGYETIMINCNPETVSTDYDTSDKLYFEPLTVEDVLSIYEK
                     ERPIGAIVQFGGQTPLNIAAQLQEAGVRILGTVPEVIDQAEDRDQFRKMMEKLAIPMP
                     QAGMASTLEEALAAAEMIGYPVMVRPSYVLGGRGMEIVFDEEQLREYVAAAVDITPER
                     PILIDKFLENAIEAEADAVSDGTHAFVPAVMEHIELAGIHSGDSACVIPPLTIADRHL
                     RTIIDYTQRIAQELHVVGLMNIQYAIAEDKVYVLEANPRASRTVPLVSKICNTPMARL
                     ATELILADYTGQKNDIATNFKPAQISHYGVKEAVFPFDKFPEVDPVLGPEMRSTGEVL
                     GMANSFGLAYFKAQEATHSSLPFSGTVLMSIAEQDRSSGVIEIAQEFLKLGFKIKATQ
                     GTRKFLQDHSIDAEFIHKIEEGRPNITDGIMNGEIQLVINTPIGKRSLKDDSYIRKTA
                     IKYKIPYITTTPAALASAKGIAASQEAAANKTVVKSLQEYHGEIM"
     misc_feature    complement(459094..462306)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="carbamoyl phosphate synthase large subunit;
                     Reviewed; Region: carB; PRK05294"
                     /db_xref="CDD:235393"
     misc_feature    complement(461956..462288)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(461305..461925)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(460687..461049)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="Carbamoyl-phosphate synthetase large chain,
                     oligomerisation domain; Region: CPSase_L_D3; smart01096"
                     /db_xref="CDD:198164"
     misc_feature    complement(460327..460653)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(459736..460311)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(459160..459492)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="Methylglyoxal synthase-like domain from type II
                     glutamine-dependent carbamoyl phosphate synthetase (CSP).
                     CSP, a CarA and CarB heterodimer, catalyzes the production
                     of carbamoyl phosphate which is subsequently employed in
                     the metabolic pathways...; Region: MGS_CPS_II; cd01424"
                     /db_xref="CDD:238712"
     misc_feature    complement(order(459265..459273,459337..459339,
                     459385..459390,459394..459396,459457..459459,
                     459475..459477))
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="IMP binding site; other site"
                     /db_xref="CDD:238712"
     misc_feature    complement(order(459304..459306,459340..459342,
                     459346..459351,459355..459357,459379..459381,
                     459391..459393))
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238712"
     misc_feature    complement(order(459169..459171,459181..459183,
                     459196..459198))
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="interdomain contacts; other site"
                     /db_xref="CDD:238712"
     misc_feature    complement(459190..459198)
                     /gene="carB"
                     /locus_tag="DSY0398"
                     /note="partial ornithine binding site; other site"
                     /db_xref="CDD:238712"
     gene            complement(462549..463466)
                     /locus_tag="DSY0399"
                     /db_xref="GeneID:3953753"
     CDS             complement(462549..463466)
                     /locus_tag="DSY0399"
                     /note="similarity to COG0583 Transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516632.1"
                     /db_xref="GI:89893145"
                     /db_xref="GeneID:3953753"
                     /translation="MMNLEQSTYLVEVDKYKSITKAANNLFVSQSTISMSIAHLEKEL
                     NIIIFKRSKTGVTATANGKKIITYAQNILNELKNMNEYAINCSNNLASTIKITSAPTF
                     CNSILIDIVTELLTTTPEIHIDLKENNNEHIIQNIYNGEIDIGIIGHLCDSKDRILNN
                     LDKKSISYEEFYCGNVNLYLNKNHPLLYKNSITLQDLSNYPLVSHQYLLKHWTNPLQL
                     KNLASEFYNYESIKIIIQNSNLIAIMPDIIEINDYSINAGLIVRLSEVELNTKVCYGC
                     IRSLKNDILPAEKKIIDLLKSKCDQIYIP"
     misc_feature    complement(462564..463463)
                     /locus_tag="DSY0399"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(463278..463457)
                     /locus_tag="DSY0399"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(462582..463190)
                     /locus_tag="DSY0399"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(462756..462761,462765..462770,
                     462786..462803,463086..463106,463110..463112,
                     463122..463124,463131..463136,463140..463145))
                     /locus_tag="DSY0399"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            463822..465330
                     /locus_tag="DSY0400"
                     /db_xref="GeneID:3953754"
     CDS             463822..465330
                     /locus_tag="DSY0400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516633.1"
                     /db_xref="GI:89893146"
                     /db_xref="GeneID:3953754"
                     /translation="MPYPTIYPTGTTIYKPEKCFNGFTIYPANGQGAMLIDMNGREVN
                     LWKDLEGMPNKILPGGFVMGSRGIRSPRHMTKEYIDVVQVDWDGNIVWKFDKHEYIED
                     PGEQPRWMARQKADYQRQGNPVGYYVPGMDPLTDQGNTLILCHKNVMKRKISYIPLID
                     DAIIEVDWQGNIIWEWVCSDHFDEYGFSEAAKNVLARDPNLRTSGINGMGDWMHINSM
                     SVLGPNQWYDAGDERFHPDNIIWDARQSNITAIIDKKTGKVVWRLGPDYDTPEMKKLG
                     WIIGQHHAHMIPKGLPGEGNIMIFDNGGLAGYGLPNPSAPTGFNNCRRDYSRVIEFNP
                     VTLEIEWQYGPHEAGFIVPLNSSRFYSPFISSAQRLPNGNTLITEGGGGRLFEVTHDH
                     EIVWEYISPYYGNGVYRGMSKYNGYKFNAVYRAYRVPYTYCPQAGVPEEVKIDPIDNE
                     DFRVPGAAPRGAVKVTVIEGTVDMSTTESDNFCLATDEQKEEVVKLVKREEK"
     misc_feature    <464224..465006
                     /locus_tag="DSY0400"
                     /note="Arylsulfotransferase (ASST); Region:
                     Arylsulfotrans; cl19972"
                     /db_xref="CDD:268325"
     gene            465542..467032
                     /locus_tag="DSY0401"
                     /db_xref="GeneID:3953755"
     CDS             465542..467032
                     /locus_tag="DSY0401"
                     /note="similarity to COG0471 Di- and tricarboxylate
                     transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516634.1"
                     /db_xref="GI:89893147"
                     /db_xref="GeneID:3953755"
                     /translation="MAAELQIKRKPIFSQSTKYYFHSAIAILLMFTFRFIPPFNPMIT
                     ETGMNALGIFLGVLYGWSFVGMIWPSLLGMIACGFTGIMTLQESFAMGFGSDLAVITI
                     FVFMFAAFMEESGLNSYIANWFISRKIVVGKPYAFLAAMMLSGFVLSCFTQIFAAIVI
                     VWSIFYNVAKEMGLQRREGFVNCTMFGILYSASLGAIVFPFSSFAIIALGLMKKATGL
                     TVNFLTFSLFNLLACSIIMLLYWLACKYLFRPDTQKLLSTEDRFAYMRGVKMNKKQKS
                     AAVGLGIFLTMLFLPGIFPNSSFIINQLKSLGVVGSVLLVMIAFMILRKDGSEGTEGI
                     LNFGDIARKGINWQVLVLLASTFPISSALESEQSGVLKAAEAFISSSISDLNPFLAMA
                     FLAILVACLTQFTHNAVLLIIFIPMLCPIVISHGINPIVLVVTLLYASKSALITPAAS
                     TQAAMIFANTEWVEIKELFKLAVVGATIMAVVAVAIIPLANISSVA"
     misc_feature    465611..467008
                     /locus_tag="DSY0401"
                     /note="Di- and tricarboxylate transporters [Inorganic ion
                     transport and metabolism]; Region: CitT; COG0471"
                     /db_xref="CDD:223547"
     misc_feature    465689..467011
                     /locus_tag="DSY0401"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     misc_feature    order(465707..465718,465737..465778,465824..465877,
                     465953..466003,466007..466060,466070..466072,
                     466088..466156,466217..466261,466274..466285,
                     466370..466396,466418..466444,466469..466486,
                     466574..466630,466709..466756,466808..466867,
                     466958..466996)
                     /locus_tag="DSY0401"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            467195..468439
                     /locus_tag="DSY0402"
                     /db_xref="GeneID:3953756"
     CDS             467195..468439
                     /locus_tag="DSY0402"
                     /note="similarity to COG3385 Predicted transposase(Evalue:
                     1E-61)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516635.1"
                     /db_xref="GI:89893148"
                     /db_xref="GeneID:3953756"
                     /translation="MQDKDTTQSTFMQAFQPFFSKDLWETIHREVPGLDLRSQKLTTN
                     QLTLLISHAQLQEYRALRKISTSVHHDSLGQAIGLESISHSQISRRLKTLPTQVPEML
                     FKGTLHNVAQKQGYGKIRQQLGKLYMIDASTMSLCLSRYPWAVFRKSKAGVKMHLRLS
                     FDAMAVPDEVLVTPAKTADRKKLDELIVQDQEALNIFDRGYVDYKLFDDYCEKGIRFV
                     TRLKNNAVIEFTGVERPVKEDGLIEEDVDVILGAGSRKMKHTLREVTIDDNVHEPFTI
                     LTNDFNLSAEELGEIYRYRWQIELFFKWLKQHAQIKHFYGTSETAVINQILLALMMYC
                     LLVLLKLEAGYPRDLLTLQRLLIACLFERYEEFLEKLRRRRRKGSKRIRYEEIYRMTE
                     HSILKEEETQWLDDLTYDPVIL"
     misc_feature    467579..468199
                     /locus_tag="DSY0402"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <467780..468298
                     /locus_tag="DSY0402"
                     /note="FOG: Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3385"
                     /db_xref="CDD:225920"
     gene            468669..468995
                     /locus_tag="DSY0403"
                     /db_xref="GeneID:3953757"
     CDS             468669..468995
                     /locus_tag="DSY0403"
                     /note="similarity to COG0526 Thiol-disulfide isomerase and
                     thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516636.1"
                     /db_xref="GI:89893149"
                     /db_xref="GeneID:3953757"
                     /translation="MLLQKLNASQFEEIIYTDGNPSLVIFSRKSCHVCKEVMPVLEDL
                     QSKYEGKFGFYYVDVEENKAVFQRFSLKGVPQILFFNFGEYQGKLSGKVEDEQIEEKI
                     SQVLKA"
     misc_feature    468693..468974
                     /locus_tag="DSY0403"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(468759..468761,468768..468770)
                     /locus_tag="DSY0403"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            complement(469062..469781)
                     /locus_tag="DSY0404"
                     /db_xref="GeneID:3953758"
     CDS             complement(469062..469781)
                     /locus_tag="DSY0404"
                     /note="similarity to COG0730 Predicted permeases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516637.1"
                     /db_xref="GI:89893150"
                     /db_xref="GeneID:3953758"
                     /translation="MNTYALILIVLIASTMQAATGFGFAIMSIPFLLLLLDPRDAIQL
                     NILLAFIISLMMIYKIRHTVKAATLKRLIMGSLLGTLPGILIFIFLDVRPLKLLISVL
                     LLISTCLLAAKIRFKESNTKEFLMGVCSGFLTTSIGMPGPPLMIYYAGTDLDKATIRS
                     TTVAYFVFINLLSILMQTFLYGSSAIVWKSTLISLPFLVLGIVLGQFVFVRLNQQRMQ
                     QLIYLLLFFTSIYLFVTTIAQ"
     misc_feature    complement(469086..469766)
                     /locus_tag="DSY0404"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            complement(469979..470593)
                     /locus_tag="DSY0405"
                     /db_xref="GeneID:3953759"
     CDS             complement(469979..470593)
                     /locus_tag="DSY0405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516638.1"
                     /db_xref="GI:89893151"
                     /db_xref="GeneID:3953759"
                     /translation="MEQIRPLPKINQIPVAISNRHVHLSQEDAQTLFGPNYSFKIKKD
                     LSQPGQYACEERVTLVGPKGVIENVRILGPVRPQTQVELSVSDGIKLGITPPVRDSGD
                     LANSAGITLVGPSGSLTLPEGVIAAARHIHMHSTDAERLGVKDRDRVSVTAPGPRGLV
                     FRETLIRVSHNFTLEMHIDIDEANAASLRNQDYVELLLVNHLPP"
     misc_feature    complement(470003..470572)
                     /locus_tag="DSY0405"
                     /note="propanediol utilization phosphotransacylase;
                     Provisional; Region: PRK15070"
                     /db_xref="CDD:237899"
     misc_feature    complement(470312..470557)
                     /locus_tag="DSY0405"
                     /note="Propanediol utilisation protein PduL; Region: PduL;
                     pfam06130"
                     /db_xref="CDD:253576"
     misc_feature    complement(470027..470233)
                     /locus_tag="DSY0405"
                     /note="Propanediol utilisation protein PduL; Region: PduL;
                     pfam06130"
                     /db_xref="CDD:253576"
     gene            complement(470665..472152)
                     /locus_tag="DSY0406"
                     /db_xref="GeneID:3953760"
     CDS             complement(470665..472152)
                     /locus_tag="DSY0406"
                     /note="similarity to COG1012 NAD-dependent aldehyde
                     dehydrogenases(Evalue: 1E-102)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516639.1"
                     /db_xref="GI:89893152"
                     /db_xref="GeneID:3953760"
                     /translation="MVFDTDLASIQESRNLVQKAKEAQLHLAHFNEQQIDKILASIVA
                     AVEENAEGLARMACQETEYGIVEHKIAKNLFAARDVYESTKHIKTIGTISEDPDRKVI
                     RYAVPMGVLVGITPRTNPTSTIIHNALCAIKGANAIVFSPHPFAVQCGCATASLINEA
                     AVKAGAPDGVCSCLSMTSLQASHELMHHPDVAAIIATGGPGLVKSAYSAGKPAFGVGS
                     GNVPVFIERSADIKQAVNDIMVSKTFDNGMICASEQSILADQPIKDEVIKELQNQGAY
                     FLSPEEVQKVGRVVIHANGSMNNALVGQSPAVIAQRAGISIPADTALLIAPMDGYGKD
                     YPLSHEKLTTVLSFYVVQDWKEACHLSIELLKLGGIGHSCAIHSQNEQVIREFLAKPV
                     FRIIVNTPSALGGIGQTTGIMPSLTLGCGTWGGSSISENLGPQHLINIKHLTYGLKKV
                     AFHKVPAAQGNVSPLLPPTKATSWDIKSDDIADVVKQVLQQLKIG"
     misc_feature    complement(470815..472113)
                     /locus_tag="DSY0406"
                     /note="Coenzyme A acylating aldehyde dehydrogenase (ACDH),
                     ALDH family 20-like; Region: ALDH_F20_ACDH; cd07122"
                     /db_xref="CDD:143440"
     misc_feature    complement(471403..471405)
                     /locus_tag="DSY0406"
                     /note="putative catalytic cysteine [active]"
                     /db_xref="CDD:143440"
     gene            complement(472172..472462)
                     /locus_tag="DSY0407"
                     /db_xref="GeneID:3953761"
     CDS             complement(472172..472462)
                     /locus_tag="DSY0407"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516640.1"
                     /db_xref="GI:89893153"
                     /db_xref="GeneID:3953761"
                     /translation="MQQDALGMVETKGLVGAIEAADAMVKAANVHLIGKVLVGGGLVT
                     VMVRGDVGAVKAATDAGAAAAQRVGELKSVHVIPRPHTEVEMILPHDDSGKA"
     misc_feature    complement(<472196..472456)
                     /locus_tag="DSY0407"
                     /note="Carbon dioxide concentrating mechanism/carboxysome
                     shell protein [Secondary metabolites biosynthesis,
                     transport, and catabolism / Energy production and
                     conversion]; Region: CcmK; COG4577"
                     /db_xref="CDD:226943"
     misc_feature    complement(472196..472450)
                     /locus_tag="DSY0407"
                     /note="1,2-propanediol utilization protein A (PduA),
                     Bacterial Micro-Compartment (BMC) domain; Region:
                     BMC_PduA; cd07059"
                     /db_xref="CDD:132899"
     misc_feature    complement(order(472214..472216,472223..472228,
                     472232..472234,472238..472246,472337..472345,
                     472352..472354,472367..472369,472385..472390,
                     472397..472399,472424..472426,472433..472435))
                     /locus_tag="DSY0407"
                     /note="Hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132899"
     misc_feature    complement(472352..472354)
                     /locus_tag="DSY0407"
                     /note="Putative hexagonal pore residue; other site"
                     /db_xref="CDD:132899"
     gene            complement(472491..472769)
                     /locus_tag="DSY0408"
                     /db_xref="GeneID:3953762"
     CDS             complement(472491..472769)
                     /locus_tag="DSY0408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516641.1"
                     /db_xref="GI:89893154"
                     /db_xref="GeneID:3953762"
                     /translation="MQQEALGMIETKGLIGAIEAADAMVKAANVHLIGNVLVGGGLVA
                     VMVRGDVGAVKAATDAGAAAAQRVGELISVHVIPRPHGEVEMILPKAK"
     misc_feature    complement(472503..472757)
                     /locus_tag="DSY0408"
                     /note="Bacterial Micro-Compartment (BMC) domain; Region:
                     BMC; cl01982"
                     /db_xref="CDD:261139"
     misc_feature    complement(order(472644..472646,472659..472661,
                     472674..472676,472692..472697,472704..472706,
                     472731..472733,472740..472742))
                     /locus_tag="DSY0408"
                     /note="Hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132884"
     misc_feature    complement(472659..472661)
                     /locus_tag="DSY0408"
                     /note="Hexagonal pore residue; other site"
                     /db_xref="CDD:132884"
     gene            complement(472826..473476)
                     /locus_tag="DSY0409"
                     /db_xref="GeneID:3953763"
     CDS             complement(472826..473476)
                     /locus_tag="DSY0409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516642.1"
                     /db_xref="GI:89893155"
                     /db_xref="GeneID:3953763"
                     /translation="MKALITAADVKTAAETPEKILTISEADLITPAARDAAKELGVQI
                     TAHPVSLPPTVAPPAAAPPSTISPSPAFSPTSPLDPALVSRIIEEVMVCLNRSGSPAH
                     PQKEADPGGLRIVKGNSLILEDFSTGNPRDRIKIKELFNKKECPLYSAGIMALDKTSY
                     SLTPARDELNYIIEGTLECCIDNRCYTAQAGDTLYIPAQAKITLTAPDKVKLFYVC"
     misc_feature    complement(472832..473233)
                     /locus_tag="DSY0409"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            complement(473525..474052)
                     /locus_tag="DSY0410"
                     /db_xref="GeneID:3953764"
     CDS             complement(473525..474052)
                     /locus_tag="DSY0410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516643.1"
                     /db_xref="GI:89893156"
                     /db_xref="GeneID:3953764"
                     /translation="MEVNSIARGIEAADAMLKAAQVDLLEAKPVCPGKYIVLICGDVA
                     AVQSSVAAGKTMAAHSVLDDFILPNVHPQVLTAISAATPLTLIKALGIIETFSIASLM
                     VAADTAAKTGQVDLVEIRIGMGIGGKSFVTLTGDVASVESSVAAGVMLASERGMLVDK
                     VVIPSPHDHLKRCLR"
     misc_feature    complement(473531..474052)
                     /locus_tag="DSY0410"
                     /note="PduT-like ethanolamine utilization protein; Region:
                     eut_PduT; TIGR02526"
                     /db_xref="CDD:131578"
     misc_feature    complement(473837..474049)
                     /locus_tag="DSY0410"
                     /note="1,2-propanediol utilization protein T (PduT),
                     Bacterial Micro-Compartment (BMC) domain repeat 1; Region:
                     BMC_PduT_repeat1; cd07053"
                     /db_xref="CDD:132893"
     misc_feature    complement(order(473951..473953,473966..473968,
                     473981..473983,473999..474004,474011..474013,
                     474038..474040,474047..474049))
                     /locus_tag="DSY0410"
                     /note="putative hexamer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132893"
     misc_feature    complement(473966..473968)
                     /locus_tag="DSY0410"
                     /note="putative hexagonal pore; other site"
                     /db_xref="CDD:132893"
     misc_feature    complement(473555..473788)
                     /locus_tag="DSY0410"
                     /note="1,2-propanediol utilization protein T (PduT),
                     Bacterial Micro-Compartment (BMC) domain repeat 2; Region:
                     BMC_PduT_repeat2; cd07054"
                     /db_xref="CDD:132894"
     misc_feature    complement(order(473669..473671,473690..473692,
                     473705..473707,473723..473728,473735..473737,
                     473762..473764,473771..473773))
                     /locus_tag="DSY0410"
                     /note="putative hexamer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132894"
     misc_feature    complement(473690..473692)
                     /locus_tag="DSY0410"
                     /note="putative hexagonal pore; other site"
                     /db_xref="CDD:132894"
     gene            complement(474052..475443)
                     /locus_tag="DSY0411"
                     /db_xref="GeneID:3953765"
     CDS             complement(474052..475443)
                     /locus_tag="DSY0411"
                     /note="similarity to COG1726 Na+-transporting
                     NADH:ubiquinone oxidoreductase alpha subunit(Evalue:
                     1E-45)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516644.1"
                     /db_xref="GI:89893157"
                     /db_xref="GeneID:3953765"
                     /translation="MRRKINWPRCPSMREELIQKIKKAGVVGAGGAGFPTHVKVNSKA
                     RTVLVNGAECEPLLRVDQQLMAGQAPKVVMGLELVMSVTGAKEGIISLKHKYHDAISA
                     LEKEISGKPIRIHILDDFYPAGDEHVTVYESTGRLVPQGSIPLKVDCVVHNVETLLNI
                     VDAVADQPVTDTYLTITGEVNQPLTLRLPIGTSISEALAIAGYHDSEGMQVIEGGPMM
                     GKIVADLHQPITKTTKGLIVLPREHPLLRLKTLPADKVLRQSRASCVQCRFCTDLCPR
                     YLLGHRLEPHKIMRMVNYGQGQEETMKMAFACSECGVCEQYACIMGLSPRAVNALLKK
                     ELTRLGIKPSPSPADQAVDPLQPHRKIPVKRLISRLALQDYDRNAPLQEKDYPIDRVA
                     IKLCQHVGAPSVPIVKAGQRVKKGDPIASPPAKGLGSYLHASIDGVVQEITDSILISA
                     REGSETQPWNPSV"
     misc_feature    complement(474964..475344)
                     /locus_tag="DSY0411"
                     /note="Respiratory-chain NADH dehydrogenase 51 Kd subunit;
                     Region: Complex1_51K; pfam01512"
                     /db_xref="CDD:250674"
     misc_feature    complement(474787..474927)
                     /locus_tag="DSY0411"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     misc_feature    complement(474472..474654)
                     /locus_tag="DSY0411"
                     /note="4Fe-4S dicluster domain; Region: Fer4_17;
                     pfam13534"
                     /db_xref="CDD:257853"
     misc_feature    complement(<474118..474294)
                     /locus_tag="DSY0411"
                     /note="RnfC Barrel sandwich hybrid domain; Region: RnfC_N;
                     pfam13375"
                     /db_xref="CDD:257702"
     gene            complement(475400..475690)
                     /locus_tag="DSY0412"
                     /db_xref="GeneID:3956008"
     CDS             complement(475400..475690)
                     /locus_tag="DSY0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516645.1"
                     /db_xref="GI:89893158"
                     /db_xref="GeneID:3956008"
                     /translation="MRIGRVINSIWATRKADSLIGTKLMIVQLLDRPHGELGPIIVAA
                     DIIGAGIGEKVLVTEGSSARNMDNFNDSPIDSTIVGIIDEEKDKLAEVSKHA"
     misc_feature    complement(475442..475690)
                     /locus_tag="DSY0412"
                     /note="Ethanolamine utilisation protein and carboxysome
                     structural protein domain family; Region: EutN_CcmL;
                     cd01614"
                     /db_xref="CDD:133473"
     misc_feature    complement(order(475442..475444,475448..475450,
                     475454..475456,475463..475471,475499..475501,
                     475517..475519,475550..475552,475565..475567,
                     475649..475660,475664..475672,475682..475684,
                     475688..475690))
                     /locus_tag="DSY0412"
                     /note="Hexamer/Pentamer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133473"
     misc_feature    complement(order(475466..475468,475481..475483,
                     475499..475501,475571..475573,475598..475600,
                     475607..475609,475685..475687))
                     /locus_tag="DSY0412"
                     /note="central pore; other site"
                     /db_xref="CDD:133473"
     gene            complement(475741..476571)
                     /locus_tag="DSY0413"
                     /db_xref="GeneID:3956009"
     CDS             complement(475741..476571)
                     /locus_tag="DSY0413"
                     /note="similarity to COG1077 HSP70 class molecular
                     chaperones involved in cell morphogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516646.1"
                     /db_xref="GI:89893159"
                     /db_xref="GeneID:3956009"
                     /translation="MEKANQRIAAFQETMDHPRPYQGQKRLYTGVDLGTAYTVLAVVD
                     EEGTPVAGAMGFAQVVRDGLVVDYIGAVDILRELKATLEESLGVELLKAGVAYPPGTS
                     PGDQKALHYIAEAVGFDVIAALDEPTAANNVLNIEDGAVIDIGGGTTGTAVIGQGQVV
                     CVADEPTGGTHVSLVIAGAYRLPFAEAEKLKMDSRKHQELLPVIKPVIEKIAGIIRGH
                     IQDHPVDRVYLVGGTSCFTGFETIVAAELQRPVIKPANPFLVTPLGIALAAAKTCSNP
                     "
     misc_feature    complement(475765..476568)
                     /locus_tag="DSY0413"
                     /note="ethanolamine utilization protein EutJ; Provisional;
                     Region: PRK15080"
                     /db_xref="CDD:237904"
     misc_feature    complement(475762..476499)
                     /locus_tag="DSY0413"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    complement(order(475879..475881,476134..476145,
                     476194..476196))
                     /locus_tag="DSY0413"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            complement(476637..477575)
                     /locus_tag="DSY0414"
                     /db_xref="GeneID:3956010"
     CDS             complement(476637..477575)
                     /locus_tag="DSY0414"
                     /note="similarity to COG2159 Predicted metal-dependent
                     hydrolase of the TIM-barrel fold(Evalue: 8E-31)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516647.1"
                     /db_xref="GI:89893160"
                     /db_xref="GeneID:3956010"
                     /translation="MNIIDFRFRPNTEAILKGISSNPAFKGMCQSIDFNKMLPQTLEE
                     VVEELDRHHVVKAVISGRDCETTYGAQSNNPSVIEFCHKFPDKFIGFAGLDPHKGMAA
                     LAEITHAVHEEGIKGAAIDPYLARIYVNDAKYYPIYAKCCELGIPLIIATGPGTLVPN
                     AVIDHVAPRYIDFVARDFPELKIIASHGGYPWVNEMITVAQRNANVYLELSEYEFFPQ
                     SSAYIEAANSILSDKIMYASAHPFVDFKLALKNYEQLPLKPEVREKVMYKNAAKVLGL
                     SDGTFSASKAMDAQEVQMIIENVIAQLSQRGLLADR"
     misc_feature    complement(476745..>477356)
                     /locus_tag="DSY0414"
                     /note="Predicted metal-dependent hydrolase of the
                     TIM-barrel fold [General function prediction only];
                     Region: COG2159"
                     /db_xref="CDD:225070"
     gene            477879..479273
                     /locus_tag="DSY0415"
                     /db_xref="GeneID:3956011"
     CDS             477879..479273
                     /locus_tag="DSY0415"
                     /note="similarity to COG3829 Transcriptional regulator
                     containing PAS, AAA-type ATPase, and DNA-binding
                     domains(Evalue: 2E-91)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516648.1"
                     /db_xref="GI:89893161"
                     /db_xref="GeneID:3956011"
                     /translation="MTQDHWNKFATSQVYQQVIELLPEGVYISDAEGTTIAVNSMYEQ
                     LTGLKGQEVMGENVKVLVEKGVYNLALNPEIVVTGEHKMSVQITKTGRKVLLNGYPIF
                     DDSGKVSFVLTFVRDISLLSQLKEQIADQQEIIDKYREANEQCKKALTSNVEIFESKK
                     MIALMEKLKKIAKTDTTVLLLGETGVGKDVLARKIHQYSPRRKEPFLKIDCSTIPENL
                     IESELFGYEQGAFSGANTKGKVGLFEMADKGTLFLDEIGEIPLQLQVKLLRVLQDQEI
                     IHIGSTKVKKVNVRFIAATNRDLEEEVRKGTFRSDLYYRLRVADLEIPPLRERQEDIR
                     VMMQAFLDKYNAKFRKEISFTKELAEVLLAYKWPGNVRQMDNLIQSLVVTHETESVDV
                     TDLPHYMLLDLSKPEEAGNPSQGKSLDELVADYERNLLKKALDRYKSSSKVAEFFQVD
                     RSTIFRKAKKYKLL"
     misc_feature    477942..478232
                     /locus_tag="DSY0415"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    477945..478235
                     /locus_tag="DSY0415"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    order(477990..477992,478002..478004,478020..478022,
                     478059..478070,478125..478127,478149..478151)
                     /locus_tag="DSY0415"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(478050..478052,478062..478064,478074..478079,
                     478164..478166,478170..478172)
                     /locus_tag="DSY0415"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    478341..479210
                     /locus_tag="DSY0415"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    478359..478829
                     /locus_tag="DSY0415"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    478422..478445
                     /locus_tag="DSY0415"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(478425..478448,478638..478640,478764..478766)
                     /locus_tag="DSY0415"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    478626..478643
                     /locus_tag="DSY0415"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    478821..478823
                     /locus_tag="DSY0415"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            479594..482071
                     /locus_tag="DSY0416"
                     /db_xref="GeneID:3956012"
     CDS             479594..482071
                     /locus_tag="DSY0416"
                     /EC_number="2.3.1.54"
                     /note="similarity to COG1882 Pyruvate-formate
                     lyase(Evalue: 1E-112)"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate-formate lyase"
                     /protein_id="YP_516649.1"
                     /db_xref="GI:89893162"
                     /db_xref="GeneID:3956012"
                     /translation="MSTCCLSPHEERIIDPQKGKVNYEGRERVFKILESFQDLRPKID
                     VERAKYFTESFKATEGQPLQPRWAKALMHIAQNITVYIDDQQLIVGRAGAQGRYGIVF
                     PELDGDFLGLAIEQLPQRVESPFNIDPDDAQIIINDVAPYWKGKTFHEELAKALPEDT
                     LKVTYDPADPLASRFIVNETASFRSSIQWVHDYEKVLKRGFKGIKEEAQAKLDQLDPL
                     SPADNMEKRPFLEAVIITCDAIVVWANRHAHLAAQMAKLEKDPQRKQELSDIAERCAW
                     VPEHPARNFREAVQSQWFVQMFSRIEQKTGTIISNGRMDQYFYPYYQKDVAEGILTPQ
                     QAIELLECMWVGMAQFIDLYLSPTGGAFNEGYAHWEAVTVGGQTPDGVDATNELTYLF
                     LESKQKFPLNYPDLAARIHSRSPERYLYEVAETVKEGTGFPKLINDEEVVPLLLSKGA
                     KFAEALDYAVSGCAECRMPNRDTYTSGNPYINFAAAIEMTLYNGRMLKYGDEQLGLET
                     GDPTQFETWDEFWKAYLAQQTNFLKHAFIQQHIIIRLRAQHFASPLGSLMHDLCMENC
                     LDLHQPVIKGGIDLGYFELIGYGTVVDSLAAIKKLVYEEKKLTMAELLEAVRNNFEGH
                     EVIREMVMHTPKYGNNDPYSDVIAKEVDRTAVEFTKKYSRELGVHLDLRLVPFTSHVP
                     FGKVVSATPNGRKAWMPLADGSSASHGADVNGPTAVLLSNFFSKNYGYRNRAARLLNI
                     KLSPSCVAGEEGSEKLVSFIRTWCDLKLWHIQFNIVNRETLLAAKQDPDKYRGLIVRV
                     AGYSAYFVDLSSDLQDDIIARTEHEML"
     misc_feature    479672..482065
                     /locus_tag="DSY0416"
                     /note="glycyl radical enzyme, PFL2/glycerol dehydratase
                     family; Region: PFL2-3; TIGR01774"
                     /db_xref="CDD:233568"
     misc_feature    479672..482056
                     /locus_tag="DSY0416"
                     /note="Pyruvate formate lyase 2 and related enzymes;
                     Region: PFL2_DhaB_BssA; cd01677"
                     /db_xref="CDD:153086"
     misc_feature    order(479768..479779,480023..480031,480041..480046,
                     480053..480064,480263..480268,480272..480277,
                     481211..481213,481223..481225,481238..481240,
                     481574..481582,481586..481588)
                     /locus_tag="DSY0416"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153086"
     misc_feature    order(480155..480157,480512..480517,480680..480682,
                     480698..480700,480977..480982,480986..480988,
                     481022..481024,481616..481618,481622..481624)
                     /locus_tag="DSY0416"
                     /note="active site"
                     /db_xref="CDD:153086"
     misc_feature    481982..481996
                     /locus_tag="DSY0416"
                     /note="glycine loop; other site"
                     /db_xref="CDD:153086"
     gene            482133..483065
                     /locus_tag="DSY0417"
                     /db_xref="GeneID:3956013"
     CDS             482133..483065
                     /locus_tag="DSY0417"
                     /EC_number="1.97.1.4"
                     /note="similarity to COG1180 Pyruvate-formate
                     lyase-activating enzyme(Evalue: 5E-60)"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate-formate lyase-activating enzyme"
                     /protein_id="YP_516650.1"
                     /db_xref="GI:89893163"
                     /db_xref="GeneID:3956013"
                     /translation="MGESKVSERKTGIVFNIQHYSVHDGPGIRTIVFTKGCPLRCPWC
                     SNPESQRLQLQLGFNPNKCLGIKACFRCAEVCAYGAVKLNVEESDRILIDRKLCTDCL
                     QCVDVCPSQALQAFGKPITVEDVLKEVEKDSVFYARSGGGLTFSGGEPLMQGNFVAET
                     LKEARRRRLKTTIETCGYADWSTMERVCQHLTSLIMDIKCMDPEKHQEYTGASNELIL
                     DNFNKLCEHFPKLPKLIRTPVVPGFNDREEDIREIAEFVKDKPNVTYELLKYHRLGQQ
                     KYHFLGREYPWPDTQLEDVKFEKLKEVAKSIVNQ"
     misc_feature    482172..483053
                     /locus_tag="DSY0417"
                     /note="glycyl-radical enzyme activating protein family;
                     Region: PFLE_PFLC; TIGR02494"
                     /db_xref="CDD:233895"
     misc_feature    482436..483050
                     /locus_tag="DSY0417"
                     /note="DRE-TIM metallolyase superfamily; Region:
                     DRE_TIM_metallolyase; cl18962"
                     /db_xref="CDD:267315"
     gene            483087..484109
                     /locus_tag="DSY0418"
                     /db_xref="GeneID:3956014"
     CDS             483087..484109
                     /locus_tag="DSY0418"
                     /note="similarity to COG1638 Dicarboxylate-binding
                     periplasmic protein(Evalue: 2E-39)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516651.1"
                     /db_xref="GI:89893164"
                     /db_xref="GeneID:3956014"
                     /translation="MKKGLLKVSVLILTCLLVFSLSGCSKTEKASADGKIVIRLGHPM
                     APGNNVTVGYEKFKEIVEQKSEGKIEIQIFGNTTLGSDRVTMESTQKGTLEMASCSSP
                     NMASFAREFMVFDLPYITAPEHQQKLYAALNEGELEQYLDNVCGKIGLKPIMYSEFGY
                     RNFVSTKKPITKAADLKGLKVRTTDSPVEVAVAEALGMSATPVAWGETYTALQQGTVD
                     AEGNTWGLLSDAKHGEILEYGIDSGHNYSMHLLMINKKYFEALPEDLQTILVESGKEA
                     LEWQRAVSNDMETEAKQKLIDSGVTLYDLTPAEKEELKTITRPVWDKFPEIPQELIDL
                     VTATQK"
     misc_feature    483120..484106
                     /locus_tag="DSY0418"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            484268..486142
                     /locus_tag="DSY0419"
                     /db_xref="GeneID:3956015"
     CDS             484268..486142
                     /locus_tag="DSY0419"
                     /note="similarity to COG1593 Integral membrane protein,
                     possible transporter(Evalue: 1E-141)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516652.1"
                     /db_xref="GI:89893165"
                     /db_xref="GeneID:3956015"
                     /translation="MLDIAKKPENSWKKWLRWIDGNFEKPFLVIGMLAIIMLITYQTL
                     YRYIVSNITGGTAIVGLEELARFIFIWITYLAIPLAIKGRNNIRVDILYDRISDRWQK
                     ISWIMVDSCILVLTGVIFFMGIDHLQMMLNYPQTSPALNIPFFFPYLILPIGFGLMSI
                     RCIQDLVKQALEIGLKDTLIGVLVTAAIFSPLFLKPDVPAMAWLFGYFVLFIFIGVPI
                     AMALGLSALGTILCANTMPIEYISQISFTSIDSFPIMAIPFFVAAGVFMGEGGLSKRL
                     LGLADELLGSFTGGLALATVVTCMFFAAISGSGPATVAAIGSLTIPAMVERGYSRAFA
                     AALVAAAGSIGVMIPPSNPFVVYGVSAQVSIGKLFMGGIVPGLIIGLVLMGISYYYSK
                     KNGWKGEARKRTFRTVGKAFWEAKWALMVPVIILGGIYSGYMTPTESAAVAAFYGLIV
                     GVFIHRGINLKNIVYCFTESCSTSAVIIALMAMATIFGNILTIEQIPTKIATWMLAIT
                     DSKYVILLIITLLLLFVGTFMEALAAIVILTPILLPIVLQVGIDPIHFGIIMVVNLAI
                     GFITPPVGVNLFVASGLAKLKIEEISKAVVPFLLGMIAVLLLISYVPSISMFLTQFVK
                     "
     misc_feature    484370..484768
                     /locus_tag="DSY0419"
                     /note="Tripartite ATP-independent periplasmic
                     transporters, DctQ component; Region: DctQ; pfam04290"
                     /db_xref="CDD:252507"
     misc_feature    484880..486112
                     /locus_tag="DSY0419"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     misc_feature    485003..486133
                     /locus_tag="DSY0419"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; COG1593"
                     /db_xref="CDD:224509"
     gene            486352..487608
                     /locus_tag="DSY0420"
                     /db_xref="GeneID:3956016"
     CDS             486352..487608
                     /locus_tag="DSY0420"
                     /note="similarity to COG0389 Nucleotidyltransferase/DNA
                     polymerase involved in DNA repair(Evalue: 1E-65)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516653.1"
                     /db_xref="GI:89893166"
                     /db_xref="GeneID:3956016"
                     /translation="MPEHKAKDCDIVLFDANSYYASCHQAVNPELQGKPLLVAGDPRN
                     RTGIILTASYEARFYGVKTAMPLFQALKLCPEAVVLSPDFRLYLDLSRKMWEIVERYT
                     DEDHIEVVSVDECFADFRGSHLLFGSTEEIARRVQKEILEELGLGVSVGVSYCKIFAK
                     LASDYQRDPKTRVKLPRSFTVIAPGELESKVWPLGVGELSGIGRQTEKQLADLGIRTI
                     GDLAQASPQALRKGFGVYGAKLYAWANGRDERPVTPEDQAKDHSIGRSITLPQDITDP
                     EQGAEVLLFLADSVGRKVRREDTKAQTLTVQVKDAEFKTRTYSTTLFEPTDSTDVIYR
                     ESLKLLAKWPQGKPIRLLGLTASRLQKGIEQLSLFQEESEEQTELDRTVDELRDKYGS
                     GILMRGTQYLSLSRKLAGRSTKDKRE"
     misc_feature    486370..487593
                     /locus_tag="DSY0420"
                     /note="DNA polymerase IV; Reviewed; Region: PRK03103"
                     /db_xref="CDD:235104"
     misc_feature    486394..487428
                     /locus_tag="DSY0420"
                     /note="DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa;
                     cd03586"
                     /db_xref="CDD:176459"
     misc_feature    order(486394..486399,486403..486411,486499..486504,
                     486511..486513,486520..486522,486688..486690,
                     486871..486873)
                     /locus_tag="DSY0420"
                     /note="active site"
                     /db_xref="CDD:176459"
     misc_feature    order(486469..486471,486547..486549,486682..486684,
                     486688..486693,486829..486831,486949..486969,
                     487054..487059,487126..487128,487135..487155,
                     487228..487230,487297..487308,487312..487314,
                     487399..487404,487414..487416,487423..487425)
                     /locus_tag="DSY0420"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176459"
     gene            complement(487676..488713)
                     /locus_tag="DSY0421"
                     /db_xref="GeneID:3956017"
     CDS             complement(487676..488713)
                     /locus_tag="DSY0421"
                     /note="similarity to COG2931 RTX toxins and related
                     Ca2+-binding proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516654.1"
                     /db_xref="GI:89893167"
                     /db_xref="GeneID:3956017"
                     /translation="MKIQSSAIVMAGESKHTESYKKEVTLQSWQNKDAAGKPVLNLEN
                     TDILDLSDSIKDRKSPAANVQQAQEISLEMSEGDKRKLELLQLMLEAITGKKLRFFVP
                     QKLVLNDSNRLPFSPTQAPTQGWGIVFESREQYIEQQSMSFSAQGQVTTADGKTIDLQ
                     LQLNISRSFAYQNNISFRAGDAVTIDPLAINLGVSSAQLTQQKYVFDLDYDGNTELIS
                     FLAPGSGFIALDKNGDGIINDGSELFGTRSGDGFADLALYDSDHNGWIDENDPIYDKL
                     RIWTKNEKGEDVLFALGEQSIGALYLGSAATDFSLKGDRNQSLGEIRRTGIYLNENGT
                     VGTLQHVDLTI"
     gene            488899..489435
                     /locus_tag="DSY0422"
                     /db_xref="GeneID:3956018"
     CDS             488899..489435
                     /locus_tag="DSY0422"
                     /note="similarity to COG0778 Nitroreductase(Evalue:
                     4E-23)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516655.1"
                     /db_xref="GI:89893168"
                     /db_xref="GeneID:3956018"
                     /translation="MSFLELAQKRRSLRSYLPDPVEQEKLEYVLECARLAPSWKNLQC
                     WRFIVVEDADLRQELTTAYAETNPGRKALLQAPLIVVLCGVPAESEVWEGKDYMMLDA
                     GLAMEHLILAAAEQGLGTCWQGLFAEDKVREILKVPENVRVLAMTPLGYPAEERKPRP
                     RKEMSQIVFKGTWGSGNA"
     misc_feature    488905..489402
                     /locus_tag="DSY0422"
                     /note="Nitroreductase-like family 3. A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_3; cd02139"
                     /db_xref="CDD:239054"
     misc_feature    order(488926..488928,488932..488934,488938..488940,
                     489016..489018,489268..489273)
                     /locus_tag="DSY0422"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239054"
     gene            489484..490212
                     /locus_tag="DSY0423"
                     /db_xref="GeneID:3956019"
     CDS             489484..490212
                     /locus_tag="DSY0423"
                     /note="similarity to COG1451 Predicted metal-dependent
                     hydrolase(Evalue: 2E-26)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516656.1"
                     /db_xref="GI:89893169"
                     /db_xref="GeneID:3956019"
                     /translation="MPSSLKLGKTIIPYEERKSSRIKRISIRITPEKVRVSAPARTAK
                     GEIQAFIEKNQEWILENWTKLQETMVKPPRVYETGEKVSYLGKELNLEIIDTPHKMIS
                     AFYRKDQETLEIKMPQELQGEQRQEAVREILDKWYKQKARAVFLQKLNLWSRQMGVTY
                     NQFRLKEQKTRWGSCSSLGNINLNWRAVMAPEPVLDYLVIHELSHLIYLNHSAEFWEH
                     VARYCPEHAAHRRWLREKGHSLVI"
     misc_feature    489550..490188
                     /locus_tag="DSY0423"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     pfam01863"
                     /db_xref="CDD:145171"
     gene            490314..491153
                     /locus_tag="DSY0424"
                     /db_xref="GeneID:3956020"
     CDS             490314..491153
                     /locus_tag="DSY0424"
                     /note="similarity to COG2267 Lysophospholipase(Evalue:
                     8E-35)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516657.1"
                     /db_xref="GI:89893170"
                     /db_xref="GeneID:3956020"
                     /translation="MEQGCQLIQTREGTRIYYRQRLPAHPKAVVMICHGYAEHSSFYV
                     QFMEFLAEHGYGAYALDHRGHGHSEAERGHLDRFEVFLEDLDVFVDHVRELHPTQPLF
                     MFGHSMGGLISFNYGILHPGKLQGQIFSGAALARPVGTEYIPTFLFKLLNVVLKRLRI
                     RPKLSGKTTRNMAVRKISDGDSLVLRYATLGFFYQFACRGVAFAQEKAGRYQLPCLIL
                     HGTGDRLVPYQASQRIFAEISSRDKTLKLYEGLYHELIHEPEREEVLADIVDWLERRV
                     KFC"
     misc_feature    490350..491144
                     /locus_tag="DSY0424"
                     /note="Lysophospholipase [Lipid metabolism]; Region: PldB;
                     COG2267"
                     /db_xref="CDD:225176"
     misc_feature    490350..490583
                     /locus_tag="DSY0424"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     pfam12146"
                     /db_xref="CDD:256874"
     misc_feature    490530..>490655
                     /locus_tag="DSY0424"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            491371..492144
                     /locus_tag="DSY0425"
                     /db_xref="GeneID:3956021"
     CDS             491371..492144
                     /locus_tag="DSY0425"
                     /note="similarity to COG1434 Uncharacterized ACR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516658.1"
                     /db_xref="GI:89893171"
                     /db_xref="GeneID:3956021"
                     /translation="MKRSWGSWLSILAGIIGILDTIVVTGLKGGVNLGTILPAGVGSL
                     FLLWGLWGDKSRNTLFSQRFPGLRKLIRWGIVLLLGSFFIIEGLILWNTEDRIPEQGK
                     VLIILGAGLNGEQLSWTLRERVDKGVGILAENPQMKVVVSGGQGPGEWIPEAEAMAQY
                     LIGQGIAPERILKEDRSTSTMENFRFSRVLLDQLEGFDPAEPVLVITSDFHMFRSKIL
                     AERNGLNPVGVPCSTPWYIRPNAYLREYFAVVKSILIDR"
     misc_feature    491677..492117
                     /locus_tag="DSY0425"
                     /note="YdcF-like. YdcF-like is a large family of mainly
                     bacterial proteins, with a few members found in fungi,
                     plants, and archaea. Escherichia coli YdcF has been shown
                     to bind S-adenosyl-L-methionine (AdoMet), but a
                     biochemical function has not been...; Region: YdcF-like;
                     cd06259"
                     /db_xref="CDD:99750"
     misc_feature    order(491908..491910,491917..491919,491989..491991,
                     492001..492003,492010..492012,492103..492105)
                     /locus_tag="DSY0425"
                     /note="putative active site [active]"
                     /db_xref="CDD:99750"
     gene            492178..492705
                     /locus_tag="DSY0426"
                     /db_xref="GeneID:3956022"
     CDS             492178..492705
                     /locus_tag="DSY0426"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516659.1"
                     /db_xref="GI:89893172"
                     /db_xref="GeneID:3956022"
                     /translation="MLRGSHGDEFSLRIVGYEFPDKDNDLGFDSNWLIVEVYCKHGEK
                     TWVKRAPSLLTWEAGILIKWARDILYKQPESEVLEFIEPNLLFQALRGENGKIETLRV
                     TLGHETCPDWVHTLRKPAYFSMDFAINPEDIEAFCQSLEADLLIYPRRLQGIKELASS
                     PRDRLRIVKKDNDRT"
     gene            complement(492711..494831)
                     /locus_tag="DSY0427"
                     /db_xref="GeneID:3956023"
     CDS             complement(492711..494831)
                     /locus_tag="DSY0427"
                     /note="similarity to COG0744 Membrane carboxypeptidase
                     (penicillin-binding protein)(Evalue: 1E-120)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516660.1"
                     /db_xref="GI:89893173"
                     /db_xref="GeneID:3956023"
                     /translation="MNNSPDPQGKWQAYLSKALAKCRTFKFPAFYKKPKFWRNLAILF
                     LFVLLSGLGAGYYWISTLDVSKLESPLAKPTYIYDQAGNKISQLSSSRIEPVTLEQVP
                     QLTQQAIIATEDKRFYEHQGVDFRSILRALIQDLKTRNFSEGGSTISQQLAKNLFLTS
                     DKTLSRKLKEAGYAIKIEATLSKEEILEAYLNHIYFGEGRWGLQEATRYYFGKNAEEL
                     NLEESALLAGILKGPTIYSPLQDKELALQRRNIVLAMMADQGYITAKEAAQATAAPIA
                     LRTKPLDNLSGKYAPYVDYVIEEAINRYGFTEDQILTLGLQIHTQMDAKVQQAAETVY
                     KDDQFFPQGQSDQKVQSGIAILDQHTGAIRGLVGYRGESAFRQFNHASQLKRQPGSII
                     KPLMVYGPALEKGYRPDALLYDGPLDLDGYAPKDWDGQTRGWVTMEEAIQQSWNIPAV
                     WLFDQIGIDTGKAFVQKAGIPLTEKDAHLSLALGGFAEGVSPLEIAQAYTAFANQGLM
                     HTAHAITKITTADGHVLAQMQPESVQVTEPAHAYTMTLLLQNVVQQGTAPKAALGSRP
                     VAGKTGSVELPPTQEFAGISKGQKDVWFVGYTPELTAAIWMGYDQTDRDHYLTTSGGS
                     GPAVVFHEVLSSALKDTPIKPFEVPAGYVKDWNIWPEGWDDQDEYDQNKDDDKDKKDK
                     KGKKNKKDPKDKNEFWDLFQDLWS"
     misc_feature    complement(494061..494588)
                     /locus_tag="DSY0427"
                     /note="Transglycosylase; Region: Transgly; pfam00912"
                     /db_xref="CDD:250219"
     misc_feature    complement(492912..494552)
                     /locus_tag="DSY0427"
                     /note="penicillin-binding protein, 1A family; Region:
                     PBP_1a_fam; TIGR02074"
                     /db_xref="CDD:233710"
     misc_feature    complement(492930..493778)
                     /locus_tag="DSY0427"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl17760"
                     /db_xref="CDD:266819"
     gene            495216..496052
                     /gene="panB"
                     /locus_tag="DSY0428"
                     /db_xref="GeneID:3956024"
     CDS             495216..496052
                     /gene="panB"
                     /locus_tag="DSY0428"
                     /note="catalyzes the formation of tetrahydrofolate and
                     2-dehydropantoate from 5,10-methylenetetrahydrofolate and
                     3-methyl-2-oxobutanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="YP_516661.1"
                     /db_xref="GI:89893174"
                     /db_xref="GeneID:3956024"
                     /translation="MKTTKDFWVMKNEGKKIVMITAYDYPSAKQAEQAGADIILVGDS
                     LGNVVLGYDSTVYVTMEDMIHHGKAAKRGAPNTFIVADMPFMSCHLSIRDTLLNGARL
                     IQETGAQAVKVEGADEMIPHIRALVRAGIPVVSHLGLTPQTAAVLGGFKVRGKDGEAA
                     RKMLEDVKECQEAGAFALVLECIPKQLAQEISTNLTIPTIGIGAGVHTDGQVLVYHDI
                     LTYGVNRAPKFVKAYANADQLMLKGLQDYADEVRSMNFPDDEHSFTMKEEELKTLYGG
                     RG"
     misc_feature    495225..495986
                     /gene="panB"
                     /locus_tag="DSY0428"
                     /note="Ketopantoate hydroxymethyltransferase (KPHMT) is
                     the first enzyme in the pantothenate biosynthesis pathway.
                     Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes
                     the first committed step in the biosynthesis of
                     pantothenate (vitamin B5), which is a...; Region:
                     KPHMT-like; cd06557"
                     /db_xref="CDD:119342"
     misc_feature    order(495225..495230,495285..495296,495303..495305,
                     495348..495350,495354..495371,495381..495386,
                     495399..495401,495408..495413,495420..495422,
                     495429..495431,495468..495473,495501..495503,
                     495513..495515,495522..495527,495540..495542,
                     495594..495611,495639..495644,495648..495659,
                     495741..495743,495861..495863,495870..495875,
                     495915..495917,495924..495938)
                     /gene="panB"
                     /locus_tag="DSY0428"
                     /note="oligomerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:119342"
     misc_feature    order(495276..495278,495333..495335,495339..495347,
                     495459..495461,495549..495551,495621..495623,
                     495636..495638,495756..495758,495849..495851,
                     495855..495857)
                     /gene="panB"
                     /locus_tag="DSY0428"
                     /note="active site"
                     /db_xref="CDD:119342"
     misc_feature    order(495342..495344,495459..495461,495549..495551)
                     /gene="panB"
                     /locus_tag="DSY0428"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119342"
     gene            complement(496101..496700)
                     /locus_tag="DSY0429"
                     /db_xref="GeneID:3956025"
     CDS             complement(496101..496700)
                     /locus_tag="DSY0429"
                     /note="similarity to COG1051 ADP-ribose pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516662.1"
                     /db_xref="GI:89893175"
                     /db_xref="GeneID:3956025"
                     /translation="MPLPIVDYKFCPQCGKPLLSVDFSGQHRPHCPDCSFVFWGNFSL
                     GVGGVVWHEGKVLLVQRAHNPGKGNWTIPGGYVEQDEQIAVAITREIREETGIHAKPL
                     SVIALRDRPGEKHDAYIVFLLEYLGGTLQGEPEEVSDLGFFTLEECENLPIAQLSLSV
                     IKASRTLLIPTSPGFLPQTGVKMIGGDQAILYQISKEPE"
     misc_feature    complement(<496599..496670)
                     /locus_tag="DSY0429"
                     /note="RNHCP domain; Region: RNHCP; pfam12647"
                     /db_xref="CDD:257191"
     misc_feature    complement(496242..496571)
                     /locus_tag="DSY0429"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:260427"
     misc_feature    complement(order(496416..496442,496470..496478))
                     /locus_tag="DSY0429"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(496742..497965)
                     /locus_tag="DSY0430"
                     /db_xref="GeneID:3956026"
     CDS             complement(496742..497965)
                     /locus_tag="DSY0430"
                     /note="similarity to COG0477 Permeases of the major
                     facilitator superfamily(Evalue: 1E-76)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516663.1"
                     /db_xref="GI:89893176"
                     /db_xref="GeneID:3956026"
                     /translation="MNTQYLNKFNIPRPILVLIIGGFIHSVGSSFMWPLNSIFMHNIL
                     GRSLTEAGALISLQALATLVGQFISGVLADRFGSRRVMIYGLIGTILPLILISCFPVW
                     EVYAPGLLFYGFAIAFIFVPINALVFTLWPEGGRRGFNLLYVFNNAGVAVGTALGGFI
                     AALSFKLVFLLNGLFFFIYLLMVLIFLSAKDIQSKPLSKSRVKVPIFKDRGFPVLIAL
                     CAAIFLMWGAYIQINTVLPVTMTNLGYSLPQYSILWTLNGVIIVAFQPVIHWIIRHWA
                     PTLSRQFYVSCLFYAIGFLILLGNFPYPSYFIMMIIITLGEMLVLPGVPAAAALIAPE
                     GKTATYQGVVGGAASGGRALGPILGGLAFDHYGGNMAWALALVFVSIALLPFYLYQRR
                     ERTFTQGTGAKEQAI"
     misc_feature    complement(496799..497923)
                     /locus_tag="DSY0430"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(496898..497914)
                     /locus_tag="DSY0430"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(496910..496912,496919..496924,
                     496931..496936,496943..496948,496979..496981,
                     496988..496993,497003..497005,497012..497017,
                     497024..497026,497171..497173,497183..497185,
                     497192..497194,497204..497206,497216..497218,
                     497255..497257,497264..497269,497276..497281,
                     497288..497290,497516..497518,497534..497539,
                     497546..497551,497582..497584,497591..497596,
                     497603..497608,497615..497620,497756..497761,
                     497765..497770,497780..497782,497789..497794,
                     497801..497803,497855..497860,497864..497872,
                     497879..497881))
                     /locus_tag="DSY0430"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            498217..498801
                     /locus_tag="DSY0431"
                     /db_xref="GeneID:3956027"
     CDS             498217..498801
                     /locus_tag="DSY0431"
                     /note="similarity to COG1592 Rubrerythrin(Evalue: 5E-49)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516664.1"
                     /db_xref="GI:89893177"
                     /db_xref="GeneID:3956027"
                     /translation="MDFKDSKTFQNLVNGFAGESQARNRYTFYAGVAKNEGHQAIQNI
                     FISTADNEKEHAKVFYKFLQKYAGDQTEVFRVNADYPLNYRDTLANLKSAAAGEGEEV
                     IDYNTFADIADEEGYADIAVAFRKIATVEAHHQERYARLAAELENGTLYKKDQKISWK
                     CENCGYVHEGSGAPDLCPACQHPQGYFKPLPEVY"
     misc_feature    498226..498780
                     /locus_tag="DSY0431"
                     /note="Rubrerythrin [Energy production and conversion];
                     Region: COG1592"
                     /db_xref="CDD:224508"
     misc_feature    498235..498654
                     /locus_tag="DSY0431"
                     /note="Rubrerythrin, ferritin-like diiron-binding domain;
                     Region: Rubrerythrin; cd01041"
                     /db_xref="CDD:153100"
     misc_feature    order(498271..498273,498280..498282,498292..498294,
                     498370..498372,498379..498381,498505..498510,
                     498517..498519,498607..498609,498616..498618)
                     /locus_tag="DSY0431"
                     /note="binuclear metal center [ion binding]; other site"
                     /db_xref="CDD:153100"
     misc_feature    498691..498780
                     /locus_tag="DSY0431"
                     /note="Rubredoxin, Small Modular nonheme iron binding
                     domain containing a [Fe(SCys)4] center, present in
                     rubrerythrin and nigerythrin and detected either N- or
                     C-terminal to such proteins as flavin reductase,
                     NAD(P)H-nitrite reductase, and...; Region: rubredoxin_SM;
                     cd00729"
                     /db_xref="CDD:238371"
     misc_feature    order(498697..498699,498706..498708,498745..498747,
                     498754..498756)
                     /locus_tag="DSY0431"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238371"
     gene            complement(499104..500423)
                     /locus_tag="DSY0432"
                     /db_xref="GeneID:3955442"
     CDS             complement(499104..500423)
                     /locus_tag="DSY0432"
                     /note="similarity to COG0477 Permeases of the major
                     facilitator superfamily(Evalue: 4E-42)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516665.1"
                     /db_xref="GI:89893178"
                     /db_xref="GeneID:3955442"
                     /translation="MQPYVKSFRYGWSSWSILVIAFITVFFHRLSVGSVADELTREIP
                     MNSVTLGNLTAMNYYAYALMQIPVGILVDRIGVRKINFCGLLVTAAGSILFGLAHTLE
                     AAYLSRFLVGIGSSVIIVSIFKIQATWFPLSRFSALSGLTSFFGNFGSLLALYPLTFL
                     SLTFGWRNVFYWMAGISLLLALLVLWGVRDARTEIYSPPRETAAAGSTGPTGSVSPLS
                     RKHSQTPEHTSTAVKPLPFLAYLKESLSCVLKNPRTWPNVLILFAFTGSSTTLLGLWG
                     IPLMTQLYSLDKATAAGYVTFATFGFILGAPLISLWVRLLKGIRPALLAGTGLNLLLW
                     IYIVIIAGGRPAAELWPAFFFIFGLLIMTHILAFSNVTAVNPLNYSGMATAITNMAEF
                     IGSSLASLTIGLILDFSGNPSAAWWVILSMAALGFMAALLMKEQPAS"
     misc_feature    complement(499122..500381)
                     /locus_tag="DSY0432"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(499128..500366)
                     /locus_tag="DSY0432"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(499239..499241,499248..499253,
                     499260..499265,499272..499277,499308..499310,
                     499317..499322,499332..499334,499341..499346,
                     499353..499355,499506..499508,499518..499520,
                     499527..499529,499539..499541,499551..499553,
                     499593..499595,499602..499607,499614..499619,
                     499626..499628,499974..499976,499992..499997,
                     500004..500009,500043..500045,500052..500057,
                     500064..500069,500076..500081,500217..500222,
                     500226..500231,500241..500243,500250..500255,
                     500262..500264,500313..500318,500322..500330,
                     500337..500339))
                     /locus_tag="DSY0432"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            500549..501013
                     /locus_tag="DSY0433"
                     /db_xref="GeneID:3955443"
     CDS             500549..501013
                     /locus_tag="DSY0433"
                     /note="similarity to COG0589 Universal stress protein UspA
                     and related nucleotide-binding proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516666.1"
                     /db_xref="GI:89893179"
                     /db_xref="GeneID:3955443"
                     /translation="MPGVFKRRGAISMYKKILVPTDGSEFSVRAFKTAVELAGLFQSE
                     IVLIHVTYTPQALWGNTVPYGYVFSQEDVAKNGQMALDATMAEVSAEGVPTKTVLEIG
                     HPVIKIIDQIKKDGIDLVVIGSHGYGPITGSVLGSVSQRVLQKSPVPVLLVK"
     misc_feature    500594..501007
                     /locus_tag="DSY0433"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(500606..500614,500696..500698,500912..500917,
                     500921..500926,500954..500965)
                     /locus_tag="DSY0433"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            501199..501612
                     /locus_tag="DSY0434"
                     /db_xref="GeneID:3955444"
     CDS             501199..501612
                     /locus_tag="DSY0434"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516667.1"
                     /db_xref="GI:89893180"
                     /db_xref="GeneID:3955444"
                     /translation="MKEKEIRLTSEEIDYLLKGTIHWEDIASRTAGPLRKTVDLGTRE
                     AESGDFLKKPSFKDIEQTKVPDRGPFNSEGQGRNFNHNEKGRESFNFKEDTDEDFAED
                     FLAEDQPFWSGTKVYIILSLTGCITLGTWAYFVFA"
     gene            501839..502309
                     /locus_tag="DSY0435"
                     /db_xref="GeneID:3955445"
     CDS             501839..502309
                     /locus_tag="DSY0435"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516668.1"
                     /db_xref="GI:89893181"
                     /db_xref="GeneID:3955445"
                     /translation="MGNLADRIEVYLKRILEQSAEGYVILQRGVLAEEFSCAPSQINY
                     VLDTRFSVERGYLVESRRGGGGYLRIVRLGFHDDGDFQTIMKQLIGSQLGESRAFNLL
                     QRLVEDEIITRREEEIIRTVFHRETLGPESPTINGLRAHMMKRILLTLSREDLH"
     misc_feature    501845..502294
                     /locus_tag="DSY0435"
                     /note="Firmicute transcriptional repressor of class III
                     stress genes (CtsR); Region: CtsR; pfam05848"
                     /db_xref="CDD:253421"
     gene            502293..502823
                     /locus_tag="DSY0436"
                     /db_xref="GeneID:3955446"
     CDS             502293..502823
                     /locus_tag="DSY0436"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516669.1"
                     /db_xref="GI:89893182"
                     /db_xref="GeneID:3955446"
                     /translation="MRICIKQEGITMLCQHCQQREANVQFTKIVNGEMVKLYLCDHCA
                     KNAPEVSFVFSPGIIPDFLQSLFNFTTNAQALKEEACPQCGRRLSEITQAGKLGCSGC
                     YDKFQSELEPILRKIHGGGCHVGKIPARKGADLREKAEIEKLKEKLQQLIRKEEFEAA
                     AVVRDQIRELEQKLGG"
     misc_feature    502326..502820
                     /locus_tag="DSY0436"
                     /note="Modulator of heat shock repressor CtsR, McsA
                     [Signal transduction    mechanisms]; Region: COG3880"
                     /db_xref="CDD:226397"
     misc_feature    502704..502811
                     /locus_tag="DSY0436"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     gene            502795..503880
                     /locus_tag="DSY0437"
                     /db_xref="GeneID:3955447"
     CDS             502795..503880
                     /locus_tag="DSY0437"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:guanido phosphotransferase"
                     /protein_id="YP_516670.1"
                     /db_xref="GI:89893183"
                     /db_xref="GeneID:3955447"
                     /translation="MNSSRSWGDETMERKEHLLKNSEWMRENPDTPVVLSSRIRLARN
                     LEGVPFPLGLSQEASQDIEQKVSAELESLTIDQDKLTYYSMKDLTPIEQYVLIEKHLI
                     SPALVNSRGARGVAINSDHRVSVMVNEEDHLRIQVLLPGDQLKEAYLLSNTMDDQLEE
                     RLDFAYREAQGYLTACPTNVGTGMRASVMVHMPALVMTNRVQQLLGALNHLGLAVRGL
                     YGEGSQAFGHIYQVSNQITLGKSEEDTITHLEAVTRQIIEQEVHAREGLVREAPLVLQ
                     DKVWRARGTLEKARLLNSEDALQCLSLDRLGVDMGILPPRQQSFSTLLVETLPASLQY
                     GLERELSPEQRDEERASYMRKAMAEVK"
     misc_feature    502852..503862
                     /locus_tag="DSY0437"
                     /note="ATP:guanido phosphotransferase; Provisional;
                     Region: PRK01059"
                     /db_xref="CDD:234894"
     misc_feature    502885..503583
                     /locus_tag="DSY0437"
                     /note="Phosphagen (guanidino) kinases found in bacteria;
                     Region: bacterial_phosphagen_kinase; cd07930"
                     /db_xref="CDD:153077"
     misc_feature    order(502900..502902,502906..502908,502912..502914,
                     503092..503094,503170..503172,503194..503196,
                     503347..503349,503353..503361,503440..503442,
                     503446..503448,503452..503457,503485..503487)
                     /locus_tag="DSY0437"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:153077"
     misc_feature    order(503182..503184,503320..503322,503458..503463)
                     /locus_tag="DSY0437"
                     /note="phosphagen binding site; other site"
                     /db_xref="CDD:153077"
     misc_feature    order(503431..503475,503479..503496)
                     /locus_tag="DSY0437"
                     /note="substrate specificity loop; other site"
                     /db_xref="CDD:153077"
     gene            503918..506398
                     /locus_tag="DSY0438"
                     /db_xref="GeneID:3955448"
     CDS             503918..506398
                     /locus_tag="DSY0438"
                     /note="similarity to COG0542 ATPases with chaperone
                     activity, ATP-binding subunit(Evalue: 0)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516671.1"
                     /db_xref="GI:89893184"
                     /db_xref="GeneID:3955448"
                     /translation="MNEKYTEKALKALQFASDEAKRMGSNVIGTEHLLLGLVAEGEGI
                     AAKSLHGIGVTPEKIREQIGNLTGIGQPFTGEVSLTPRVKRVMELAHEEARRHGVSYI
                     GTEHLLLGLLMEGEGVAARVLRNLGVSPERIWKQVVQLLGGQPDDIPMPGGAPGPGTA
                     KNNGAANTPALNEFGRDLTQQAREGRLDPVVGREDEIERVVQVLSRRTKNNPVLIGEP
                     GVGKTAIAEGLAQRIINNKVPETLAGKRVVTLDLSAVVAGSKYRGEFEERLKKVMEEI
                     RVDGRIIVFIDELHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKYIEK
                     DPALERRFQPITVGEPTVEQAVQILLGLRDRYEAHHRTQITDEAVEAAVKMSDRYISD
                     RFLPDKAIDLMDEAASRVRLAAFTAPPDLKSLEEKIEALKSEKEAAVLGQEFEKAAKF
                     RDEEHQLREELAQLRNTWESKRDISQSQVTADDIAQIVASWTGIPVKKLAQEESERLL
                     GLEETLHQRVVGQEDAVKAVSRAVRRARAGLKDPKRPVGSFIFLGPTGVGKTELARAL
                     AEALFGEEDALIRIDMSEYMEKHAVSRLVGAPPGYIGHDEGGQLTEAIRRKPYSVILL
                     DEIEKAHPEVFNILLQVLEDGRLTDTKGRTVDFRNAVIIMTSNVGASFMKKEALGFAS
                     RRDEETEYKNMSSRVMEELKKTFRPEFLNRVDEIVVFHSLQTEGLLKITEILMKQVNG
                     RLQEQGYDLQVEKSALELIAKEGNDPTFGARPLRRAIQRLIEDSLSEKILLGEFKSGD
                     KIKVEAVEDKMKFAKVRARKSKKAEAAE"
     misc_feature    503927..506365
                     /locus_tag="DSY0438"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    503963..504121
                     /locus_tag="DSY0438"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    504488..504946
                     /locus_tag="DSY0438"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    504563..504586
                     /locus_tag="DSY0438"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(504566..504589,504776..504778,504887..504889)
                     /locus_tag="DSY0438"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    504764..504781
                     /locus_tag="DSY0438"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    504938..504940
                     /locus_tag="DSY0438"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    505190..505297
                     /locus_tag="DSY0438"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     misc_feature    505310..>505627
                     /locus_tag="DSY0438"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:266541"
     misc_feature    505472..505951
                     /locus_tag="DSY0438"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    505574..505597
                     /locus_tag="DSY0438"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(505577..505600,505790..505792,505916..505918)
                     /locus_tag="DSY0438"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    505778..505795
                     /locus_tag="DSY0438"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    506081..506323
                     /locus_tag="DSY0438"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            506651..508000
                     /locus_tag="DSY0439"
                     /db_xref="GeneID:3955449"
     CDS             506651..508000
                     /locus_tag="DSY0439"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_516672.1"
                     /db_xref="GI:89893185"
                     /db_xref="GeneID:3955449"
                     /translation="MAKVKTRFFCQSCGQESPRWLGKCPGCGEWNTLVEEVVERAAAK
                     RTPLGVKATPLTEIQIREEERVSSGSQELNRVLGGGIVPGSFVLLGGEPGIGKSTLLL
                     QTAGLLAKGMDVLYISGEESEKQIKLRAERLGIKESRLHILTETRLEVVRDVALAMGP
                     GLLIVDSIQTMVLEELQAAAGSVSQVREGAAFLMRLAKEEEIPIFLVGHVTKEGAIAG
                     PRVLEHIVDTVLYFEGDRHHVYRLLRAVKNRFGSTNEIGVFEMHEDGLVEVPNPSKVF
                     LGENSATAPGSSVAVIVEGSRPLLVEIQALVTPTTYGPPRRTATGIDYNRILMLLAVL
                     DKKVGLHLGAQDVFINIAGGIRIDEPGVDLACIAAIASSLGERPLKRYALIGEVGLTG
                     EVRGISQIENRVKEAVKLGFEGCIIPRINVSAVKVPGNFTVIAVKTVEEAVQVMFEQ"
     misc_feature    506651..507994
                     /locus_tag="DSY0439"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    506672..507769
                     /locus_tag="DSY0439"
                     /note="Sms (bacterial radA) DNA repair protein. This
                     protein is not related to archael radA any more than is to
                     other RecA-like NTPases. Sms has a role in recombination
                     and recombinational repair and is responsible for the
                     stabilization or processing of...; Region: Sms; cd01121"
                     /db_xref="CDD:238541"
     misc_feature    506921..506944
                     /locus_tag="DSY0439"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238541"
     misc_feature    order(506924..506926,506936..506944,506996..506998,
                     507002..507004,507146..507151)
                     /locus_tag="DSY0439"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238541"
     misc_feature    507137..507148
                     /locus_tag="DSY0439"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238541"
     misc_feature    <507656..507913
                     /locus_tag="DSY0439"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            complement(508136..508528)
                     /locus_tag="DSY0440"
                     /db_xref="GeneID:3955450"
     CDS             complement(508136..508528)
                     /locus_tag="DSY0440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516673.1"
                     /db_xref="GI:89893186"
                     /db_xref="GeneID:3955450"
                     /translation="MENLTDRYQILVESLLIRHQSVLDILTKGQEASARVNRAVVKTV
                     TDCGCLSIDARKKPIPEEASFSDLKSLLDSQLDGELCESCKDIIETELGKQLFYIAAL
                     ANTLGISLDDVIQKEETRLSTLTIFNLT"
     misc_feature    complement(508181..>508288)
                     /locus_tag="DSY0440"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain superfamily; Region: NTP-PPase;
                     cl16941"
                     /db_xref="CDD:266492"
     gene            508730..509206
                     /locus_tag="DSY0441"
                     /db_xref="GeneID:3955451"
     CDS             508730..509206
                     /locus_tag="DSY0441"
                     /note="similarity to COG1329 Transcriptional regulators,
                     similar to M. xanthus CarD(Evalue: 9E-34)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516674.1"
                     /db_xref="GI:89893187"
                     /db_xref="GeneID:3955451"
                     /translation="MFDIGDRVVYPMHGAGIIEAIEEREVLGESHQYYVMNIPVGNMK
                     VYIPLKNVNQLGIRGVISSEEVPQVLKILENESTLPALAWNRRYRANMDRIKSGDIYS
                     VAEVVRSLSQRDREKGLSTGEKKMYDNAYQILVSELILAEGVQADEMSERIKGLLA"
     misc_feature    508730..509203
                     /locus_tag="DSY0441"
                     /note="CarD-like/TRCF domain; Region: CarD_CdnL_TRCF;
                     cl00588"
                     /db_xref="CDD:260515"
     gene            509285..510454
                     /locus_tag="DSY0442"
                     /db_xref="GeneID:3955452"
     CDS             509285..510454
                     /locus_tag="DSY0442"
                     /note="similarity to COG1855 ATPases of the PilT
                     family(Evalue: 3E-96)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516675.1"
                     /db_xref="GI:89893188"
                     /db_xref="GeneID:3955452"
                     /translation="MMIRNIVRVIITVLAGAIGFYLNVVLMRLDVLQSLGWQISPIWA
                     FVAMVAIFAILGFLIAPASMRGFLKMISWFDARMTKVPTHDLIGGAVGVIIGLIIASL
                     LSSALRGIPIIGSVISIILSVSLGYLGLIIGVKRKEEVLGFFTFLPKFKGDKGEKGKG
                     KDGNRQSLGAALPNYKILDTSVIIDGRIADIVQTGFLEGTLLIPGFVLEELQHIADSS
                     DLLKRNRGRRGLDILNQISKEELANNVEIMEIDFEDISEVDSKLVRLGQNLGAPILTN
                     DYNLNKVAELQGVKVLNINELANAVKPIVLPGEEMEVQVMKEGKEPGQGVAYLDDGTM
                     IVVDTGRRYMGQTITVLVTSVLQTAAGRMIFAKPKALVEKKSIGLSGTNEVNALG"
     misc_feature    509288..510394
                     /locus_tag="DSY0442"
                     /note="Integral membrane protein (PIN domain superfamily)
                     [General function prediction only]; Region: COG4956"
                     /db_xref="CDD:227292"
     misc_feature    509408..>509674
                     /locus_tag="DSY0442"
                     /note="CobD/Cbib protein; Region: CobD_Cbib; cl00561"
                     /db_xref="CDD:260499"
     misc_feature    509810..510193
                     /locus_tag="DSY0442"
                     /note="PIN domain of Thermus Thermophilus Hb8,
                     uncharacterized Bacillus subtilis YacL, and other
                     bacterial homologs; Region: PIN_YacL; cd09877"
                     /db_xref="CDD:189047"
     misc_feature    order(509819..509821,509912..509914,510059..510061,
                     510113..510115)
                     /locus_tag="DSY0442"
                     /note="putative active site [active]"
                     /db_xref="CDD:189047"
     gene            510495..511175
                     /locus_tag="DSY0443"
                     /db_xref="GeneID:3955453"
     CDS             510495..511175
                     /locus_tag="DSY0443"
                     /note="similarity to COG1211
                     4-diphosphocytidyl-2-methyl-D-erithritol synthase(Evalue:
                     1E-51)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516676.1"
                     /db_xref="GI:89893189"
                     /db_xref="GeneID:3955453"
                     /translation="MGASVNKQFLPLQGRPLLAHTLSLFERSGAVAEIVIVSAKEDRE
                     RIAELVRTEGFQKVSAIVLGGEERQESVFAGVKALSSLIQRVAVHDGARPLLTCLELN
                     RFFTEAEKFGAAIMAVPVKDTIKRVDAQGKVLETPPRETLRAVQTPQVFARSLLEEAH
                     HKAREAGYLTTDDAALIEWLGHPVQTLMGSLENIKITTPEDLDLAEAILAKRMNQVNH
                     GDRSLDSL"
     misc_feature    510495..511109
                     /locus_tag="DSY0443"
                     /note="CDP-ME synthetase is involved in
                     mevalonate-independent isoprenoid production; Region:
                     CDP-ME_synthetase; cd02516"
                     /db_xref="CDD:133009"
     misc_feature    order(510513..510515,510687..510698,510705..510707,
                     510762..510770,511077..511079)
                     /locus_tag="DSY0443"
                     /note="substrate binding site; other site"
                     /db_xref="CDD:133009"
     misc_feature    order(510771..510773,510828..510830,510852..510854,
                     510858..510860,510912..510929,511005..511010,
                     511014..511019,511026..511028,511041..511052,
                     511062..511067)
                     /locus_tag="DSY0443"
                     /note="dimer interface; other site"
                     /db_xref="CDD:133009"
     gene            511265..511741
                     /locus_tag="DSY0444"
                     /db_xref="GeneID:3955454"
     CDS             511265..511741
                     /locus_tag="DSY0444"
                     /note="similarity to COG0245 2C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase(Evalue: 3E-52)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_516677.1"
                     /db_xref="GI: