GenomeNet

Database: RefSeq
Entry: NC_007907
LinkDB: NC_007907
Original site: NC_007907 
LOCUS       NC_007907            5727534 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Desulfitobacterium hafniense Y51 DNA, complete genome.
ACCESSION   NC_007907
VERSION     NC_007907.1  GI:89892746
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000010045.1
KEYWORDS    RefSeq.
SOURCE      Desulfitobacterium hafniense Y51
  ORGANISM  Desulfitobacterium hafniense Y51
            Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae;
            Desulfitobacterium.
REFERENCE   1
  AUTHORS   Nonaka,H., Keresztes,G., Shinoda,Y., Ikenaga,Y., Abe,M., Naito,K.,
            Inatomi,K., Furukawa,K., Inui,M. and Yukawa,H.
  TITLE     Complete genome sequence of the dehalorespiring bacterium
            Desulfitobacterium hafniense Y51 and comparison with
            Dehalococcoides ethenogenes 195
  JOURNAL   J. Bacteriol. 188 (6), 2262-2274 (2006)
   PUBMED   16513756
REFERENCE   2  (bases 1 to 5727534)
  AUTHORS   Nonaka,H., Shinoda,Y., Keresztes,G., Ikenaga,Y., Abe,M., Naito,K.,
            Inatomi,K., Furukawa,K., Inui,M. and Yukawa,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2004) Contact:Masayuki Inui Research Institute of
            Innovative Technology for the Earth (RITE), Microbiology research
            group; 9-2 Kizugawadai Kizu-cho, Soraku-gun, Kyoto 619-0292, Japan
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/09/2014 05:23:45
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 5,365
            CDS                          :: 5,203
            Pseudo Genes                 :: 86
            CRISPR Arrays                :: 5
            rRNAs                        :: 18 ( 5S, 16S, 23S )
            tRNAs                        :: 57
            ncRNA                        :: 1
            Frameshifted Genes           :: 67
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5727534
                     /organism="Desulfitobacterium hafniense Y51"
                     /mol_type="genomic DNA"
                     /strain="Y51"
                     /db_xref="taxon:138119"
     gene            1..1350
                     /locus_tag="DSY_RS00005"
                     /old_locus_tag="DSY0001"
     CDS             1..1350
                     /locus_tag="DSY_RS00005"
                     /old_locus_tag="DSY0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_005815138.1"
                     /db_xref="GI:492341161"
                     /translation="MPPRSLQVLWQETLSKLENELSKPSFETWLSSTYLLDIEGDTLI
                     VSVPNEFAKDWLESRYAPIIRSTVQSILGQSMNLRFLVTSIHETTQPGDNQNKASSNS
                     KAEPADNKTLNSKYTFDTFVIGNSNRFAHAAALAVAESPALAYNPLFIYGGVGLGKTH
                     LMHAIGNAVIQRSPSTRVLYVSSEKFTNELIESIRDQNPIEFRNHYRNVDILLIDDIQ
                     FLAGKEGTQEEFFHTFNALHDANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQP
                     PDLETRIAILRKKAKLENLQVANEVMVYIADKIHSNIRELEGALIRVMAVGSLTSNPI
                     TVETAAEALKDIIPVSTPKEITIEMIQQAVADFYHLSLGEFKAKKRTRAVAFPRQIAM
                     YLSRELTDNSLPRIGDEFGGRDHTTVLHAYDKISESRQNDPLLDRKINEIIQMIQSL"
     gene            1606..2709
                     /locus_tag="DSY_RS00010"
                     /old_locus_tag="DSY0002"
     CDS             1606..2709
                     /locus_tag="DSY_RS00010"
                     /old_locus_tag="DSY0002"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_012615304.1"
                     /db_xref="GI:501669894"
                     /translation="MKIYCSKDSLITGVNTVQKAVSNKNTLPVLQGIMIRAEGQSLIF
                     EATDLEIGIRCVVPAQVEKEGVVVLPSRLFSDLVRKLPDVLIELELQNDVINIHYNES
                     DLSLRGYDPEEFPLLPDLFDAETFNLPVSIFKTMIKQTIFACSAEESRPVFTGCLLQI
                     EDGSLRLIATDTHRLAYRIAEISNPEQIKFQGIIPAKTLGEIYRLLRDEDENLFIRFN
                     QAQIVFQFGAVHLLSRLIEGQFPNYKQVIPQSCQTKVLLSARLFQDSVERASLLARDG
                     SHTSIIKLSVDTERLSIDQTSELGKISEQMEVKKEGNDVKIAFNSKFLLDVLKIIDSE
                     EIVFELSGSYSPGIIRPVDDPNYLYLALPVRTS"
     gene            2724..3821
                     /locus_tag="DSY_RS00015"
                     /old_locus_tag="DSY0003"
     CDS             2724..3821
                     /locus_tag="DSY_RS00015"
                     /old_locus_tag="DSY0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q252K0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="WP_005815135.1"
                     /db_xref="GI:492341158"
                     /translation="MEIKWLHLKSFRNYQDQEVDFRPGLTILQGENGQGKTNILEGIY
                     YLLTGKSYRVHREQELARWGENEFHLYGDFIVQRRKLRLESHYQDKRKIIKINQIPCR
                     KLSEYVGTINVVFFSPDDLVMVKGGPAERRRFLDLHIAQHHSKHIQLLNAYNKVLQQK
                     NALLKQGQGGSKSQIAQIELWNEQILRIGSEIIRNRWEFTGLLSRKGQEIYGQISSGK
                     EELTMDYHALGKNNLEEALAAFPKLLAEKMSLEMERKMVLIGPHRDDILFKLNERSAR
                     LYGSQGQQRSIVLSTKLAELEVIRQEKGDYPLLLLDDVLSELDRFRRDYLLDYTKSLQ
                     QTIMTMTSAETLTQRASLLLKVEKGQIGRIE"
     gene            3825..4082
                     /locus_tag="DSY_RS00020"
                     /old_locus_tag="DSY0004"
     CDS             3825..4082
                     /locus_tag="DSY_RS00020"
                     /old_locus_tag="DSY0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815134.1"
                     /db_xref="GI:492341157"
                     /translation="MFLHLGGDILINQEKIIAILDLETAMRNSTSENFLNKIKEKQKI
                     NYISEKGKEKSLIIASDGNYFSPISSSTLLKRSSSAIIGEE"
     gene            4234..6168
                     /gene="gyrB"
                     /locus_tag="DSY_RS00025"
                     /old_locus_tag="DSY0005"
     CDS             4234..6168
                     /gene="gyrB"
                     /locus_tag="DSY_RS00025"
                     /old_locus_tag="DSY0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849086.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_005815132.1"
                     /db_xref="GI:492341155"
                     /translation="MQEKAEIKETIPTNDYNAGQIEVLEGLEAVRKRPGMYIGSTSLR
                     GLHHLVYEIVDNSIDEALAGYCDTIEVTIHKDNSISVVDNGRGIPVDIHPKLGKPAVE
                     VALTVLHAGGKFSGSAYKVSGGLHGVGMSVVNALSTWLHVEVRKDGNIYHQEFMRGKT
                     KTELAVIGQVDPNQTGTTITFSPDPEIFEDTVFLFDTLAHRLRELSFLNKKVSITLID
                     AREDKKEVYYHTGGIYDFVKYINRSKESLHPEPIYFEAEKDGVQVEVSMQYNDGYVEN
                     LFSYANNIHTHEGGTHESGFKAALTRVANDYARKNNILKANEANLSGEDIREGLTAVI
                     SVKVPEPQFEGQTKTKLGNSEIRSIVDSITGEGLSAFFEENPAIGKKVIEKSIQASRA
                     REAARKARELTRRKSALEVSALPGKLADCSWKEAELCEMYIVEGDSAGGSAKQGRDRR
                     FQAILPLRGKILNVEKARLDRILGNAEIRAMITAMGTGISEDFDIEKARYHKLVIMTD
                     ADVDGAHIRILLLTFFFRYMKPLLENNYVYIAQPPLFKVKKGKDIHYVYSNEELAKLQ
                     DEIGRDRVEIQRYKGLGEMNAEQLWETTMDPAKRTILQVTMEDAIKADELFTILMGDV
                     VEPRREFIQDNAQYVRNLDV"
     gene            6182..8668
                     /locus_tag="DSY_RS00030"
                     /old_locus_tag="DSY0006"
     CDS             6182..8668
                     /locus_tag="DSY_RS00030"
                     /old_locus_tag="DSY0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012615305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="WP_005815130.1"
                     /db_xref="GI:492341153"
                     /translation="MSTEIQGGKILPIEISEELKKSFIDYSMSVIVSRALPDVRDGLK
                     PVHRRIIYTLHELGMTPNKPYSKSARLVGDCMGKFHPHGDSSIYDAVVRLAQDFSTRY
                     PLIDGHGNFGSVDGDSAAAMRYTEARMSKITQYMLADIDKDTVDFQPNYDEREQEPKV
                     MPAKFPNLLVNGSAGIAVGMATNIPPHNLTEVIEGTIAQIDNPEIEIKELMTYIKGPD
                     FPTGASIMGTEGIISAYRTGKGSFRTRAKAHVEEMEKSGKMRIIVTEIPYMVNKARLV
                     EKIAELVREKRIEGITDLRDESDRTGMRIVMELRRDVNPQVLLNQLYKHTQMEESFGV
                     NILALVDGQPKVLNLKQIIHYFIEHQKDVIVRRTRFELNKAEAEAHILEGLRIALDYI
                     DEVISIIRTSADEQSAKDNLMSRFGLSDKQSQAIVDMRLKRLTGLEREKIEEQYQKIQ
                     ETIAYLKAVLNSEQMVLNIIKQELQEVKEKFGDERRTEISFDATHMNIEDLIDDEEVV
                     ITMSHRGYIKRMPLNTYKSQRRGGKGVHGMATREEDFVEKIFTTSTHQYILFFTTRGK
                     VYRLKAHEIPEAGRTGKGTALVNLLSINPSEEKITAVLSIRKYNEDFHLFMATRKGIV
                     KKTLLKEYDSPRKDGLIAISLSGDDELIDVRLTKPDEHIIIATKNGLCIRFLESDVRQ
                     MGRTAHGVKGISLEKEDLVVSMDVIYEEEAEILSMTELGFSKRTSLSEYRVQGRGGKG
                     IIATKLNAKTGKLVGLKVMRPENDMMIITEDGIIIRQEVSGISKQGRSAQGVMAMRTG
                     ESKVVAIAVVDNKEDAEESDLELVEIESEE"
     gene            8783..9349
                     /locus_tag="DSY_RS00035"
                     /old_locus_tag="DSY0007"
     CDS             8783..9349
                     /locus_tag="DSY_RS00035"
                     /old_locus_tag="DSY0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_005815128.1"
                     /db_xref="GI:492341151"
                     /translation="MNERIGVLSLEGTDHDPCRFLRQLGCEVIRVQQREDLIDIQGLI
                     MTGTGNKAKNLGQPGLGDRIKELAKADFPIFGLGAGMVLLSKESPGQGNDRLGLMDLT
                     VTKEPMAGRTEAYLSIPALGLTPLKAIFNEAPYIQEITPNVGILAEYNGKIVFVRQGN
                     MLAGAFHPQQTEDDRIYRYFLDIVNGQI"
     gene            9380..10645
                     /locus_tag="DSY_RS00040"
                     /old_locus_tag="DSY0008"
     CDS             9380..10645
                     /locus_tag="DSY_RS00040"
                     /old_locus_tag="DSY0008"
                     /EC_number="6.1.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q252J5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine--tRNA ligase"
                     /protein_id="WP_011458807.1"
                     /db_xref="GI:499778073"
                     /translation="MLDLKFVRTNPEVVKEALKKRNSNVSLDAFLEQEEERRKLLFEV
                     ESLKAKRNTVSEEVGRRKKHGEDAEQLILEMREVGQKVKNLEDKLGEIEQSMEAVLYE
                     IPNIPHESVPVGADEEANVEVRTWGTPRSFDFEPLAHYEIGEKLDILDFARAGKVTGA
                     RFTFYKGLGAKLERALISFMLDRHSAKGYVEVLPPYMVHRNSMIGTGQLPKFEEDAFK
                     VAGTDYFLIPTAEVPVTNMYREEILEAEQLPIHHCAYSACFRAEAGSAGRDTRGLIRQ
                     HQFNKVELVKFAFPENSYEELESLTRDAESILQELELPYRVMALSTGDLGFTSAKTYD
                     LEVWLPSFNTYREISSCSNFEDFQARRANIRFRRAPKAKPEFLHTLNGSGLAIGRTVS
                     AILENYQEADGRVRVPKALQPYLGVEYIG"
     gene            10747..10835
                     /locus_tag="DSY_RS00045"
                     /old_locus_tag="DSY_tRNA1-Ser"
     tRNA            10747..10835
                     /locus_tag="DSY_RS00045"
                     /old_locus_tag="DSY_tRNA1-Ser"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:10781..10783,aa:Ser,seq:tga)
     gene            11032..11110
                     /locus_tag="DSY_RS00050"
                     /old_locus_tag="DSY_tRNA2-Arg"
     tRNA            11032..11110
                     /locus_tag="DSY_RS00050"
                     /old_locus_tag="DSY_tRNA2-Arg"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11066..11068,aa:Arg,seq:cct)
     gene            11126..11572
                     /locus_tag="DSY_RS00055"
                     /old_locus_tag="DSY0009"
     CDS             11126..11572
                     /locus_tag="DSY_RS00055"
                     /old_locus_tag="DSY0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_005815124.1"
                     /db_xref="GI:492341147"
                     /translation="MNHQDYMRLALEEAEIAFAQGEVPIGAVVVHKGEIIARAHNEKE
                     LRQDPTAHAEVLAVQRATQALGIWRLSEATLYVTLEPCPMCAGSLVQARLKTLVFGAA
                     DLKGGAVGSVTNVLDVNRWNHRVEVVAGILEEECAQILKDFFRKLR"
     gene            11822..11910
                     /locus_tag="DSY_RS00060"
                     /old_locus_tag="DSY_tRNA3-Ser"
     tRNA            11822..11910
                     /locus_tag="DSY_RS00060"
                     /old_locus_tag="DSY_tRNA3-Ser"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11857..11859,aa:Ser,seq:cga)
     gene            complement(12071..13318)
                     /locus_tag="DSY_RS00065"
                     /old_locus_tag="DSY0010"
     CDS             complement(12071..13318)
                     /locus_tag="DSY_RS00065"
                     /old_locus_tag="DSY0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_041272155.1"
                     /db_xref="GI:752602768"
                     /translation="MITGCLQEKNNTYYAVLYIKVDGKRKPKWVSTGLPVAGTSDRKA
                     QKAFDQIRLEYEQEQEEKERREAEERAREQIEGKRNPQADVLFTDYLQKWLTQAKPTI
                     AKTTFKGYQTMLDGRISRYFTELNITLGEVTPQHIQDFHQSIFDEGHTPNTVIHYHAV
                     LRRALQNAVKKEIIDSNPADRVDRPKKNVYHAQFYSAEEMMALFDEISDDPLEICVKL
                     AAYYGLRRSEVLGLKWDAINLEQKTISIKHKVIEDTVDGKSIAVGEDVLKTKSSFRTL
                     PLLPSVEKLLLAEKEKQEMYRKLFKRSYCRDYLDYICLDQAGKLMRPNYVTEHFSWAL
                     EKADLKKIRFHDLRHSCASLLLANGISMKQIQIWLGHSTFSTTADIYSHLDFHAQIES
                     GLVMDGMFERNRVAEPTGLAAAN"
     gene            complement(13467..13685)
                     /locus_tag="DSY_RS00070"
     CDS             complement(13467..13685)
                     /locus_tag="DSY_RS00070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013623266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excisionase"
                     /protein_id="WP_041272156.1"
                     /db_xref="GI:752602769"
                     /translation="MSNKTIMFEKYPDVVEVNQLREMLGGISRKLAYKLLSEKEIHSV
                     RIGRTYKIPKSCVIEYLLSEEMCHIKIG"
     gene            complement(13699..14067)
                     /locus_tag="DSY_RS00075"
                     /old_locus_tag="DSY0011"
     CDS             complement(13699..14067)
                     /locus_tag="DSY_RS00075"
                     /old_locus_tag="DSY0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="growth inhibitor PemK"
                     /protein_id="WP_011458809.1"
                     /db_xref="GI:499778075"
                     /translation="MDTIKQGVSRGDIYYADLNPVVGCEQGGIRPVLILQNDIGNRHS
                     PTIIVCAITGKPKKPLPTHTAIAGAGRLSRESFALLEQIRTIDRSRLRGWIGRLDEQK
                     MEEINQALSISVGLSPALLL"
     gene            complement(14697..15116)
                     /locus_tag="DSY_RS00080"
     CDS             complement(14697..15116)
                     /locus_tag="DSY_RS00080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015944033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_041272157.1"
                     /db_xref="GI:752602770"
                     /translation="MAEKKEYQIKVQGQLVPVSEEIYLTYHRMKRRETYLEERDTTNG
                     VFYYSALDTEGTNGEDVIPDLVSPRVEDLIMDKLIAEKLHQSLSQLVKEEQELIYALF
                     FQNKSEHQLAAETGIPRMTIHNRKNRILARLKKLIEK"
     misc_binding    complement(15544..15633)
                     /note="cyclic di-GMP riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="cyclic di-GMP"
     gene            complement(<15734..16903)
                     /locus_tag="DSY_RS00085"
                     /old_locus_tag="DSY0014"
     CDS             complement(<15734..16903)
                     /locus_tag="DSY_RS00085"
                     /old_locus_tag="DSY0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458812.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_041272797.1"
                     /db_xref="GI:752603410"
                     /translation="MQQWKKKTLIFLISQGITLFGSSVVQFAIVWDVTLKTSSGAWVS
                     AFTICSFLPQFLISFFSGVWADRYSRKFLIILSDTVIAATTLTLVLLMPFIGNGTSLY
                     TALLIASVIRSLGAGIQTPAVNSMIPQLVPDEHLMRLNGINATLQSVVQFAAPAAAGA
                     ILTFSTLRSTLFIDITTAIIGVVLLACIAIPKQVANEKTEAPSVFAEMKQGMKYTFAN
                     RFIGKLLITYGLFIFLAVPAGFLAALFVSRIYGDNYFYLTATELVGFAGMTAGGILIS
                     TWGGFSNRVKTLLVGMVVFGTLAIGMGAIRNFVVYLVLMAVYGIALTMVQTAVTTLIQ
                     EKTDDHMQGRIFGFLSAMYSGCLPLGMAVFGPLSDVVSIRILMIVTGGVLVILAGV"
     gene            complement(17246..17746)
                     /locus_tag="DSY_RS00090"
                     /old_locus_tag="DSY0015"
     CDS             complement(17246..17746)
                     /locus_tag="DSY_RS00090"
                     /old_locus_tag="DSY0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_041272158.1"
                     /db_xref="GI:752602771"
                     /translation="MMKRWISLLVENEIGVLARVSSLFSGKSYNLDSLTVGATEDNSI
                     SRMTISLTSDDQTFEQIKKQLNRSVEVIKVVDFTDVAIHMKELMFIKISDCTQQEMIQ
                     LTHIISVFALKMIDYDADTAIIECVQTEDRNNNLIRLFEKTFPNRFSIVRGGGVAIEA
                     INLSNG"
     gene            complement(17743..19485)
                     /locus_tag="DSY_RS00095"
                     /old_locus_tag="DSY0016"
     CDS             complement(17743..19485)
                     /locus_tag="DSY_RS00095"
                     /old_locus_tag="DSY0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_011458814.1"
                     /db_xref="GI:499778080"
                     /translation="MRISGADLLVKALKEENVDTLFAYPGGQAIDLFNALYGVENINV
                     VLPRHEQGLIHAADGYARSTGKVGVCLVTSGPGATNLVTGIATANYDSVPLVCFTGQV
                     PTHLIGNDAFQEVDIVGITRSICKYAVTVRKREDLGTTIKKAFYIARSGKPGVVVVDL
                     PKDIQQQLGSALYPDNIELRGYKPNTTVHIGQINKALDCISHSKKPVFLIGGGVNISH
                     ANNEMTLLAEKTGIPVVTTIMGKGAIPTNHPLYVGNLGIHGSYAANSAISECDVLFSI
                     GVRFNDRITGKIGEFAKHATIIHIDIDPASISRNIVVDIPIVADAKNAISRLLEKAVC
                     LHTEEWIKQICNWKQLHPLNIPLQDANQVTPQAIIQEINTLFEHAVITTDVGQNQLWA
                     SQFIELTDNKVFLTSGGLGTMGYGFPAAIGAKLGNPDKDVIAICGDGGIQMNIQEIAT
                     AVVYELPVIICIMNNGYLGNVRQWQEMFYSKRYSKTCLLWRKGCSTICNTPDAVCPEY
                     TPDFIRLAESYGAQGIRVKKTEEIKSALLKAKNTDKVPTIIEFLIGREENVYPIIPPG
                     NSLNDMVMGGENIR"
     gene            complement(19630..20211)
                     /locus_tag="DSY_RS00100"
                     /old_locus_tag="DSY0017"
     CDS             complement(19630..20211)
                     /locus_tag="DSY_RS00100"
                     /old_locus_tag="DSY0017"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458815.1"
                     /db_xref="GI:499778081"
                     /translation="MKKILVFLTATLCLTFAACTPIQIEQVEKNALSDNEQYRLAVHI
                     TDHDSAVIHLTDTLLKDEYEVNRSGSPEMQDEYGWYVQIGIYRAMLHYVKDSLEGEAK
                     KIGVKDMQLELYKCEYNQKGELFHMVELPSESISLKLEGNNLVFSIEIPNEYYFDLRS
                     QADIIELQTMDCTRELPYQALTVNAGDVVTKDS"
     gene            complement(20287..21129)
                     /locus_tag="DSY_RS00105"
                     /old_locus_tag="DSY0018"
     CDS             complement(20287..21129)
                     /locus_tag="DSY_RS00105"
                     /old_locus_tag="DSY0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011458816.1"
                     /db_xref="GI:499778082"
                     /translation="MRKLEAALAAIAYIEEHLSDEKVDLDTVSEAVHYSKYHLHRIFS
                     NTVQLTIHEYAQRRQLTEAAKLLVFSEKPILDIALLAGYDSQQAFSNVFKAMYKQSPL
                     EFRKGEVFYPLQLEYDFKDQSGIIGVCEANPKKEIRYATDIDIPTWMDLARLCVDGFP
                     YLDEDEHIVALKRYIEKDGALLMLEGSAVIGSMLINYETGSIDFLAVHPLYRKRGVAG
                     EFLDTALSELIENKEISITTFREGDKADTGYRKALKELGFAEAELLTEFGYPTQRMVL
                     ARDG"
     gene            complement(21269..21814)
                     /locus_tag="DSY_RS00110"
     CDS             complement(21269..21814)
                     /locus_tag="DSY_RS00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272159.1"
                     /db_xref="GI:752602772"
                     /translation="MRNMTHYKKPAFWVCVAAVVCLIVLAIVPVRNSQSDGQELLDSN
                     YQVVEILYDAPYYSFVQTKETAPIYSISDDYSLYEKETAPDSAWSIKGDLYAVDYSKE
                     KLDSFFDPLYNEADKWLNSISTIYRADTDNDNQRFYLVMQTRSGEVLIAVGYDMPEHK
                     HIRWLYRMTQNSGATASSTNT"
     gene            complement(21818..22399)
                     /locus_tag="DSY_RS00115"
                     /old_locus_tag="DSY0020"
     CDS             complement(21818..22399)
                     /locus_tag="DSY_RS00115"
                     /old_locus_tag="DSY0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014521120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458818.1"
                     /db_xref="GI:499778084"
                     /translation="MKVCIIMGSPRIKGNTAELLKPFISTLESNGCAVTYISLSDKNI
                     QPCKGCYACQQIDGRYGCVQEDDVGVIMETVIESDCVVLATPIYTWYCTAPMKALLDR
                     HYGLNKFYGKATGSLWAGKMIAIIATHGYDVKYGAEPFEMGIRRLCEHSDLKYMGMYS
                     VRDEEDIASFQTEEAIAGAKAFACSLCHYEIAR"
     gene            complement(22459..22914)
                     /locus_tag="DSY_RS00120"
                     /old_locus_tag="DSY0021"
     CDS             complement(22459..22914)
                     /locus_tag="DSY_RS00120"
                     /old_locus_tag="DSY0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011458819.1"
                     /db_xref="GI:499778085"
                     /translation="MNVHKIIRAEQADLPAILELQYLAYQSEAILLGNYSIPPLKQTL
                     QELETEYKNGVILKAVHENGDIVGSVRGYTCSGTFYIGKLIVHPAVQGRGIGTQLLNE
                     IESLYPQLRYELFTSSMSNKNLKLYERQGYSRFKEKQVANGLTFIYLEK"
     gene            complement(22984..23565)
                     /locus_tag="DSY_RS00125"
                     /old_locus_tag="DSY0022"
     CDS             complement(22984..23565)
                     /locus_tag="DSY_RS00125"
                     /old_locus_tag="DSY0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011458820.1"
                     /db_xref="GI:499778086"
                     /translation="MIKGDKINLIPATLDDRRKIYEWCFQSETTKCHSGPPDYPNNPI
                     PTYEEFCSSDDGGYTEYYFTGVKPKDGRGFLIVNGKEAVGFISYYSFHLKSGISELDM
                     WIKDEANCGKGFGTDALVSLGNYLNEEMGIRELIIAPSERNTRAVRAYGKAGFVKTDK
                     AMSEFLADEYISVFGEGDYGTGDTAILVKRFNA"
     gene            complement(23631..24596)
                     /locus_tag="DSY_RS00130"
                     /old_locus_tag="DSY0023"
     CDS             complement(23631..24596)
                     /locus_tag="DSY_RS00130"
                     /old_locus_tag="DSY0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011458821.1"
                     /db_xref="GI:499778087"
                     /translation="MKKQNNFTSEYIKINGTLQYLLHYCTDPALPVLLFLHGGPGMAE
                     STFAYAFQEGMSQLFTVVHWDQRGAGKTLTKNKKNVGYPTVDELLVDTLEVVRYLKKK
                     YGKDKIVILGHSWGSMLGTLFVQKYPQEVLYYIGTGQFVDVVENERAGYDKLRELITE
                     AGNLKNLAQLEKIGDYPESNYEKPMIKKIQSIRILQGKYKIGMNFGPILKALLKSPVF
                     RLSDLSSLVKGMSNNKELWNYMFSSNLYSESRVYQMPVFYILGADDFQAPHTIATRYF
                     DTIEAPLKKLFIMNGAAHFMMLDQPKGFAQILSEIRRIEHTNGHI"
     gene            complement(24659..>24961)
                     /locus_tag="DSY_RS00135"
     CDS             complement(24659..>24961)
                     /locus_tag="DSY_RS00135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018756900.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272798.1"
                     /db_xref="GI:752603411"
                     /translation="SDLRIAEDNFVPTLFHQEIDIAEAYTEQLIYEEKNSERNHTNLY
                     IIEEYSGTDEKMKGFSRTYHFSLTNGKEWKYEGFSGAANLAGEGYFRDYLSLKQED"
     gene            complement(25255..25878)
                     /locus_tag="DSY_RS00140"
                     /old_locus_tag="DSY0025"
     CDS             complement(25255..25878)
                     /locus_tag="DSY_RS00140"
                     /old_locus_tag="DSY0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013381274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458823.1"
                     /db_xref="GI:499778089"
                     /translation="MRLSQQNENLADYLEETYLVNYNTATLQQKAAQLFAHSITDIDK
                     INTAYEFVRDSIRHSADINGHRITKTATEVLLYGEGMCYSKTILFTALLRSQGIHIGF
                     CYQRLTRDDQGNTEYDIHALNAVYIADKKAWVRIDPRGNTNGRNAQFYPGDPLREQLA
                     YTVRPDVGEIDYPGVYTRHPDRVLYPLLRCKDCLEMMAYHLPDRLEE"
     gene            complement(<26289..26465)
                     /locus_tag="DSY_RS00145"
     CDS             complement(<26289..26465)
                     /locus_tag="DSY_RS00145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006355995.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_041272799.1"
                     /db_xref="GI:752603412"
                     /translation="MPPKQKISKDTLLAHAFSIAEESGINSVTSRSVAKKAGCSIQPV
                     FSHFPTMEDLRQATF"
     gene            complement(27044..27310)
                     /locus_tag="DSY_RS00150"
                     /old_locus_tag="DSY0027"
     CDS             complement(27044..27310)
                     /locus_tag="DSY_RS00150"
                     /old_locus_tag="DSY0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041272160.1"
                     /db_xref="GI:752602773"
                     /translation="MSYFNHIYTALPDELPHRARTVYIYLRDRAGKDSDCWPAVKTIA
                     ADLQLSRSTVKRALHDLVRAGLIEKETRYRENGSNTSNRLILKK"
     gene            complement(27325..29148)
                     /locus_tag="DSY_RS00155"
                     /old_locus_tag="DSY0028"
     CDS             complement(27325..29148)
                     /locus_tag="DSY_RS00155"
                     /old_locus_tag="DSY0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_011458826.1"
                     /db_xref="GI:499778092"
                     /translation="MPSQVYILIAAAAVMFFVIGGLSLLAHYYTLNGIKSRTVGDGQH
                     GTARFASKQEIKNTYQHIPFQPELWRQGQCLPTAAEQGIILGCVGAKNKVTAMVDSDD
                     VHCLMIGASGIGKTAYFLYPNLEYACASGMSFLTTDTKGDLYRNYGAIARDYYGYHVA
                     VIDLRNPTRSDGNNMLHLVNAYMDRYLADENNLVAKAKAEKYAKIIAKTIINASGENY
                     GQNQFFYDAAEGLLSSVILLVAEYLPPTKADGKKVDCRHIISVFKLVQDLLAPSKVKG
                     KSQFQLLMEKLPPDHKARWFAGAALNSAEQAMASVLSTVLSRLNAFLDSEMEQILCFD
                     TAIDAEKFCNKKSALFIVLSEEDLTKYFMVSLMIQQLYREILAVADENGGKLKNRVMF
                     YCDELGTLPAIQSLELIFSASRSRRLSIIPIIQSFGQLEKNYGKEGSEIIVDNCQDTI
                     FGGFAPNSQTAEVLSKALGSRTVMSGSISRGKNDPSQSLQMMERPLMTPDELKSIPKG
                     NFVVMKTGTHPMRTKLRLFLDWGIRFEKPYTVAEKAHRKVAYADKLLLEESIVRKHSA
                     YLMVDEETGEVLEPFEGTGALHTPVAEPAENAVKRRSHLKT"
     gene            complement(29216..30634)
                     /locus_tag="DSY_RS00160"
                     /old_locus_tag="DSY0029"
     CDS             complement(29216..30634)
                     /locus_tag="DSY_RS00160"
                     /old_locus_tag="DSY0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272161.1"
                     /db_xref="GI:752602774"
                     /translation="MGVYVHFSDDQKYRANNVDLVDFLQRRGEKLIPSGRDKRLASDR
                     SITVRGNEWYDHSAESGGYAIDFVRQFYGLSFPEAVTILLGGEQGEVYRPASQKKQEP
                     KQPFALPNPHSDMRRVYAYLTKTRLIDREVVSYFARAKLLYESCEKSKDGMKEYHNAV
                     FVGYDENGVPHHAHKRGLYTEGTGFKGNVDSCDPAYSFHHIGTSNRLFVFEAPIDLLS
                     YITLHPKDWQNHSYVALCGVSEYAMLKMLELHPNLNHVVLCLDHDEAGIEASEKYHDL
                     LLEKGVSCDRDLSVHKDWNEDIKANHGLPAIPAEEHPQHLIRDEICRELTETAMTVKS
                     NCSANTLSALLMKALSYLHWGQFSEADECLREICRLSVAAAAREYRQMDHSRDISAVQ
                     SRLHSGFRTYENRGHLKTRLDLLESDIMALRGFERVVAADEKEKLAECYEHIAAHGLK
                     GVILLEKHRQKMEQTQEMKLSM"
     gene            complement(30781..33660)
                     /locus_tag="DSY_RS00165"
                     /old_locus_tag="DSY0030"
     CDS             complement(30781..33660)
                     /locus_tag="DSY_RS00165"
                     /old_locus_tag="DSY0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458828.1"
                     /db_xref="GI:499778094"
                     /translation="MARIIVKNGYLKGGSEKTSAHLNNLVKYIATRDGVEKIKNGREL
                     WHATKKQQTLIGEILREFPDAKEMFEYEDYLANPNRENASEFITIALEQHLDKIGDRE
                     KYLDYIANRPRVEKFESHGLFTAGDAPLVLSQVAEEVAAHTGNVWTPIISLRREDAAR
                     LDYDNAAAWKALLSSKAMELAENLKIHPDHLKWYGAFHNESHHPHIHMVCYSTDPREG
                     YLTKQGIRKMKSSLANEIFRQELIPLYGEKTQRRDELKEQSAESLRELIRQIKGGVLV
                     SERMEQLLTHLAERLQTVSGKKQYGYLKPELKNVVDEIVDDLAQDSRVSEAYRMWWET
                     KGRIESIYTETPSEPPPLSHCDDFKPIRNMVIQEALLIGNMTFEEPASVETALPEPEN
                     DLEMSLSDIEDEEDQEPIDDSVGRPSSDEASAGKESSDSWWTEEYRQAKQYLCGDEDA
                     GVPQDFRKAHELFMAEADKNNPLALYDLGRMSADGLGCEADADAAYGWYEKALVVLHA
                     AEEAKPWKYTEYRIGKMYAAGLGAEQDYLQASDWLTLSADKKYKYAQYSLGGLYYHGK
                     GVEQDHVTAFALYTRSADQSFPYASFELGKMLRDGIGCAKNQQDSDRRFKEAFLGFVS
                     LEEQSHDDKLQYRLGWMLLNGIGTDKDEARAKEYFEKAASVGNPFACYQLAKFILSDE
                     KAQPQDVEKALGYLRKAVEAENPYAAYFLGKLYEKGQHVPQNTAEAMRLYTLSAEQDN
                     EFAAYRLGKLYLDGDGVLKDVESAIRWLTFAADRKNQFAEYALGVLYFKGEDIPKDVP
                     KALEYLKRSAGQGNQFAQYRLGKIYLMGEDVPKDIQTALQFLTAAAEQGNQYAQYTLG
                     KLYLIGKDVPKDKETAVRWFTLSAAQGNIYAQFFLDHIDNFKDPSVLLAGTRLLHHMS
                     RIFADNAPPLKLPGQRTDRKLLRKLREKKQAQGHARDDHEQTMSL"
     gene            complement(33660..34073)
                     /locus_tag="DSY_RS00170"
     CDS             complement(33660..34073)
                     /locus_tag="DSY_RS00170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020072860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272162.1"
                     /db_xref="GI:752602775"
                     /translation="MKNNKERTAVWLYPETMERLDGWLIQDNCKSRSEFIEKALCFYM
                     GYLGTEDTSSYLSKALLSSMEGTLQKTENRVAGNLFRLSVEISMMMHLLATTLDISDE
                     ELHRLRGRCVAEVKKTKGKIRLDDAVEFQSRADDE"
     gene            complement(34450..>34848)
                     /locus_tag="DSY_RS00175"
     CDS             complement(34450..>34848)
                     /locus_tag="DSY_RS00175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009261428.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272800.1"
                     /db_xref="GI:752603413"
                     /translation="QLTTAARLEEKDLSFSDEIMEMDGRLNFYINTDFDVDAVFGTNV
                     QTTGNNDWLNVYANFDMESRQVCDTLDIELHRGDGGEETRSYPMNDAEKAMLYAKMDA
                     YCRQENGISLPEYCNALMQEQSLTQTPSMG"
     gene            complement(34881..35144)
                     /locus_tag="DSY_RS00180"
     CDS             complement(34881..35144)
                     /locus_tag="DSY_RS00180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018213969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272163.1"
                     /db_xref="GI:752602776"
                     /translation="MKKESITIQMDGEKLRAVKRYMGKKDADLTQELCDSLQKLYEKY
                     VPATVREYIDEGADDEASTTASPKKQREKSTAAAANEPREVSQ"
     gene            complement(35159..35525)
                     /locus_tag="DSY_RS00185"
                     /old_locus_tag="DSY0033"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(35549..37057)
                     /locus_tag="DSY_RS00190"
                     /old_locus_tag="DSY0034"
     CDS             complement(35549..37057)
                     /locus_tag="DSY_RS00190"
                     /old_locus_tag="DSY0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_011458832.1"
                     /db_xref="GI:499778098"
                     /translation="MADPATIAAIAKAAVTALSDERTRKTIGWIIAAILSPLILVIVL
                     VCSLLSGTTNHNNTAVELCFHGGVIPGSMPADYREYIGDMRQSFTLIDNAIADVNAEI
                     EGGDSLDDYRVKAIFYSLFFGAESPSRLEHREYVDCFVTYEERTRTVENENGTTSEET
                     YTVAVPIDSLPTVYNNIRTLFDRAITYEDQANANEIYYRARYGTGAPMEGDGAESWED
                     WTPDQIDGFYSDLPVGEAGAEAVRLGLSRLGDPYSQELRGQGDYTDCSYLVQWVYKKL
                     GVNLPGTAAAQGKYCVDNGLTIPKSSLAPGDLVFWSHEPNGRFMNITHVGIYAGDGKV
                     VDASSSRGEVVYRDLFDSGKQVLYARPYAEAPEASASGFVSPLGKSWRSMVTSEFGGR
                     TDPITGQQAGHSGIDLGASKGTSIRSAKAGTVKTVVYGSTGYGYYLTIDHGGGLVTLY
                     GHCSVILVREGQTVKSGETVAKVGSTGRSTGNHLHFEVRVNGAKQNPRNYLP"
     gene            complement(37062..37565)
                     /locus_tag="DSY_RS00195"
                     /old_locus_tag="DSY0035"
     CDS             complement(37062..37565)
                     /locus_tag="DSY_RS00195"
                     /old_locus_tag="DSY0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl cyclotransferase"
                     /protein_id="WP_011458833.1"
                     /db_xref="GI:499778099"
                     /translation="MKNKLYIAYGSNLNLPQMAHRCPSAKVVGASEIKDYALLFRGGR
                     SGAVATVEPCEGSSVPVLLWNITPRDEQALDVYEGYPSFYEKQSMELPLDDRTVSAMV
                     YVMTPGHRLGYPSDYYYNTIREGYETAGFDTAVLEQAVDYTEQLMESEPEPEQQSLFG
                     FGGLKWW"
     gene            complement(37578..38615)
                     /locus_tag="DSY_RS00200"
                     /old_locus_tag="DSY0036"
     CDS             complement(37578..38615)
                     /locus_tag="DSY_RS00200"
                     /old_locus_tag="DSY0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458834.1"
                     /db_xref="GI:499778100"
                     /translation="MELQAQDFGIEIEMTGLTRSRAAEVIAEYFGTTKEYEGSFYDAY
                     FARDTSGRKWKVMSDGSLDCQRKEGRRKVSADRNYSVEVVSPICQYGDIETVQELIRK
                     LREAGAFVNSSCGIHIHINAAPFDAPHLRNLVNIMAAKEDMIYKALKVSRGRESHYCQ
                     KIDPAFLERLNRQKPATLDRLKSLWYNGGDGSREHYHHSRYHCLNLHSVFQKGTVEFR
                     AFNGDLHAGKIKAYIQFCLAITAQALNQRSASPTKTQSSNEKYTFRVWLLRLGMIGDE
                     FKTARGHLLDHLEGCIAWKDPEQAQRQKERLREKREAERQQTQAPPEEAVPETEMEAV
                     DEQSPAFTMSM"
     gene            complement(38628..39107)
                     /locus_tag="DSY_RS00205"
                     /old_locus_tag="DSY0037"
     CDS             complement(38628..39107)
                     /locus_tag="DSY_RS00205"
                     /old_locus_tag="DSY0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458835.1"
                     /db_xref="GI:499778101"
                     /translation="MNRLQQQKENKAGLLEDMLSFIRYTPNREADLLAFMEKYQKADC
                     DERPAVLEKLRCCMDGKEYPNPYAESYHYTPEDVSLMGQILDDYIDDLLLAQGDPAAV
                     SECVRDTVLKINALNEECGRYLIDTWRRERLCGFINSAAELAGLSQEKDLTLQHRMW"
     gene            complement(39128..40957)
                     /locus_tag="DSY_RS00210"
                     /old_locus_tag="DSY0038"
     CDS             complement(39128..40957)
                     /locus_tag="DSY_RS00210"
                     /old_locus_tag="DSY0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_041272164.1"
                     /db_xref="GI:752602777"
                     /translation="MARKRTLPSPPQEDVKIKDFLDMIAPGIIKFNTDHFLCGNTYRC
                     VWVLREYPTATEEQAILRHLGEKDGVTLRIYTCQVTAAEEKKIIHNAANKNRMDKSST
                     NDLQQTVTAESNLQDVVTLVSSMHRNREPLLHCAVFLELTAHDSDGLKLLQTDVLTEL
                     VRSKLNVDRLILRQREGFLSVGPASRNVFGSQFERVLPASSVANLYPFNYSGKTDPRG
                     FYLGRDKFGSNIIADFDKRDDDKTNANVLILGNSGQGKSYLLKLILCNILESGKSVLC
                     LDPEHEYVELAENLGGCFIDLMSGRYRINPLEPKTWDEGGSPEDTDAPQAFRQSTKLS
                     QHISFLKDFFRCYKDFSDRHIDVIEIMLGKLYEQFGISDRTDFRKLAATDYPILSDLY
                     ALIEAEYKGYDKTKYQLYPPELLQEILLGLHSMCMGAESQFFNGHTNVTSDRFIVFGV
                     KGLLQASRNVKNALLFNVLSFMSDKLLTEGNTASSIDELYLFLTNLTAIEYIRNFMKR
                     VRKKESAVILASQNLEDFNIEHIRELTKPLFSIPTHAFLFNAGNIDKRFYIDSLQLEE
                     SEYNLIRFPQRGVCLYKCGIERYNLAVHAPAYKEKLFGTAGGR"
     gene            41124..41594
                     /locus_tag="DSY_RS00215"
                     /old_locus_tag="DSY0039"
     CDS             41124..41594
                     /locus_tag="DSY_RS00215"
                     /old_locus_tag="DSY0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272801.1"
                     /db_xref="GI:752603414"
                     /translation="MLSLRPIKKEDFSVIEEWLNKDYIKKWYGEPEEWLSEIRNDSGD
                     FGWLNHYIVLYQDMPIGFCQYYDCSKTPPGFEWDSEPKGTFCIDYLIGQEFFLKKGLG
                     SVIVQQLCSLIFKQENPVQIIADPVPENIDSIKLLERNGFTLDPTSGLYKMKIK"
     gene            41802..42299
                     /locus_tag="DSY_RS00220"
                     /old_locus_tag="DSY0041"
     CDS             41802..42299
                     /locus_tag="DSY_RS00220"
                     /old_locus_tag="DSY0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458839.1"
                     /db_xref="GI:499778105"
                     /translation="MKNLYLIGGTMGVGKTATCQILKQKLNNSAFLDGDWCWDMHPFQ
                     VTEETKRMVIQNICFLLNNFIRCSAYENIIFCWVMHQQAIIDDILSQLDTVNCTVHSI
                     SLICSEQALRTRLEKDVASGIRAEDVVKRSIERIPLYEKLNTCKVDVSDITPEQATEL
                     ILQHC"
     gene            complement(42350..42937)
                     /locus_tag="DSY_RS00225"
                     /old_locus_tag="DSY0042"
     CDS             complement(42350..42937)
                     /locus_tag="DSY_RS00225"
                     /old_locus_tag="DSY0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272165.1"
                     /db_xref="GI:752602778"
                     /translation="MNRKKKQEAREKASTRQLMGIEGITSHSLATPHGELVFFMIKPT
                     NISVLSDASIGARIYALMNVLKGISDIEMLCLNSRENFEDNKSYLKARMDAEQNPVIR
                     KLLAQDQTALDRMQVQMATAREFLIIIRLKNEKESDVQPYLSRIEKSLKDQGFTVRKA
                     GESDIKRLLGVYYEQNVTTEVYEDYDGERWVILNE"
     gene            complement(42940..43197)
                     /locus_tag="DSY_RS00230"
                     /old_locus_tag="DSY0043"
     CDS             complement(42940..43197)
                     /locus_tag="DSY_RS00230"
                     /old_locus_tag="DSY0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458841.1"
                     /db_xref="GI:499778107"
                     /translation="MYLYPDNLRSKATLWLWELRDIGIIGVGLLISVFALSRLGWLPP
                     IVLTAVYAFLSIRFEDVSILDFIRYAAAFFFGKQQTYEWRA"
     gene            complement(43201..45369)
                     /locus_tag="DSY_RS00235"
                     /old_locus_tag="DSY0044"
     CDS             complement(43201..45369)
                     /locus_tag="DSY_RS00235"
                     /old_locus_tag="DSY0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_041272166.1"
                     /db_xref="GI:752602779"
                     /translation="MMTMGSLFDGIGGFPLAAVRNGIAPVWASEIEAFPIEVTKIRFP
                     EMLHVGDITKLNGAKLPPVDVICGGSPCQDLSVAGQRAGLAGARSGLFMEQTRITKEM
                     RKADEQRNVPAHLVRPRYLVWENVPGAFSSADGEDFRAVIEEIIRIKYSACDVPRPES
                     GRWESAGAALLGDEFSLAWRVMDAQFWGVAQRRRRIFLVADFGGTTAPEILFKQDGLF
                     GDTPESGGPRQGTAAPAEGSADAAGGACLTPWDVQSRRIFEETGTWPALYSGEGGGHG
                     YIQTEEKTAIAFAANQRDEVRDLHDVAGAIQAQPGMKQQTFVAQPLICLNDQGGNRMD
                     ITEEVTSTLRAGMGGHPPLVSQPNCLNGWDTQQSRVFTPEGMAPTLAGADGGGGRNPA
                     GLLFAAGVVSKGDGDCFLMPEVHTAITGGGGQAGQGYPCVLTAGFCGNASAEARGIGY
                     QAECSPTIKTGTAPSVLCLNDQGGSQMHCTEDITGTLRAQEHGHQPLVFENHGIDSRY
                     SGPHAVAPTMSARMGTGGNNVPLVGTPVAFSLDSKESNSMKSANPYSGCRETDVARTI
                     DTGSPDPSKNQGGIAILQETICIAGNTIDREPENGGNGLGCQPDISYTITTSDRHAVC
                     EPYQEVVGALCRGDEKGIGSQYVSQNKCIVERRNLIRRLTPLECERLQGFPDGWTLIP
                     GASDSARYKALGNSVAIPCVDFVLRGIAYFLQKIYEEQEE"
     gene            complement(45369..45752)
                     /locus_tag="DSY_RS00240"
     CDS             complement(45369..45752)
                     /locus_tag="DSY_RS00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018213984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272167.1"
                     /db_xref="GI:752602780"
                     /translation="MKLIYVASPYAGDIERNTKFAKRACRHVMSEGHAFFVPHLLYPQ
                     LLDDSNPQERQLGLDMGLAMLPRCDELWCYGDRISYGMRLEIEEAGRLGIPVRRVMEQ
                     ENGFAIGRAKDTAPAEAPQQAMRMA"
     gene            complement(45771..46676)
                     /locus_tag="DSY_RS00245"
                     /old_locus_tag="DSY0045"
     CDS             complement(45771..46676)
                     /locus_tag="DSY_RS00245"
                     /old_locus_tag="DSY0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013623299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272168.1"
                     /db_xref="GI:752602781"
                     /translation="MFIWDFVLGTVMDQIIEWLYGQVVGFLADFFAQMGNMGVELFEM
                     SWVQSIVLFFSYLAWALYGTGLVVSAFETGIEYQHGRGSVKDTALNAIKGFMAVSLFT
                     IVPVELFKLSVNLQSSLTAGITGYGSSFGDLAGNIISELGSSSDIGGAMGSGVFGGLS
                     VITSPILLLFMIIMMGYAVIKVFFANLKRGGILLIQIAVGSLYMFSVPRGYIDGFTQW
                     CKQIIGLCLTTFLQATILAAGLMVLRTHALLGLGLMLSAGEVPRIAGAFGLDTSTKAN
                     LMSAVYTAQAAVNTTKTVVQAVAPK"
     gene            47293..48165
                     /locus_tag="DSY_RS00250"
                     /old_locus_tag="DSY0046"
     CDS             47293..48165
                     /locus_tag="DSY_RS00250"
                     /old_locus_tag="DSY0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458844.1"
                     /db_xref="GI:499778110"
                     /translation="MDTALTLRVACEEGKCLENDQISSLLSQSALVRKLTTDFVDHPL
                     FAVFRIMGLSEIPYMERLPYTQKMVDYINRNIATAQGFSCLGGMEEIVPCYNAMLLEA
                     YCRLGLADSKEAQAALSWIEQYQLFERNQTTSWPHKGVCKHGGCLGKTPCYIGISKTV
                     RALTTYSEFVKHENWNVEKLLVQGTGYMLRHKMFQRLSDGKPISAHITDIMFPQSYAL
                     SLTDLTYIVGKRQLMTSEDSSELLHLLQEKQIAENQWKIDYLYSYKGYVGFESKRKAS
                     EWVSALFPIWLSKS"
     gene            48464..49285
                     /locus_tag="DSY_RS00255"
                     /old_locus_tag="DSY0047"
     CDS             48464..49285
                     /locus_tag="DSY_RS00255"
                     /old_locus_tag="DSY0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_041272169.1"
                     /db_xref="GI:752602782"
                     /translation="MITQNDKQFNMFPSHIGLRKYILYYNIVFPENDTFMAQYTLMPN
                     ACGTLSLAFDGTAVIAELWGASLTPVLLGMEPNNYHVLLLIQLSPYGLYQITHQSQAE
                     FAGKRLSLVDIDNELFHSLYQAFIMSKTTIELVNTCEKILYRRMENPLISDALLLATT
                     VISDSCGQVQVKEVARQCGYSERQLNRLFLTQIGINIKNYARLTRFNYVLKHIQTSPC
                     FFAALSQQAGYFDQAHFDKDFKAISGVSPQDYLKTMSDFYYDGMGIYDTISSKED"
     gene            49289..49759
                     /locus_tag="DSY_RS00260"
                     /old_locus_tag="DSY0048"
     CDS             49289..49759
                     /locus_tag="DSY_RS00260"
                     /old_locus_tag="DSY0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_011458846.1"
                     /db_xref="GI:499778112"
                     /translation="MKYQGCLLAVKNIAASKQFYEKVLHQNVVMDIGVHVTFEGFSLQ
                     QGYAELVGLADDSVKEQSHNFQVYFEVEDLDKVYAEMKSISDLQWVHEIKEYPWGQRD
                     IRVYDSDKHIVEIAEDMNTVIKRFLKQGMPVEEVAKRTMFPLEVVKQYSLCFDK"
     gene            49819..50541
                     /locus_tag="DSY_RS00265"
                     /old_locus_tag="DSY0049"
     CDS             49819..50541
                     /locus_tag="DSY_RS00265"
                     /old_locus_tag="DSY0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage protein gp37"
                     /protein_id="WP_041272170.1"
                     /db_xref="GI:752602783"
                     /translation="MNWEPWTGCYKISDGCTNCYFYGPHAKRYGQNTIQKTDKFDWPI
                     RKTAKGEYNIKGNKILATCFATDFFLPEADEWRKEVWSIIKERTDIDFLILTKRIDRF
                     LISLPSDWGAGYDNVNIGCTVENQRLADERLPLFLSYPIKRRFIACAPLLERIDLTPY
                     LHGIDHVTVGGETGREARVCDYDWVLNIREQCVKANVTFWFKNTGSLFKCDGVVEKIN
                     PFKQTSIAKDFDINILDGKRLF"
     gene            50921..51268
                     /locus_tag="DSY_RS00270"
     CDS             50921..51268
                     /locus_tag="DSY_RS00270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018213991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272171.1"
                     /db_xref="GI:752602784"
                     /translation="MFNEICIYEAKIEKQEEIEQLMKDVADFYLQQDGVIDVKYIKRT
                     HRQADFNAVKEGELPIRLTRNVGKVTYVLHWTLKDEETHARVSKLGLENFYKRWNRCL
                     TTMPKIILGENIV"
     gene            complement(51538..53355)
                     /locus_tag="DSY_RS00275"
                     /old_locus_tag="DSY0050"
     CDS             complement(51538..53355)
                     /locus_tag="DSY_RS00275"
                     /old_locus_tag="DSY0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maturase"
                     /protein_id="WP_041272172.1"
                     /db_xref="GI:752602785"
                     /translation="MRNPINMLSSLQNHSSDRSYTFERLYRNLYNRELFLLAYQNIYA
                     SQGNMTKGTDGKTIDAMSLNRIDGIIASLKDESYQPQPSRRTYIPKKNGKLRPLGIPS
                     FDDKLVQECVRLLLEAVYEGSFAKTSHGFRPNHSCHTALSQVQVCFTGVKWFVEGDIK
                     GFFDNINHEVMIGILAEHIKDERFLRLIRKFLKAGYLEDWQYHNTYSGTPQGGIISPI
                     LANIYLDKLDRYMEELKKRFDKGKARAVYPETYELEKKRGVLAKKLRNTNSEEEKQVL
                     TEKIREIDRKKLTIPYSDPFDTSFKRLQYVRYADDFLIGVIGSKEDAIAIKEQVKAFV
                     ADMLILELSDEKTLITHSEKRARFLGYDIYVRRSAATKKDKTGRLCRHLNGTVCLEMP
                     TELMRKKLLEYGAMTIEKTVYGKDNWKAKARYYLKDNDDLEILDQYNSEIRGFRNYYR
                     IANNAAHASSFGYIMQYSMFKTFATKYRTTMRRMIGKLRTGKNFGVRFTDKKGKTKTR
                     LFYNEGFARKPLQKNAVVDVIPKTVMYSSKTSLMARLSAGQCELCGKTDCEIEIHHVR
                     KLKDLKGKSYWERFMIARNRKTLALCLDCHEKLHSGKLN"
     gene            complement(<53955..54185)
                     /locus_tag="DSY_RS00280"
     CDS             complement(<53955..54185)
                     /locus_tag="DSY_RS00280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214008.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272802.1"
                     /db_xref="GI:752603415"
                     /translation="MKRYQKIALALSLVLMISLLFSTTAFAANGDVAGAIEGTWNDAS
                     GQIKTVVNKVVFPAIDLILAVFFFAKLGTAYFD"
     gene            complement(54255..54725)
                     /locus_tag="DSY_RS00285"
     CDS             complement(54255..54725)
                     /locus_tag="DSY_RS00285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272173.1"
                     /db_xref="GI:752602786"
                     /translation="MAYERIEAPKGILYHYTTKDRLEAILKDGRIRRFKDRECWFCTS
                     LADILRLMEMTVMKEGHPYVDTRGFLQRYSAFVPDDYIILKLEQRHQNGEWVRWNQEM
                     PRGCSAELLAQAEEFSALKKGFRGDLKFYQNPQVLAVAPLLEEQTPGMDMTMQL"
     gene            complement(54739..56424)
                     /locus_tag="DSY_RS00290"
                     /old_locus_tag="DSY0052"
     CDS             complement(54739..56424)
                     /locus_tag="DSY_RS00290"
                     /old_locus_tag="DSY0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272174.1"
                     /db_xref="GI:752602787"
                     /translation="MKKLLLRALPLFLIFCLLCPMTAFADTGGSGNIDGGGGGMGQGT
                     STNSWNGGNEGVRVTVVRASDHAVVTTPFDFTNKAPSAGIYHFGKVSKLQYNNGVSLS
                     PVKGGYVYKNPGQTMPRIISTNGSNNIEIIKKYFCSEYVVKRIAEITGMNYDVLIGGE
                     YKILLEPLAYYKFEGNMFATTATEAALYDEQTSGLLRRRMVSLTHKNLPLAMFLEVSD
                     LGYPAWGGSKTSAATNADIKSSLGLGIVRFEEKPEAPQIEAYDYEYRVNTDVITAVRI
                     SGGQSDPDNPTRISFNIGGKNYNVGNVYYPDGDSQLAWVKWTTPDTEQNMTIDVTVSG
                     PGSTAKTTLNVKIVDLDKNPPPNPVADDRNDSFSHTPVPSRAVKSTASWSVWSPWWQE
                     YWVWHGDDEDGYWCDHGWWEFDLDRYSASLTANMSIQCDSKNPTASGRTMKSGYGINQ
                     TVAGSVSSNQSSAVTQPQNAVSYFPEFGYETYWRLLERMGSGRFEFQVNSYSTYKNRT
                     HFSPIWMPDGAYTINTWLIDAWTPDGMLSANLTNSLTIRGNLWQDWHAGPIQP"
     gene            complement(56495..57040)
                     /locus_tag="DSY_RS00295"
                     /old_locus_tag="DSY0053"
     CDS             complement(56495..57040)
                     /locus_tag="DSY_RS00295"
                     /old_locus_tag="DSY0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272803.1"
                     /db_xref="GI:752603416"
                     /translation="MNPKIKKWLAVAGGLALCAVLVVLIGQRFHTEKPVDDPLPSQSS
                     EVSDVTVDPNEPDSTKEKEVSVTLPDTSQPTSTDNGAVSGGTEQTIQSDAIKPEYTEN
                     QLKDPTQKPNGEKVPEPPTAVDHDKVEQPKETPKSESTSKPSGGGNSIPGFDNVPDGG
                     ANHGEVVDGDGDINKQVGIMD"
     gene            complement(57160..57708)
                     /locus_tag="DSY_RS00300"
                     /old_locus_tag="DSY0054"
     CDS             complement(57160..57708)
                     /locus_tag="DSY_RS00300"
                     /old_locus_tag="DSY0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458852.1"
                     /db_xref="GI:499778118"
                     /translation="MTDIIKKILRGKGGAGFPLIIAITLSLVIIFTGISEYFRLMIIA
                     QGVRDAVQAAVISTVVENYDDVYHGVREGYSGAYQPYAGDFEESLDYGDIYDRLDGIL
                     GLSNSSGYHEKRTPDGKLEFKVWNLDVDIRNAPLASGDQASARFEADSTILLEVPVSF
                     GGKLLPPMTIKVKTSAGYIPRF"
     gene            complement(57705..58100)
                     /locus_tag="DSY_RS00305"
     CDS             complement(57705..58100)
                     /locus_tag="DSY_RS00305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272175.1"
                     /db_xref="GI:752602788"
                     /translation="MLKILRGKRGEGYIDVAVLVLCAMLVIALAVKVFPVYIQKQQLD
                     TFATELIREAEIAGQVGSETSRREQLLQEKTGLSPHVEWSETGRIQLNGEVTVTVTYQ
                     TNIGLFGGFGSFPITLRADAAGKSEVYWK"
     gene            complement(58094..58801)
                     /locus_tag="DSY_RS00310"
                     /old_locus_tag="DSY0055"
     CDS             complement(58094..58801)
                     /locus_tag="DSY_RS00310"
                     /old_locus_tag="DSY0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458853.1"
                     /db_xref="GI:499778119"
                     /translation="MKSLHPSAGCSKGGANQVTEQEMMTLLRKKLDSGMALYQKEWQK
                     RSASELVDMASEIAAAKFVYGELSGGSYSSEYMEYLLRFENPLEVVKDQWISEQTVDF
                     SEELTHALWTLWDKGESESEYTLDPEYAPVSAEEARITLWEFIEAHPNAAFDMMTPGG
                     YVYLTPETAQLLLSGHSVKGNPDSAEFARDIPAEELLEQEICTADFSKGAWRILSDRN
                     PEPRQAQEPFEQGVTMC"
     gene            complement(58767..59639)
                     /locus_tag="DSY_RS00315"
                     /old_locus_tag="DSY0056"
     CDS             complement(58767..59639)
                     /locus_tag="DSY_RS00315"
                     /old_locus_tag="DSY0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein F"
                     /protein_id="WP_041272176.1"
                     /db_xref="GI:752602789"
                     /translation="MTIYIFLFGVLLSAGLFFITADLLRLPTLATQKAMLSAGKQAKA
                     KPKTTDVLLRNAAVRLARYIRMDEYKKSRMANVLSAAGLSDSPELFTAMAIVKAAAIA
                     LCILPCLIVLPLLAPIVLFAAILVYFKEIRKADEALAAKRGKIEQELPRFVATITQEL
                     KASRDVLSMLENFKRNAGEDFAAELDILTADMRSSSYEAALTRFEARFNSPMLSDITR
                     GLIGVLRGDDGGMYFQMLAHDMKQLELQRLKAQAMKIPPKIRVFSFAMLMCFLMTYMA
                     IIVYEIVTSLGGMF"
     gene            complement(59650..60579)
                     /locus_tag="DSY_RS00320"
                     /old_locus_tag="DSY0057"
     CDS             complement(59650..60579)
                     /locus_tag="DSY_RS00320"
                     /old_locus_tag="DSY0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011458855.1"
                     /db_xref="GI:499778121"
                     /translation="MTTVLLIACIGMIAGSFILLGLTPIEFTTAVFGKLTDRPKSLRD
                     EVGEFTHRKKQSYLRRQIAEVQSILKVTGRTARFPMLCALSLLFFAVGASIAVMLSNF
                     FLVPVMAMGCMLLPFWWVKLTASHFKKDIAAELETALSIITTAYLRNEDILTAVEENL
                     PYLNPPVLSVFKGFVSRVRLVDPNVTAALHDVKMRIDNAVFHEWCDALISCQHDRSLK
                     TTLTPIVSKLSDMRVVNGELENMVFEPRKEFIIMVVLVVGNIPLMYFLNQDWYHTLMH
                     TPLGQIVLTICAAVIFVSTAFVIKFTQPIEYRR"
     gene            complement(60576..62183)
                     /locus_tag="DSY_RS00325"
                     /old_locus_tag="DSY0058"
     CDS             complement(60576..62183)
                     /locus_tag="DSY_RS00325"
                     /old_locus_tag="DSY0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458856.1"
                     /db_xref="GI:499778122"
                     /translation="MLGKKRNPSLFSSDKKSSQAVPQEPKTFENMDISPDANTIQVVV
                     LNETTELTIPENLTQYSSYDGTIPPEMQEPPKRTVLAEVTVGHRAQSLFFTPEAEGKD
                     FSSVLADVQEYISEHYSTLITTGGEDAKAQLKRYITKYVQDHRISVNGMSGGKLADTL
                     YTEMAEFGFLTKYIYGTGIEEIDINSWRDIEVQYSDGRTVKLEERFESPQHAVNVIRR
                     MLHISGMVLDNASPIVLGHLSKNIRIAVLKSPIVDEDVGVAASIRIVNPQSMKKEDFV
                     KSGTATDPMLDFLSLCVRYGISVCVAGATSSGKTTVAGWVLTTVPDNKRIYTIENGSR
                     ELALVREKDGKVVNSIIHTLTRDSDNERQRIDQTNLLDYALRFNPDIIVVGEMRGAEA
                     NAAQEAARTGVAVLTTIHSNSCEATYRRMVSLCKRAVDMSDATLMDYVTEAYPIVVFC
                     KQLENKQRRMMEIQECEILPDGTRCYRPLFQYVITENRMEDGKFIIEGHHEQINSISD
                     SLAKRLLENGMPQPVIESLRGKEAQSA"
     gene            complement(62177..62992)
                     /locus_tag="DSY_RS00330"
     CDS             complement(62177..62992)
                     /locus_tag="DSY_RS00330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013623310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_041272177.1"
                     /db_xref="GI:752602790"
                     /translation="MLNFKKKGIFTRQAPSEDAQPEQEPQSGILAVWGSPGSGKTVTA
                     VKIAKHLADRKKNVVLLLCDMTAPMLPCVCPPSELESEHSLGSILAATHVTEALIKHN
                     LVTLKKNSHLTILGMRKGENEYTYPPYEQLQAQELMDGLREIAPFVVVDCGSYIANDI
                     LSAVALMEADSVLRLAGADLKSVSYLSSQLPLLRDSKWDAEKQYKVASNVKPQQAGEQ
                     IGQALGSVAFTLIHSQELEEQYLAGNLLADLSLKDSRLFRREIEKIAKEVFGC"
     gene            complement(62992..63816)
                     /locus_tag="DSY_RS00335"
                     /old_locus_tag="DSY0060"
     CDS             complement(62992..63816)
                     /locus_tag="DSY_RS00335"
                     /old_locus_tag="DSY0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013623311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaB"
                     /protein_id="WP_011458858.1"
                     /db_xref="GI:499778124"
                     /translation="MSLFKNRTVVGVICILLSLLICFGVTPLFNKSVSQKTEIVRVVK
                     EIKAGDEITKDTVQTVEVGGFGLPDNVIRQSETVIGKYAKSDLSIGDYILNTKLSDTP
                     AAENAYLYNLDGTKQAMSVTIKSFANGLSGKLQSGDIVSVIAADYKKQGTTVIPAELK
                     YVEVISVTASSGYDANTGEAKSEDDDRELPSTVTLLVSPEQSKVLAELESDGKLHLSL
                     VYRGTPTNTAKFTEAQDKVIAALYPVEVSQDSSSEPKSQESEESTASETPAESEVQ"
     gene            complement(63977..64429)
                     /locus_tag="DSY_RS00340"
                     /old_locus_tag="DSY0061"
     CDS             complement(63977..64429)
                     /locus_tag="DSY_RS00340"
                     /old_locus_tag="DSY0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 prepilin peptidase 1"
                     /protein_id="WP_011458859.1"
                     /db_xref="GI:499778125"
                     /translation="MQDNGIAQAVLFFCLLLVASVWDLRKRIIPDSICLLIVLTGLID
                     FSPVRLWGVLAALPLLIAALYKPDGIGGGDIKLTAAAGIVLGFWGCTAGLTLGLMASL
                     FFYFWTQAIRRLRKLEPLKTSQASLPMAPFLSLGFLAVIILRIGGNIL"
     gene            complement(64419..64649)
                     /locus_tag="DSY_RS00345"
     CDS             complement(64419..64649)
                     /locus_tag="DSY_RS00345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272178.1"
                     /db_xref="GI:752602791"
                     /translation="MKHLICKLKIKAVIAAAKTRYILSGSRGEGYIDTAIKILIAVVL
                     GALLLAGLYALFGETVLPTLTQRIKEMFNYAG"
     gene            complement(64662..68657)
                     /locus_tag="DSY_RS00350"
                     /old_locus_tag="DSY0062"
     CDS             complement(64662..68657)
                     /locus_tag="DSY_RS00350"
                     /old_locus_tag="DSY0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458860.1"
                     /db_xref="GI:499778126"
                     /translation="MKKKMKRPLGIILAACLVVSLFAGSAYGVNRYFEDAKGHWAEEA
                     IQILTEKGVISGYPDGLAHPDEIITRGEFAALIARTMELPEPDESEVTIHFVDIAGHW
                     SEQNVEALIIAGIIQKDDFGTKFLPDEPITRMEMIRMLVRAIGKGDHDASCPCVTGFS
                     DDSALSDADKSSICTGKEYGIVNGYPDGTVKPDGKATRAEAFEMLVDTEKAKEQIKKE
                     EPPKPPVVTPTPPVTPKPGDKPSGGGGSSGGSSDGGGSGGGGSSYVHAPQFSFTLPKT
                     AYTADEIEIKPESRYVSGVTWSALKNGLPAELSELTEGTLTANGGKVKFTQTGSITLI
                     ATAENSRGATVTHEQTVSIYPVVTATFTLPETAHTDTAVPVELATENLGINSVVWSLQ
                     KNGAIANIDEALTGELTATGGTVLFKEKGSYTLTASITDELGKTVTVENSITVYPVAE
                     VNLILPAVSHTDKTVALKTETKETDGLTLTYTLTRNSESADISTWIEGNPSAGSIRFK
                     EKGVYALTASVTDATGRVFAGTADITVYPVGSAGFYLPEVFHTDKEVVVEAVFDEIGS
                     HTAKWSLMHDGKEVSLTDAAEGALGNSGGKLKFRSKGSYVLKAEFTDDGGRSYRYEQS
                     FVAYPVPTVTYSLPKYAHTDTDIVVKTEAADLDGLTIEWLVDNTFGFQDWPTYVDGKL
                     SNDGGTIRFKRAGIYELVARITDDTGRVFLYESKDRCEVLPVLTIGFELPAFAYTDTA
                     IDLRTHGNNNVLPVEWSVSKNGKSIRLSEAFNGNLTPQGGKITFKGDGEYVLTAAMTD
                     YLKRSYSHSESIRILPVVQYAFTMPQTVHYGAEFTVAAKDVQHIGSYAAVWTLQKDGN
                     TAPYQGTLGNDGGKIAIRDTGAFTLTASVTDREGRVTTHSERITVTNTAPNAPVVKAE
                     PTRTAKDGKFLVTITANATDPDGDAVTLEYADTAADSYYALGTHTIRVRAKDIAGAYS
                     AWTEKTFTVTNAAPTVTLTAVPSRTVKDGKFHVDISATAADADGDATTLEWENKAADG
                     YYSPGTHTVKVRAKDIAGVYSPWAEKTFTITSSAPTVTLTAAPTRTASGGKFLVNITA
                     KATDVDDDATTLEWENKADDNYYAVGTHTVRVRAKDATGLYSQWVSKTFTIANSAPTA
                     PVITRTPGGNSVAPGTPVTITATSSDPDGDAVTLIWEGRNTETQTYPRGKNVVRVKAV
                     DSAGAESPWAAIVFFVADSNGGGGMTLTGPDSVIMENGIEGATITEYTFTVPPVSGHS
                     GSDFGRVRGYNKLTGQWDQLDYGTTSNGITFTRSFGAGVYTQLEMYYYTNHDCMYNKS
                     NITYSVTYHFE"
     gene            complement(68668..69027)
                     /locus_tag="DSY_RS00355"
                     /old_locus_tag="DSY0063"
     CDS             complement(68668..69027)
                     /locus_tag="DSY_RS00355"
                     /old_locus_tag="DSY0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458861.1"
                     /db_xref="GI:499778127"
                     /translation="MPKNTTPAVPKYDVKIHSIRPEGSCKATASVNIYGDFAVRGIKI
                     MDGSKGLFVSMPSYKAGNGEYRDICFPCTKDAKAEFDKAVLGAYQQALTQGQATAQKQ
                     EFPEPQQAQSQPVMGGM"
     gene            complement(69061..69324)
                     /locus_tag="DSY_RS00360"
     CDS             complement(69061..69324)
                     /locus_tag="DSY_RS00360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013623318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272179.1"
                     /db_xref="GI:752602792"
                     /translation="MVHIIKKVKATVSHKLTAAKDTAARLAFRSRHILSEGAGEGYID
                     TAIKILLAVVIGALLLAGLYALFGETVLPTLTQRIKEMFNYAG"
     gene            complement(69381..69935)
                     /locus_tag="DSY_RS00365"
                     /old_locus_tag="DSY0064"
     CDS             complement(69381..69935)
                     /locus_tag="DSY_RS00365"
                     /old_locus_tag="DSY0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272180.1"
                     /db_xref="GI:752602793"
                     /translation="MPGITLKNGLISYYGNPAGYTEKEKAVVDSIFQNDELSTWLKNR
                     SLTPQWTDGVMERLLAGEHPGCIETAAPLKNVRIWQLKPDVDIHMKFIPYEEMVRQFG
                     NPSPEHYRIAYDGQLNTNDLETIYARCNVNHPPGYDGHSLSMSDIVELYDDSGSEFHY
                     CDRFGFQKISFGEPEQTQTMGMSM"
     gene            complement(69977..70549)
                     /locus_tag="DSY_RS00370"
     CDS             complement(69977..70549)
                     /locus_tag="DSY_RS00370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013623320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272181.1"
                     /db_xref="GI:752602794"
                     /translation="MKTNQKKTEQTLQIPMAVQQCCGFTDAETLAVMAADSVCVIHKG
                     ELTALELIHVITALSELASDMTIHLAKACGLCNNCSDEKSEAGAECDCGNNPSEWVAN
                     CSLCHDLLDESQSIHIPDYLLEEAGIPKGAKLEAYTDGNSGEITVVEADIQQDLGDVP
                     PCILSVLAQSGICLAALDELIMQESIIYGK"
     gene            complement(<71183..71557)
                     /locus_tag="DSY_RS00375"
     CDS             complement(<71183..71557)
                     /locus_tag="DSY_RS00375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009258907.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272804.1"
                     /db_xref="GI:752603417"
                     /translation="MDKNTFWQIIDSVNSEVSGSDLEGVLRVTQEKLEDYNPQEIAAW
                     ANFLGQYRDFADTSGVFAASCILNDYMSDDGFMDFRAWLISRGKEVYLAALKNPDTLA
                     GIDIPEDTRFESYGYVAYDAYRE"
     gene            complement(71560..72390)
                     /locus_tag="DSY_RS00380"
                     /old_locus_tag="DSY0067"
     CDS             complement(71560..72390)
                     /locus_tag="DSY_RS00380"
                     /old_locus_tag="DSY0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_011458865.1"
                     /db_xref="GI:499778131"
                     /translation="MSWIGGKKALRELIVTLFPLYYERYIEVFGGGGWILFHKFPGND
                     FEVYNDFNGLLVNLYRCVREKPEELMDALRYVLNSRADFELVRNALARDSPASDVQRA
                     AWFYQLIRYSYASGLTSYGSQPHDMRSNFPLIEQAHRRLAKVVVENKDFERLIGQYDR
                     PVSFFYCDPPYFETESYYKNVGEDGFTEKDHIRLRDALMRAQGKFLLSYNDCGFIRDL
                     YDAPGIQIDSYTRINNIKQRYDNGAQFPEILIANYDMQERMRDGPMQLNLFGEGGFLE
                     "
     gene            complement(72399..72731)
                     /locus_tag="DSY_RS00385"
                     /old_locus_tag="DSY0068"
     CDS             complement(72399..72731)
                     /locus_tag="DSY_RS00385"
                     /old_locus_tag="DSY0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272182.1"
                     /db_xref="GI:752602795"
                     /translation="MPQEQLAEYLHRYHHGAENAVTSKTMEYAFRISGKELRDLVNAL
                     RREGIPIASDQSGYFYAKTEAEVRLTIRHMKSRISGINAAITGLKRSLAAFDDTQIRL
                     PLEGGDDF"
     gene            complement(72935..74170)
                     /locus_tag="DSY_RS00390"
                     /old_locus_tag="DSY0069"
     CDS             complement(72935..74170)
                     /locus_tag="DSY_RS00390"
                     /old_locus_tag="DSY0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272805.1"
                     /db_xref="GI:752603418"
                     /translation="MPPEQCLFMKVEISRPGSFGAETSSTLTLPAAPYEILDALDKAR
                     ITDERVIYSAEVIGCELDYLPQFIGTNANLYELNHLAERLSSLSAGELDCFEGMVMMD
                     TIQTQYSPIAIDRLINMTHSMKDCHVVYEAHDDSTLGKFYADNDFVQKLENVPDEIYE
                     CLDFGKIGKEMREGEGGVFTPHGYVIQNGEIAAEYHSGDAVPLEKLDYTMLLRVTKGD
                     FNDPQYDNDLVAFLKLPADDKMLSQAVEVVEAASPEECVFSAVDCMIPSLTEKINDAL
                     YESDGDCYGLVNELAEQLQRINNKGNISTYKAMMEVVQTEISLEDALDLSQEIEKFSV
                     IREAASPADYARSMLSKYCIEYESELFSRTDLYGYGSKLMEEKEVALTEYGVLWSLTG
                     QTVEQCLNRPSQSHGMEMK"
     gene            complement(74184..74912)
                     /locus_tag="DSY_RS00395"
                     /old_locus_tag="DSY0070"
     CDS             complement(74184..74912)
                     /locus_tag="DSY_RS00395"
                     /old_locus_tag="DSY0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458868.1"
                     /db_xref="GI:499778134"
                     /translation="MRDYQGLLKFVKEQYPPGTRIRLIEMQDPYAPVPPGTEGEVDFI
                     DDAAQIHMKWSNGRSLALIPGVDRFTVIPQHLQTLKLYMPLAVMQYERDELGSLEEYP
                     SELDQGTVLSYHDQILAAILKERTPEKTERGLMKYYHEDDGVGQKVKSLFFTVEQVGS
                     KLMGVAECRVQGDLGDAELEQLKDYVSGQASDGFGEGFEQHPIKVGSDELYVSLWTAS
                     KGWSISTKDELEATGQQMGGMQLG"
     gene            complement(74909..75142)
                     /locus_tag="DSY_RS00400"
     CDS             complement(74909..75142)
                     /locus_tag="DSY_RS00400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272183.1"
                     /db_xref="GI:752602796"
                     /translation="MLVHYKKNKKPACYDSESIITTGRIPPDERPHGPFKSCGNCPYP
                     SHGFICYSSEGNCLRTDMQRIHNRNKQKKEELT"
     gene            75557..>75922
                     /locus_tag="DSY_RS00405"
     CDS             75557..>75922
                     /locus_tag="DSY_RS00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019118452.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272806.1"
                     /db_xref="GI:752603419"
                     /translation="MKPKIYKTYRQLISILRSRGLNIKQGSAGSRTMRILEKENYYNV
                     INGYKDLFIQTPATDMTDEVYKTTATFDEIFALYSFDREIRIIYLKYILKLENHFKTV
                     VSHCFSQKYGHDNYLKLSSF"
     gene            complement(76679..77248)
                     /locus_tag="DSY_RS00410"
                     /old_locus_tag="DSY0072"
     CDS             complement(76679..77248)
                     /locus_tag="DSY_RS00410"
                     /old_locus_tag="DSY0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458870.1"
                     /db_xref="GI:499778136"
                     /translation="MDMATDYSHLLAEYPEKICQDQFYKICRMSKRKATWLLENGYIP
                     CEDTGKKTRRFKIRITDVIEYLTRLEDSPESLLTPPGIFSSGIKYRPKRQTDIQIDAD
                     EFMEMLKKRWSSSPDALTVDDAVKLTGYCKTTVSEWITKKKLFGVWYYNKYLIPKDCL
                     IEYMATQAHRITQKSEKHMNLIAQYFDGR"
     gene            complement(78083..79327)
                     /locus_tag="DSY_RS00415"
                     /old_locus_tag="DSY0073"
     CDS             complement(78083..79327)
                     /locus_tag="DSY_RS00415"
                     /old_locus_tag="DSY0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011458871.1"
                     /db_xref="GI:499778137"
                     /translation="MQDKDTTQSTFMQAFQPFFSKDLWETIHREVPGLDLRSQKLTTN
                     QLTLLISHAQLQEYRALRKISTSVHHDSLGQAIGLESISHSQISRRLKTLPTQVPEML
                     FKGTLHNVAQKQGYGKIRQQLGKLYMIDASTMSLCLSRYPWAVFRKSKAGVKMHLRLS
                     FDAMAVPDEVLVTPAKTADRKKLDELIVQDQEALNIFDRGYVDYKLFDDYCEKGIRFV
                     TRLKNNAVIEFTGVERPVKEDGLIEEDVDVILGAGSRKMKHTLREVTIDDNVHEPFTI
                     LTNDFNLSAEELGEIYRYRWQIELFFKWLKQHAQIKHFYGTSETAVINQILLALMMYC
                     LLVLLKLEAGYPRDLLTLQRLLIACLFERYEEFLEKLRRRRRKGSKRIRYEEIYRMTE
                     HSILKEEETQWLDDLTYDPVIL"
     gene            79782..79979
                     /locus_tag="DSY_RS00420"
     CDS             79782..79979
                     /locus_tag="DSY_RS00420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_026198773.1"
                     /db_xref="GI:648507022"
                     /translation="MEYMKVKEAVEKWGLTDRRVRILCEQERINGVIKKGRSYLIPAD
                     AEKPIDGRKLRVKRPVYAMNL"
     gene            <79940..>80365
                     /locus_tag="DSY_RS00425"
                     /old_locus_tag="DSY0075"
     CDS             <79940..>80365
                     /locus_tag="DSY_RS00425"
                     /old_locus_tag="DSY0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007777848.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_035214461.1"
                     /db_xref="GI:737230128"
                     /translation="TAGETARLRDEFMIEFTYNSNAIEGNTLTLQETALVLEGITIDQ
                     KPLKDHLEAVGHRDAFVYVQQLVSNKVPLEERTIKEVHSLVLMDRPEDKGLYRRIPVR
                     IMGAALEPQQPYSVPKKMKQLINKKRGTMHPLERIAWFHL"
     gene            complement(80371..81228)
                     /locus_tag="DSY_RS00430"
                     /old_locus_tag="DSY0076"
     CDS             complement(80371..81228)
                     /locus_tag="DSY_RS00430"
                     /old_locus_tag="DSY0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011458873.1"
                     /db_xref="GI:499778139"
                     /translation="MGWIEGISDAINYIEDNITEELTIENISKQAFVSSFYFQKGFAM
                     LCGFTVGEYIRQRRLTLAGSELVSTDRKIIDIALKYGYDSPDSFTKAFLRFHGVTPTA
                     VRKDGAMLKSFAPLKIKFSLEGGFIMDYRIIEKEAFTVMGAAKVFKYDTAGTEIPKFW
                     TEHYQTGKDKIVCGMYGVCVDESMGSDEFEYLIADNYTTSSEIPDGFVTKVIPKHSWA
                     VFACKGAMPTSLQNTNQKIFSEWLPNCKDYEIAAGYNIEMYTNVADYPKGNQDENYYS
                     EIWIPVQKK"
     gene            81434..82000
                     /locus_tag="DSY_RS00435"
                     /old_locus_tag="DSY0077"
     CDS             81434..82000
                     /locus_tag="DSY_RS00435"
                     /old_locus_tag="DSY0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458874.1"
                     /db_xref="GI:499778140"
                     /translation="MEYKQRDYPLFSACGLNCGLCPRYQMNGASQCPGCAGKDFLAKH
                     PKCGVLSCSQRKEFTYCYQCDEFPCPKYDGADQSDSFITHLHQFRDMEKAKRWGIEAY
                     RQELNEKVSMLEQLLANYDDGRRKSLFCLAVNLLETEDIKHVLEQLTSEVQSDAPLKE
                     KAASAVCLLQAMAEQRKITLKLRKKSKL"
     gene            complement(82134..82439)
                     /locus_tag="DSY_RS00440"
     CDS             complement(82134..82439)
                     /locus_tag="DSY_RS00440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_005815111.1"
                     /db_xref="GI:492341134"
                     /translation="MMINDEVKAVIEGSPFITLVTVSADGTPHPIIAGKGEVSGDQVI
                     FGIYKMEVTQKNLQANDKAWLVGATKDGGPKGYRLFGTAKAVGKQLIFTAQTVEAMI"
     gene            82563..82928
                     /locus_tag="DSY_RS00445"
                     /old_locus_tag="DSY0078"
     CDS             82563..82928
                     /locus_tag="DSY_RS00445"
                     /old_locus_tag="DSY0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_035214419.1"
                     /db_xref="GI:737230086"
                     /translation="MTERDVKCVVSCPTKCPCMEYCPLGSALKIIGGKWKLPILCALH
                     QDGTTRYNTLKRKIAGITNTMLVSSLKELEEDGLIVRRQYMEMPVRVEYTLTDVCDDL
                     MPILKQLAQWGVKVHTKES"
     gene            83094..83279
                     /locus_tag="DSY_RS00450"
     CDS             83094..83279
                     /locus_tag="DSY_RS00450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815107.1"
                     /db_xref="GI:492341130"
                     /translation="MSQLNQVELQNLRHLIGAHETAHQKLQAYAQQATDPEIKQFFQD
                     GAQGAMKTKQQLLSFLN"
     gene            83293..83541
                     /locus_tag="DSY_RS00455"
                     /old_locus_tag="DSY0079"
     CDS             83293..83541
                     /locus_tag="DSY_RS00455"
                     /old_locus_tag="DSY0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coat protein F"
                     /protein_id="WP_005815105.1"
                     /db_xref="GI:492341128"
                     /translation="MIDEKVMVNDVLSSVKSSLTFYANTISECANPELRSTIQQIRNN
                     DEASQYQLFQMAQAKGYYKPALMAKDDEIQQTKSQVSS"
     gene            complement(<84258..84443)
                     /locus_tag="DSY_RS00460"
     CDS             complement(<84258..84443)
                     /locus_tag="DSY_RS00460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458876.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272807.1"
                     /db_xref="GI:752603420"
                     /translation="MLLGRYNILLMDEPSNFLDLPGIEALEVLMKSYAGTILFISHDQ
                     RLLENVADRIYAISVKIL"
     gene            complement(84445..85908)
                     /locus_tag="DSY_RS00465"
                     /old_locus_tag="DSY0081"
     CDS             complement(84445..85908)
                     /locus_tag="DSY_RS00465"
                     /old_locus_tag="DSY0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_005815099.1"
                     /db_xref="GI:492341122"
                     /translation="MGFFVVFIFAGKDMENRRGIAISGYPCCCLSFFVDMQIESPSRG
                     WRSAFFIAISNYELCNKKREEPTMELLLKATDIYVEYKGREILSINELELYNYDRIGL
                     VGSNGAGKSTLIKVLLGELALPGCIVKGIGNFAYIPQLTEAAWQESIDHALLGKLGVS
                     RLDTQTMSGGEETRLKVAQALSGQVHGIFADEPTSHLDREGIDFLIGQLQYFSGALLI
                     ISHDRYFLDKVVNKIWELKDGKITEYWGNYSDYLGQKEEERQRQTAQYEQHVMERARL
                     ERAAEEKRKQAQKVDQKTKGAAKKGATESGGRLGHQKTIGSKQKTLYKAAKSMEHRIE
                     SMGDISAPEKARTVRFRQSQALALHNPYPITGTEINKIFDNKVLFEKASFQIPLGAKV
                     AFTGGNGTGKTTLFQMILHREAGIAISPKAEIGYFAQNSYKFNRDQGVMTFMEDHCDY
                     GQSEIRSVLASMGFSPNDIKKNLSVLSGGRAHQIIAG"
     gene            86162..86368
                     /locus_tag="DSY_RS00470"
                     /old_locus_tag="DSY0082"
     CDS             86162..86368
                     /locus_tag="DSY_RS00470"
                     /old_locus_tag="DSY0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_005815097.1"
                     /db_xref="GI:492341120"
                     /translation="MHNKVRILREEWGLTQKELGEKVGVSRQAINAIETGKFDPSLWL
                     AYDLAKLFKVSIEELFLFIEEDRK"
     gene            86365..86829
                     /locus_tag="DSY_RS00475"
     CDS             86365..86829
                     /locus_tag="DSY_RS00475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815096.1"
                     /db_xref="GI:492341119"
                     /translation="MKQLLKNPATNAIGLSLFTAFYSLIFIVTAGHVEFVNLLYYSRS
                     DGKSSFWTGWSYFLASGYHAYIAYVLIALSILVVLMLLTRRHPYDEYHTDVLIKCLAV
                     ATILTLAAIAIFYLLVLSEPNGIVEKFTLFIVIHWVTVVLADLVYVLICRWR"
     gene            86870..88207
                     /locus_tag="DSY_RS00480"
                     /old_locus_tag="DSY0083"
     CDS             86870..88207
                     /locus_tag="DSY_RS00480"
                     /old_locus_tag="DSY0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_011458877.1"
                     /db_xref="GI:499778143"
                     /translation="MKIVLIQPKMNKRPMDTDLKTRMAPPLSLLTLMGLTPEGHEVIM
                     VNENVEKIDYACGAELVGITITLDVMPRAVEIAEEFHRLGIPVVAGGIHVTSSPDECR
                     GYFDAICIGAAERIWARMIEDAEEGRLQQVYHDMTDFRGEEIASPAYHRIDKNRYLYT
                     NIITTSRGCPNRCGFCYNSCRNRMYIRRPVANVLRDIEGLGTRHILFIDDNFIGVPAY
                     TRELLNHLRGRELKWSAAVTTKIADYPDVLDLMAETGCQSLFIGFESINNSSLHGVNK
                     DNQFEKYERIVTAIHSRGIMINASMVFGLDGDEPDVFQRTLDWLVKNKIETLTSHILT
                     PYPGTELHGRMKEEGRILDHELSRYNTAHVVFQPKGMTAEELYKGYLWIYREFYSFPN
                     IWRRRPEHKAQRKSYFLFNIFYRKFGGFTSALARVIPMRAVGRLAARISYRVK"
     gene            88390..88704
                     /locus_tag="DSY_RS00485"
     CDS             88390..88704
                     /locus_tag="DSY_RS00485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012615316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012615316.1"
                     /db_xref="GI:501669953"
                     /translation="MKRLVLSVLLLIISFFLSIIALKFEMKIMGPEEGYNVPFPAYLM
                     ACLLYLLVFCGIYSALNPLFQNYRDNEKYVLTGVFSVLLFVVFRFPLSYLGLIWLNPI
                     LY"
     gene            88924..89379
                     /locus_tag="DSY_RS00490"
                     /old_locus_tag="DSY0085"
     CDS             88924..89379
                     /locus_tag="DSY_RS00490"
                     /old_locus_tag="DSY0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_005815091.1"
                     /db_xref="GI:492341114"
                     /translation="MNERIDKRKSLIKAISAIDRYSQTYIGRNVKDYNIGQGQWAFLT
                     QLLFNYDGITQEELSELLNIDKANTARALKKLEEEGYVYREEDPKDGRKKIVYVTAKA
                     RDFEQEFHEVFKGLNRILAKDFTEDERETARRILYKMLDNIADYERRHR"
     gene            89404..89811
                     /locus_tag="DSY_RS00495"
                     /old_locus_tag="DSY0086"
     CDS             89404..89811
                     /locus_tag="DSY_RS00495"
                     /old_locus_tag="DSY0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011458878.1"
                     /db_xref="GI:499778144"
                     /translation="MEILMKPIGYIKSPYKEKGEAPRQSTLSGETTAVIEILEEYQEG
                     IADIQEGEYGVILFYFHKSEGYKLTTLSRRNNQVMGVFSTRSPNRPNGIGLSTVRFVK
                     REGNRLFFEGVDMLDNTPVLDIKPYIDPAAVAD"
     misc_binding    89861..90042
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            90164..91717
                     /locus_tag="DSY_RS00500"
                     /old_locus_tag="DSY0087"
     CDS             90164..91717
                     /locus_tag="DSY_RS00500"
                     /old_locus_tag="DSY0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012615318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein"
                     /protein_id="WP_005815088.1"
                     /db_xref="GI:492341111"
                     /translation="MEKRYSQRIVALLVMVMIILLGGCNSSATNQPAENPPAEKAVAA
                     GTYTAKAAGYHGDLEVTTEVDQEGKITKITIGENTETEDVGGIAMEKIPQRIIEAQSL
                     DVDVIAGATLTSKGIINGVAAALKEAGADPVHYGYVAPEEESEAIMSPLNKSALPVKK
                     ETTGSITIKDVKGREVTLDLPISSYAISTMDVIDYIIPLKGEEAFAMLVASGQDGGGG
                     IQKYAQLYKPIVGDYTQHLGQISDHNAPFDLEMVLSMNPDVLIVNSAMAAHKYALEIE
                     EQLTAAGISIVLIDVPGKTLDKSVQETMKLLGKIFQEEEKAAEVAAFIDKQYELLAAK
                     NLAQRQNKPKVYYEKSGYSEVYGSTGTSVSGWGLPIAIAGGDNIADAVLLDKASAGGS
                     SNTLDPEYVIKADPDYIILSGVNDGWLDSLKQKKEPPQYDIINRTGWSNLQAVKNNNV
                     YEFAHSTSRSIYAFYPCLKMAKLFYPEEFKDLNPEAVLDEFFDQFMLVGSDISTWFTG
                     LEDRISLKK"
     gene            91876..92895
                     /locus_tag="DSY_RS00505"
                     /old_locus_tag="DSY0088"
     CDS             91876..92895
                     /locus_tag="DSY_RS00505"
                     /old_locus_tag="DSY0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-siderophore ABC transporter permease"
                     /protein_id="WP_005815086.1"
                     /db_xref="GI:492341109"
                     /translation="MLIRRRIFLIIGLSVGMAALVILNISIGSSSIAIHDILRVLFTG
                     EGDGHNSMIIKDIRLPMALMAVVVGASLGISGCELQTILRNPIASPYTLGISAAASFG
                     AAMGLILNANVLKSLKVPETLAVTVNAFIFALMVAVAIYIFSRQRQINKTAIILFGVA
                     LNFLFNSLTMVLQYIADENQLQSLIFWNFGSLLKTTWSKFFIVALVLVICFLVLFKNA
                     WKLTAMTLDDTKARSIGVDTAKVRRMVIFVSSLLAAVSVCFVGTIGFVGLIAPHIARQ
                     LVGEDQRFFMPLSGLLGAFVMCLAFVISKLIIRGVILPIGLVTSIIGIPFFIAIIFSK
                     KMRSM"
     gene            92895..93689
                     /locus_tag="DSY_RS00510"
                     /old_locus_tag="DSY0089"
     CDS             92895..93689
                     /locus_tag="DSY_RS00510"
                     /old_locus_tag="DSY0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005815083.1"
                     /db_xref="GI:492341106"
                     /translation="MLKVNNLNFSYKGYKKSKGSHKVFSGFSLEFAKGFNVILGPNGA
                     GKSTLIKAIFGLLDYEGEIFYGQESLTAMCTEDKIKLMSYLPQMDVDLSTLTVLEMVI
                     LGRLPELSHKVSDEDLDIVMDTLRSLNIEHLAPRNFSELSGGQKKLVFIAQTLVRNPK
                     VLLLDEPVNSLDLQKQLELCQLLQRVVAEQNVDLIVVLHDINLAARYAQHIVVVDGKG
                     SLYSAGEPREVITAAMLQEVYGVIANITYDEQGVPIIAPVCSVRGI"
     gene            complement(93745..94560)
                     /locus_tag="DSY_RS00515"
                     /old_locus_tag="DSY0090"
     CDS             complement(93745..94560)
                     /locus_tag="DSY_RS00515"
                     /old_locus_tag="DSY0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_005815081.1"
                     /db_xref="GI:492341104"
                     /translation="MEFKRVTLDNLASEHICCALTDQKGESSVASKKAWLSQRLGEGL
                     VFDKLDVRGKVFIEYIPAEKAWCPITADHYLFINCFWVSGQYKGQGYANLLLERCLAD
                     AKAKGKQGLVVLSAEKKMPFLSDPKYLKYKGFQIADQAPPYYELLYLPFSPQANVPQF
                     KACVKSGRTDEEGWVVYYTNQCPHTDKYVPILVDHLKSKKLAIKAIKIETTEQAQKAP
                     NPFTTYALFYNGQFITNEILTAKSFDKLLIKTNLYPPTVPPSPSEYPAPLQRG"
     gene            complement(94733..95236)
                     /locus_tag="DSY_RS00520"
                     /old_locus_tag="DSY0091"
     CDS             complement(94733..95236)
                     /locus_tag="DSY_RS00520"
                     /old_locus_tag="DSY0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DtxR family transcriptional regulator"
                     /protein_id="WP_005815079.1"
                     /db_xref="GI:492341102"
                     /translation="MDNKSGSEYRTVRGYQIANYQENKLTPAMEDYMEMACRLCLENG
                     YTRINKLAELLNVRPSSASKMIAKLSELGYLQYDLYESILLTEKGKETGTYLLSRHDT
                     VEQFLRLIGNMNPLEETELIEHSLNVSTVLQLHTLLDFFAQNVAVQESFETFKKAAKE
                     NPASPSL"
     gene            95381..96322
                     /locus_tag="DSY_RS00525"
                     /old_locus_tag="DSY0092"
     CDS             95381..96322
                     /locus_tag="DSY_RS00525"
                     /old_locus_tag="DSY0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="manganese transporter"
                     /protein_id="WP_011458881.1"
                     /db_xref="GI:499778147"
                     /translation="MSRKLKRMLGIVLSLILLTAGCSQTAGKKESGEGSLNVVATTTM
                     LADLAGVIGGEHVSVNGLMGPGIDPHLYQASAGDVERMQKADVVVYNGLHLEGKMSEL
                     FENLSAQGIFTICIEKSMDRSRLLISEDDGGVYDPHIWFDVTLWKQAAQGVAEGFAQA
                     DPEHGNSYIANLERYLAELDELNAYIQKRAAQLPKGQRVLITAHDAFQYFGNAYGFEV
                     RGLQGISTDSEAGTSDVSALASFIVERRIKAIFVESSVPPKTIQALQAAVKAQGFDVA
                     IGGELYSDSLGGEGSGDETYIKTFRSNIDTIVDALKA"
     gene            96338..97093
                     /locus_tag="DSY_RS00530"
                     /old_locus_tag="DSY0093"
     CDS             96338..97093
                     /locus_tag="DSY_RS00530"
                     /old_locus_tag="DSY0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="manganese ABC transporter ATP-binding protein"
                     /protein_id="WP_011458882.1"
                     /db_xref="GI:499778148"
                     /translation="MDMKGMEHAVEVETLTVAYDAKPVLWDVNLKVPKGTLMAVVGPN
                     GAGKTTLIKAMLGLLTPVTGAICFSGGKGDGHALKNRIGYVPQSGSVDWDFPATVQDV
                     VLMGCYGKLGWFRRPRKADYELTAQMLKKVGMEQYASRQISQLSGGQQQRVFLARALA
                     QEAEIYFMDEPFKGVDAQTEKAIVLLLKELKEQGKTVMVVHHDLQTVADYFDWVTLIN
                     LRVIASGPVEEVFHEENLKMAYRSTGALLRSVV"
     gene            97095..98018
                     /locus_tag="DSY_RS00535"
                     /old_locus_tag="DSY0094"
     CDS             97095..98018
                     /locus_tag="DSY_RS00535"
                     /old_locus_tag="DSY0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter permease"
                     /protein_id="WP_011458883.1"
                     /db_xref="GI:499778149"
                     /translation="MNTWLALLNDYTFQTVSLGSALLGMISGVLGSFAVLRKQSLLGD
                     GVSHSALPGVVIAFILLGSKNTEILLLGALLSGLTATALILGIVRHTRIKFDSALALV
                     MSFFFGLGMVLLTYVQKIPNSNQAGLKRFIFGQASTLLQRDIILMSVCGVVLLTLVLV
                     FWKEFKLFVFDSDFAHNLGFSPKKLNLLLSFMIVLTIIIGLQTVGVILMSALLISPAV
                     AARQWTNKLGVMVLLAAAFGALSGVVGTAASSAVPKLPTGPAIVVCASLLVVLSVLFA
                     PGRGILHRVYRHRKNKLMLKLEGSGPDVPTI"
     gene            98002..99105
                     /locus_tag="DSY_RS00540"
                     /old_locus_tag="DSY0095"
     CDS             98002..99105
                     /locus_tag="DSY_RS00540"
                     /old_locus_tag="DSY0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter permease"
                     /protein_id="WP_011458884.1"
                     /db_xref="GI:499778150"
                     /translation="MSPQFEIQLIAVIVAVACALPGVFLVLRKMAMMSDSITHTILLG
                     IVLAFFVTHDLSSSFLIAGAALMGVVTVWLTEILGRTRLLAEDAAIGIVFPLLFSIAI
                     ILITRYAGSVHLDTDSVLLGELAFAPFDRMIVERVDLGAKAIHTTGILLLINLAVIII
                     FFKELKLATFDPMLASVLGFAPTLVHYGLMTLVSLTTVGAFQAVGSILVVAFMIGPPV
                     TAYLLTDDLKRMLILSGAIGAINGLLGYLAAALLDVSIAGCMAMMTGISFLLVFIFAP
                     GRGLVSTLSRRRNQKIGFAKMILLLHLYHHEESEANLAEIQNYLRLDGELTKNLIALL
                     QKEGCIELNNSVIKLTEQGRLTSLRSYETLLSG"
     gene            99365..101008
                     /locus_tag="DSY_RS00545"
                     /old_locus_tag="DSY0096"
     CDS             99365..101008
                     /locus_tag="DSY_RS00545"
                     /old_locus_tag="DSY0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_041272184.1"
                     /db_xref="GI:752602797"
                     /translation="MNKPKLHLLRKRFAPLLILLVVVLLVGLPGCSPSPTTSKAPEEG
                     KKEELVLAVGMADYGMFDPKKTWGAIGQIRLTHSSLLKATKDLTFVGDLAKSFETSKD
                     GYTWTFKIRNDAKFSNGDPVTIEDVLFTYEMLKEDGIAFDLSFVDKMEISGKDTIVFT
                     LQEPRSTFVSQLSEIGIVPKHIYDDNYSKNPIGSGPYQVTQYNDGEQIIMDYNPYWYG
                     EEPQFKKLTFLLLGEDAAFAAAKAGQVDICYIPPKFAGQTLPGMTLHVLESVDSRGIS
                     LPVLPSGGTGYINANEVKVGNDITSHLAIRQALNIGLSRQGIIDVTMDGYGKAAYSIV
                     DGTPWFNEKTVIEDGRVEEAKQLLADAGWADTNKDGIVEKDGLKAEFDLYFPSSDQLR
                     GDIALAVADQALGLGIKINIIGATWDEIFIQGKANACLWGGGRLHPHQLYTMYSSQVI
                     NTGYNNMPSYINPTSDDYIKKALYASTQEEANQYWKLAQWDGKTGFSPLGDAPIVWLA
                     RVDHLYLVNDQVNIGNQLMHSHGYEFGLFGNITEWSINP"
     gene            101128..102105
                     /locus_tag="DSY_RS00550"
                     /old_locus_tag="DSY0097"
     CDS             101128..102105
                     /locus_tag="DSY_RS00550"
                     /old_locus_tag="DSY0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005815068.1"
                     /db_xref="GI:492341091"
                     /translation="MSQKILRRFLRMITLMLGLSILTFWLIHLSPIDPVNAYAISDTS
                     MSQEQLEKLKEYWGVNKSPVEQYFSWAGALLQGDFGMSKLYRVPVMDIIKSRAMTSFA
                     LMGTAWLLSGVFGYLLGAVAAMRRGKLLDRFIKWYSYILVSIPTFLLALILLLVFAVW
                     LGMFPIGLTKPIGLADADVTLADRLRHFILPALTLSLLGVANIAMHTREKMIDILNTE
                     YVTFARARGETAWQIFKNHGFRNSIIPAISIQFAYFSELFGGSVLAEQVFAYPGLGST
                     LTTAGLKGDLPLLLGIILIASLFVFIGNFIADILNTIVDPRIKRGELRC"
     gene            102099..102968
                     /locus_tag="DSY_RS00555"
                     /old_locus_tag="DSY0098"
     CDS             102099..102968
                     /locus_tag="DSY_RS00555"
                     /old_locus_tag="DSY0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_005815067.1"
                     /db_xref="GI:492341090"
                     /translation="MLEQLGRKEEVLLDPGKTGNVRKKIIWMIGFSTCLIGLILILSF
                     ILSNDNLRVNNASKNLMPSLQHLFGTDWLGRDMFTRTMKGLRLSLAVGIFATVISVTV
                     ATLLGTAAALFGKKVDELISWLIDLFIGMPHLIFMILICYIVGGGIRGIVIGVAMTHW
                     TSLARVVRAEVLQIKSAEYIQLSRSYGKSPWYIARRHVMPSVFPQIMIGAFLMFPHVI
                     LHEAALTFLGFGLSPQTPAVGIILSEAMSHLSTGQWWLILFPGILLILVAKSFDNIGE
                     QLRILLDPTSSNE"
     gene            102981..103793
                     /locus_tag="DSY_RS00560"
                     /old_locus_tag="DSY0099"
     CDS             102981..103793
                     /locus_tag="DSY_RS00560"
                     /old_locus_tag="DSY0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_005815064.1"
                     /db_xref="GI:492341087"
                     /translation="MLKAAQPLLKVENLSIGFSQYFRGTQKRVIQPIANLHVEIEEGE
                     IVAVVGASGSGKSLLAHAILGILPTNAICSGSMMYRGEELTKKRKEELRGREISFIPQ
                     SVNYLDPLMPVGKQVQIGLAKQRAQERQNRLFAHYGLKESDGRLYPHELSGGMLRRVL
                     FATSVREGVKLVIADEPTPGIHPQALAEILKQLQQFAREGAGVMLITHDIMSALAIAD
                     RVAVIKDGQTIELSPVSAFSGTGEQLQTDYARELWRALPQNDFACQELRWEA"
     gene            103793..104401
                     /locus_tag="DSY_RS00565"
                     /old_locus_tag="DSY0100"
     CDS             103793..104401
                     /locus_tag="DSY_RS00565"
                     /old_locus_tag="DSY0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter ATP-binding protein"
                     /protein_id="WP_005815062.1"
                     /db_xref="GI:492341085"
                     /translation="MALLGENLGVYYKKDQWIFKNMNIKVLPGQVLGLSGYSGCGKTT
                     LARVLAGYILPQTGRVSVDSKPLAPKSFRPVQLIYQHPEKAINPRWKMEDVLTETYTP
                     SQDILDAFGIREDWRKRWPIELSGGELQRFCIVRALNPQTRYIIADEMTTMLDAITQA
                     RIWHSFLHICQSRKIGVIVVSHELSLLNRLCDKVIQVGNTWE"
     gene            complement(104452..105762)
                     /locus_tag="DSY_RS00570"
                     /old_locus_tag="DSY0101"
     CDS             complement(104452..105762)
                     /locus_tag="DSY_RS00570"
                     /old_locus_tag="DSY0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011458888.1"
                     /db_xref="GI:499778154"
                     /translation="MNKAKREYKLSQTLMITAVLACLASALLFLGLQYLSRGIIYDYC
                     KKPEVISAHIEKKITSLRQYIKDNQISLSDLSELDNWMRGKELTEIVIYHDNTLIYSS
                     HTLSPSFSFPSQPKFPDFYLWHNKYILTFQEGTAEVFIKDFFEHRYIDYITYFNLLVF
                     FLCFITIMVFFIHKKVSYINTLEKEIRILEGGDLHYSITIKGNDELASLAQEIDEMRK
                     AFIAREDYAERVRAATNTLMAGVSHDLRTPLTALIGYLEVLEGEDIPAKESSFLGKCK
                     NRALQIKDLINHLFDYFFISTNDYKEIDLKHYPAQEVLREMIHEHIYLMEQSGFMVSS
                     TVDLPEGRIKVDAGMIQRIFDNMLSNVQKYADPAHPVRLYSTIDSGELVLVFENHSRH
                     SLEPTPKAGLGLNNCQKIMLLHQGRFMYRQNDHVFTIQLAFPLI"
     gene            complement(105755..106450)
                     /locus_tag="DSY_RS00575"
                     /old_locus_tag="DSY0102"
     CDS             complement(105755..106450)
                     /locus_tag="DSY_RS00575"
                     /old_locus_tag="DSY0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoB family transcriptional regulator"
                     /protein_id="WP_005815058.1"
                     /db_xref="GI:492341081"
                     /translation="MPENSTILVVDDDPEIREIIHILLQREGFAVQVAADADTALATL
                     TPGVDLAILDIMMPGKSGFELCSEIRKTTTIPILFLTAKNQDADKAEGFSCGGDDYLV
                     KPFSSIELISRVKALLRRYLIYQKQEPASKKEVRLGDLYIDLDTGTVARSGEKIALTS
                     MEYQVFRLLLLNRRKVFSAKEIYEHIWQEPFLPLSNNTIMVHIKNLRRKLEKDVGRPQ
                     YIRTVWGKGYYIE"
     gene            106631..107629
                     /locus_tag="DSY_RS00580"
                     /old_locus_tag="DSY0103"
     CDS             106631..107629
                     /locus_tag="DSY_RS00580"
                     /old_locus_tag="DSY0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011458890.1"
                     /db_xref="GI:499778156"
                     /translation="MKKLWSKILVGGLVLFLMAGCSQTQNSSSPNTNDKQTQSEKLSV
                     YTSFYPMYDFAAKIGGDKITPVNMVPAGMEPHDWEPSAADITGLEKADVFVYNGAGME
                     HWVEDVLESLQNKALIAVEASKDITLREGHHKHDHEDEHEDEGKEHEEEEEHGHEGAE
                     YDPHTWLSPLNAKKQMETIKDAFVQADPDNKDYYEANYVKYAADLDGLDKEFKDTLAP
                     LPKKDIIVSHEAFGYLCGAYGLNQIGIEGLAPDSEPDPARMAEVIEFAKEHEVKVIFF
                     EELVSPKVAETIAKATGAKTAVLSPIEGLSDEQQAAGDDYLAVMRQNLEALKAALQ"
     gene            107640..108383
                     /locus_tag="DSY_RS00585"
                     /old_locus_tag="DSY0104"
     CDS             107640..108383
                     /locus_tag="DSY_RS00585"
                     /old_locus_tag="DSY0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_005815055.1"
                     /db_xref="GI:492341078"
                     /translation="MSNIIEVDDLGFSYGNEPVFSKIGFSVYKGDFAAIIGANGAGKS
                     TLLRLILGELVPNAGSVRLFGQDSRRFRNWPKIGYVPQAGQHSNANFPATAEEIVRAN
                     LFSQIGLLRFPGKEHRDKVQRALELVGMEGYAKRMIGELSGGQQQRIMLARVLAGDPE
                     IMILDEPTTGVDAQTVQSLYELLARLNQENGLTIVMVTHDISRAAKYVSRILCLEEGS
                     LVEHKHKHPGQELAKEGKGNDECDCHSGI"
     gene            108355..109188
                     /locus_tag="DSY_RS00590"
                     /old_locus_tag="DSY0105"
     CDS             108355..109188
                     /locus_tag="DSY_RS00590"
                     /old_locus_tag="DSY0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_005815052.1"
                     /db_xref="GI:492341075"
                     /translation="MSVIAILEYDFMRRAFIVGILLAVIIPCIGIIVVLKRLSMIGDA
                     LSHTSLAGVAAGLIMGINPILGAVTACIAAALGIEFIRKKIPKFSEMSIAIVMSAGIG
                     LAGVLSGHVKNAANFNSFLFGSIVSISDFEMILVAGISCIVMLAFILLYKELFYIALD
                     ERAARLSGVPVGVINFIFTILTAVTVSVAARTVGALIVSSMMVVPVACAMQVGKSYRQ
                     TVIYGIIFAVVFTVTGLFLSYYLKLKPGGTIVLLGVLCLVVMLLIKQINSMLRRTVFK
                     M"
     gene            109217..109648
                     /locus_tag="DSY_RS00595"
                     /old_locus_tag="DSY0106"
     CDS             109217..109648
                     /locus_tag="DSY_RS00595"
                     /old_locus_tag="DSY0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011458892.1"
                     /db_xref="GI:499778158"
                     /translation="MKEVTIVKEVNNNWPAGIKRTKPRESVLSVLEHAPKPLSAAEIC
                     SEIEKEGESPWLSTIYRILELFVKKGVVVKLAVLNNEMALYELNRFQHKHYAICLGCH
                     KIVTMNNCPMEKFIPKIEDDDFRVLGHNLEVYGYCRECSVK"
     gene            109735..110772
                     /locus_tag="DSY_RS00600"
                     /old_locus_tag="DSY0107"
     CDS             109735..110772
                     /locus_tag="DSY_RS00600"
                     /old_locus_tag="DSY0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815048.1"
                     /db_xref="GI:492341071"
                     /translation="MGTEIYIISGFLGVGKTTLIQKMLKEAFQGEKVVLIENDFGEIS
                     VDAALLKSGGVEVKEISAGCICCSLSGDFVKALKDLLLRFHPDKIIIEPSGVGKLSDV
                     MKACSDPRIVLHAKVKGKITVVDVKRCQMHLDNFGEFFEDQIRNADVVVFSRSESFPA
                     KLGDGEKIVKKLNPQGRVLTKPWAQINTAELLNPQRQQHRLPGRCRHGHDEHNHDHRD
                     HHSHDHNHHDHDHDHAHHSHDHAADCSHQEGCEHNSRAEDVFDTVTIRTKRVFDTEEL
                     KAKVVKMEDSAKGTILRAKGIVRGPKGYLNLQYLPGDIRITGCHARGDMLCIIGRNLN
                     RQELCAIFSGE"
     gene            110777..112351
                     /locus_tag="DSY_RS00605"
     CDS             110777..112351
                     /locus_tag="DSY_RS00605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_005815046.1"
                     /db_xref="GI:492341069"
                     /translation="MAIPVYVVTGFLDAGKTTFLNNLLNKYSWRDVRAFVIQFESGEE
                     EFQGRHLNCYKLSVPKKILEQRPEQIVERICSSIEEQPFDEIWIEWNGVVPFSELQSL
                     LLHPSLRGLCQIQKVVHIADGENIENLLGRTGASLPEQIANSDFVVMRNVDSAVTYRR
                     IRRLVNGLNPGVPLYKVKEYQELYKQLFGKKEHPVNLFLLMVIAMSALYFMAKPVLEG
                     AQIPVNTIVNVFLGIILQAVPFLLIGVLLSSAIQVFIPQSFIERRFPKSIGMGMLVAI
                     LGGFCLPVCDCASIPVFRSLVRRGIPLPVAVTFMTATPVINPVVIVSTYYAFSGNTGI
                     VVGRIFFGIVAAVLIGLTMGFWPPKGSVLAGGAFDRLLCSCGCYDDVESITTFKGKAG
                     LFIRHSQAEFFGVGKYLVMGSFIAALFQVMGTGLFTKAQDGAGLAVSILIMMVMAFVL
                     SLCSSSDAIIARSLANQFPMGAIMGFLVFGPMMDIKNVLMLSSGFSKAFIVRLLLTSL
                     SICFVLVFLFFNWGGM"
     gene            112353..113216
                     /locus_tag="DSY_RS00610"
                     /old_locus_tag="DSY0109"
     CDS             112353..113216
                     /locus_tag="DSY_RS00610"
                     /old_locus_tag="DSY0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942544.1"
                     /db_xref="GI:506422825"
                     /translation="MPAKAFNPQIFLEFLCYCVFGGLIFYLVSSEKYLTYVTPRLKPY
                     LYFTSIVMGVWALTALGRLFRPQHKLRSAHCFVLVIPIVLLLLPHAPVSASNLSGNYI
                     GGSAFSNRSGQSALSMQNDLSITIEDASSPEDKVQAEIIQEPLAGLPAGAYVSELPGL
                     DMGNKRITVAHEDFSMWLTEMYTNIEKYQGYTVVMTGFVFNDPEFLKEDEFVPARLMM
                     SCCVGDLAPAGILCKYDQADQLQAESWVTVEGTLTLGQHEYDGVLSDEPQIRVTKITP
                     AEAVEGYIYPY"
     gene            113324..113494
                     /locus_tag="DSY_RS00615"
                     /old_locus_tag="DSY0110"
     CDS             113324..113494
                     /locus_tag="DSY_RS00615"
                     /old_locus_tag="DSY0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein Spo0E"
                     /protein_id="WP_011458895.1"
                     /db_xref="GI:499778161"
                     /translation="MEKRLLKKIEVLRKKLYRYATTRSLVDARVVELSQELDYLLNQY
                     QRLNKYTQLSFW"
     gene            113585..113674
                     /locus_tag="DSY_RS00620"
                     /old_locus_tag="DSY_tRNA4-Ser"
     tRNA            113585..113674
                     /locus_tag="DSY_RS00620"
                     /old_locus_tag="DSY_tRNA4-Ser"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:113619..113621,aa:Ser,seq:gga)
     gene            114134..115807
                     /locus_tag="DSY_RS00625"
                     /old_locus_tag="DSY0111"
     CDS             114134..115807
                     /locus_tag="DSY_RS00625"
                     /old_locus_tag="DSY0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_011458896.1"
                     /db_xref="GI:499778162"
                     /translation="MAYLALYREWRPKNFKDMVGQDHVTKTLTNALMQSKVAHAYLFS
                     GPRGTGKTTTAKVLAKALNCEHREGVEPCNQCAFCLSIDQGSAMEVFEIDAASNRGID
                     EIRDLRDKVRLSAGESKYKVYIIDEVHMLTTEAFNALLKTLEEPPERVVFILATTEVH
                     KIPLTILSRVQRFEFHRIPLEQIHSHLDKVCQTIGRDVEPEALQIIAQKSEGGLRDAL
                     SILDQCLLLDGKLGVEQVYQVLGMVGEEFSAQLVDHLLTGDYAKALGCLGEGINQGMD
                     PRQIIRELLDYMRQALLYASTQAFPQVAPHLREHLAYQCQMLGLKTLLQWIGILLQGE
                     SQLKYAANARLAAELLLVQVIYNSQPGYSKESPQVLERLQELEEEIKNLSSGKSRQES
                     KAEPVKKVKESREGGSEPPGHKKPELPSLQDKPVISQGGETSALSIEQVQGRWGDILE
                     QVRKRKKSTHAFLMEGKPVELDGDSLVIVFKEGLSFHRDKVNQKENRETIEEVLQSSL
                     GKAYRLQSLLENEYGKDPKDSEQVEKAKENPMIKKAADLFGADLLIVEE"
     gene            115830..116162
                     /locus_tag="DSY_RS00630"
                     /old_locus_tag="DSY0112"
     CDS             115830..116162
                     /locus_tag="DSY_RS00630"
                     /old_locus_tag="DSY0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815036.1"
                     /db_xref="GI:492341059"
                     /translation="MAFKGGGMGNMGNMLKQAQKLQEEMAKAQEELKTRTVEASVGGG
                     AVQVVVNGKNELVELKIKPEAVDPDDVEMLEDLVKAAVNEGLRKVEELVSSEMGKLTN
                     GLKIPGLF"
     gene            116173..116769
                     /locus_tag="DSY_RS00635"
                     /old_locus_tag="DSY0113"
     CDS             116173..116769
                     /locus_tag="DSY_RS00635"
                     /old_locus_tag="DSY0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8FY16.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="WP_011458897.1"
                     /db_xref="GI:499778163"
                     /translation="MDFLNYPEPLADLITGLSRLPGIGPKTAGRLAFYLLQQPQVAEN
                     LAETMIRAQREIRQCSLCCNYTDHDPCPICTGEKRERTLLCIVEQPRDVVSLEKTREF
                     KGLYHVLHGVISPLEGVGPEQLTISKLLGRLEGVQEVVMAMNPTVEGEATALYLSRLL
                     KPLGIKVTRIAHGLPVGGDLEYADEITIARALEGRRQI"
     gene            116859..117113
                     /locus_tag="DSY_RS00640"
                     /old_locus_tag="DSY0114"
     CDS             116859..117113
                     /locus_tag="DSY_RS00640"
                     /old_locus_tag="DSY0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815033.1"
                     /db_xref="GI:492341056"
                     /translation="MTLIFLALFVLLIGLVVKSSLGQPNTFLKAGIHILGGIVGLWIF
                     DLILSVVGFGIPINVFTITLVGLLGFPGVVALVGLQVLGI"
     gene            117490..121020
                     /locus_tag="DSY_RS00645"
                     /old_locus_tag="DSY0115"
     CDS             117490..121020
                     /locus_tag="DSY_RS00645"
                     /old_locus_tag="DSY0115"
                     /EC_number="1.2.7.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate ferredoxin oxidoreductase"
                     /protein_id="WP_011458899.1"
                     /db_xref="GI:499778165"
                     /translation="MAKMKTMDGNEAAALASYAFTEVATIFPITPSSTMAELVDEWAA
                     HNKKNIFGQPVKVVEMQSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGE
                     LLPSVFHVSARALATHALSIFGDHQDVMSVRATGFAQLSSHNVQEALDLGFIAHLATI
                     KAKVPFVHFFDGFRTSHEIQKIEVTDYDDVAKLLDRDALQAFRDNALNPERPVLRGTA
                     QNPDVYFQGREVSNRYYDAVPDIVAHYMDEYAKITGREYQPFQYYGAEDAERVIIAMG
                     SVCDTIEETVDYLVAKGEKVGVVKVHLFRPFSTKYLFKVLPKTVKAIAVLDRTKEPGS
                     TGEPLYLDVKDSFFNHEIKPVIVGGRYGLGSKDTTPSQVLAVYKNLAQAEPKNDFTIG
                     IVDDVTFKSLPEDEVVSTAPEGTIACKFWGLGSDGTVGANKQAIKIIGDHTTMYAQAY
                     FQYDSKKSGGITISHVRFGKKPIKSPYYVSDANYVACHNQAYVGQYDLTKGLKKGGTF
                     VLNCQWQPEELADKLPASMKQFIAKNDIKLYIIDAVSIAREIGLGSRINMVMQSAFFK
                     LANVIPVEEALGYLKESVVKTYGKKGQNIVDMNNAAIDRGADSLVKVEVPASWADAAP
                     AQAEAAAAADLPEYVAKIQNVMNAQEGDSLPVSAFVGREDGTVPVGTTAYEKRGIAVI
                     VPEWDVEKCIQCNQCSYVCPHAAIRPFLLNEEEVANAPEGFVTKKALGKEADGLQLRV
                     QVSPLDCTGCGNCAEVCPAKGKALVMKDAAEQTAAQAGNWEYALTVTNKAERFDITTV
                     KGSQFAQPLLEFNGACPGCGETAYVKLLTQLYGDRMMIANATGCSSIWGGSAPSVPYT
                     VNAKGQGPTWANSLFEDNAEFGYGMYLGVRQQREKLALLMEEACATEISADMKEAFQE
                     WIAGMDDADASKAAAAKVRAALDVYEGDSALIADIKGRKDHLVKKSQWIVGGDGWAYD
                     IGYGGLDHVLASGDDVNILVMDTEVYSNTGGQSSKATPRAAVAKFAAAGKKIRKKDLG
                     MMAMSYGYIYVAQVALGANMAQTIKAMKEAEAYKGPSIIIAYAPCINHGLKSGMSKSV
                     TEAKKAVEAGYWHLYRFNPDLEDQGKNPFTLDSKEPTASFRDFLMGEVRYTSLINTFP
                     ESAEELFEGAEKYAKVRLDSYKRLASYKYE"
     gene            121195..122547
                     /locus_tag="DSY_RS00650"
                     /old_locus_tag="DSY0116"
     CDS             121195..122547
                     /locus_tag="DSY_RS00650"
                     /old_locus_tag="DSY0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_035214414.1"
                     /db_xref="GI:737230081"
                     /translation="MERIIMQDLLRWKNSKHRKPLILKGVRQVGKTWLLKEFARRYYN
                     NLAYFNFDEHPEYKQFFENTKDVERILQNLMMAGGQIINPKEPGTTLIVFDEIQECPN
                     ALNTLKYFCENTPHYHVACAGSLLGIALSKPASFPVGKVDFLEIGPMTFTEFLLANGD
                     GNFVSYLDNLDRIEPIPDAFFNPLYEKLKMYFVTGGMPESVRSWTEERDVELVQQVLA
                     NILGAYERDFAKHPDPKDFPKISLIWKSLPSQLARENKKFIYKVVKEGARAREYEEAL
                     QWLCDASLAYKIYRSSAPGLPFSAYDDLAAFKLYLVDVGLLRRLSLLAPSAFGEGNRL
                     FVEFKGALSENYVLQALRNQLEAMPRYWTMDNPRHEVDFLIQRENEIIPVEVKSETNV
                     ESRSLKKFKEKYGDKVKLRVRFSLNNLRLDGDLLNIPLFITDYADKLIGMALTGQPKE
                     "
     gene            122613..123095
                     /locus_tag="DSY_RS00655"
                     /old_locus_tag="DSY0117"
     CDS             122613..123095
                     /locus_tag="DSY_RS00655"
                     /old_locus_tag="DSY0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B"
                     /protein_id="WP_005815025.1"
                     /db_xref="GI:492341044"
                     /translation="MDMDQEDLIRRLNWFYSLEMNQVELYKVQSKQFKDHYAGQVFER
                     VAAIEQSHVDNVAARITSLGAKPTLLGEVVSPILGMSLGNLMSLTGLERALQLNMELE
                     RKAMSDYKKLIEDLVAGGEDPGGDLCSQLKDNFVDEHLHTALFDTLRENLMEDKIETL
                     "
     gene            123293..124864
                     /locus_tag="DSY_RS00660"
                     /old_locus_tag="DSY0118"
     CDS             123293..124864
                     /locus_tag="DSY_RS00660"
                     /old_locus_tag="DSY0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore gernimation protein GerA"
                     /protein_id="WP_035214413.1"
                     /db_xref="GI:737230080"
                     /translation="MAKRFFTMIKELTQRPYRKRIRVVHKVPIDQEWDKPVSFARIKE
                     ELSKSSDIIFRDFILRGKEDIPCSLGMVDGLVDKDLLDAYILRVIMVEAVDDPVFQEM
                     TLKNVNDRLLDLFTPANEVKKIGRLGEAIDGMLSGDAVLFIKESQEALVISARGWSDR
                     GVGVPQNESSIRGPKEGFNETLRTNTSLLRRKIKHPSLRLVSMKIGDLSKTDVVIAYV
                     ETIADMDVVGEVLKRLSRIRTDAVISGDMLEELIEDHPYSPFPQVSNTERPDIVAADL
                     LEGRVAIMVDGTPSALIVPVTLPTFMQVNDDYYQRAMIVIIVRTIRYWGAAIALLAPS
                     LYIAVTTFHQELLPTPLVLSLAANREAVPFSALGEALLMLLALEILQEGGLRLPKPIG
                     QTIGIVGALIIGEAAVSAGLISPIMVIVIGLTAVSGYTIPYYDLAIAIRLIRLPLMIL
                     AGTMGFFGLAIGLYLSIIHLLALRSFGTPYLSPIAPLRIRAFFQDTFVRAPWWASRKI
                     PDLVDVHDTKSGRKK"
     gene            124865..125977
                     /locus_tag="DSY_RS00665"
                     /old_locus_tag="DSY0119"
     CDS             124865..125977
                     /locus_tag="DSY_RS00665"
                     /old_locus_tag="DSY0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="WP_005815022.1"
                     /db_xref="GI:492341039"
                     /translation="MERISTHQFTILSTAVLLGTTYMVAGSALAGTAGRDGWMAILPG
                     FALGIPLAFMIFSLMPRYPGMNLIEISEKVLGKWLGKGMGLLYSAITLYFGAILLGQG
                     VDMYNRSVLPLMPQYILVLGLFVIVVYLYFSGIEVLSRFSEVVFPIIFLSLVFIALFS
                     IPRFERGELFPMLDNGIRPLLKAMSNVAPWPMEYILFLGGLLPFLPRKAKDLKVLKKG
                     VFKAFFMVIALSTLMVVIQIMTFGPFETSRLTYALLVLGNMVEISRTISGVEVIFTLI
                     WTGALALKVTALLFAGIWGLRTVFGIKSRKASVRTGVVVGIIYVLIPLYTLTGITVVV
                     EIQLVDQYLILPFTMVWVVLIWGVERWKRRKKSFSH"
     gene            125944..127185
                     /locus_tag="DSY_RS00670"
                     /old_locus_tag="DSY0120"
     CDS             125944..127185
                     /locus_tag="DSY_RS00670"
                     /old_locus_tag="DSY0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458901.1"
                     /db_xref="GI:499778167"
                     /translation="METPQKKFFPLRLTLVLLLIMGVLLLGGCGGKREIDELAYMLGI
                     GIDQGKEEGTYLVTMQIAEPKTSGGGAAELENWTISMETKSISTIMEQAAEAFSKQPF
                     AGTVRVIVLGEDLAGAGINEALDYFQRFYEFRRTIYLLVAKGQAKDIMEAELRTKQIP
                     SLNLFDTIEGQSRQSVFPITRLGHYLTVLGRESQNPIIPRVEKIQPGEHGLFYSDKEG
                     EEMLIHESAVFEGGKCVAKLNDQETKGYLWLDNEIESRVLEGEDGDGVTVTAWVLNSK
                     TKYKVENIDGKMGIKFNIKTTVSINEILGKGEQADIYRWQQFIKELQPLMAQAIQEEC
                     EAAVAKSKEQGLDFIGIGRKIEIKNPKYWREIKENWPQGIKDIPVAYDINVKIEHSGL
                     ARNSPVSPQENGAKGGSHTLQ"
     gene            127229..128671
                     /locus_tag="DSY_RS00675"
                     /old_locus_tag="DSY0121"
     CDS             127229..128671
                     /locus_tag="DSY_RS00675"
                     /old_locus_tag="DSY0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Orn/Lys/Arg decarboxylase, major domain protein"
                     /protein_id="WP_005815018.1"
                     /db_xref="GI:492341033"
                     /translation="MSILEEENVLNLGHKLLQYEAQKLISFHTPGHKGKAEFFTDLHF
                     PDQDLTELPGLDMLHSPAGVIAQAQARAAAVYQSDASFYLINGATVGNQGMFMALAGT
                     GKRGKDLQLPKVLVERQSHRSVFSALVLSGCEPEYIPSVVHPEFGLPLGLKSIAEVDL
                     GEFLGVHLTYPGYYGTLPDLAMIAAQRDRQAVQVSILVDQAHGSHYLSPLFPKGALAY
                     GADLVLCSTHKTLSALTQAAMLHVQGSRIPLSALKEALELLQSSSPSYLLMASLERAV
                     EHALESRRWELLHEAVQELHHRVGGSLRILNPQDVGTYGIAGLDWTKIMINTQRLGVA
                     APRCVEHLRKSYGIDPELWDDKNILFLLGIGNTPEEVEILTKGLLSLASLNKDVVASP
                     EEMVFEIPLPPVRLTPRQAYFARKRKIPLAESVGHIVGESISPYPPGIPWIVMGEEMT
                     PEILELLTRHKGRWQGWEDAGQGVWIIEEV"
     gene            128673..129521
                     /locus_tag="DSY_RS00680"
                     /old_locus_tag="DSY0122"
     CDS             128673..129521
                     /locus_tag="DSY_RS00680"
                     /old_locus_tag="DSY0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_035214412.1"
                     /db_xref="GI:737230079"
                     /translation="MNIALHLIEKAAQEGRLAHLLLFHGGSGPERRKAGLEIARRINC
                     TSGQDAPCGHCPSCKKILSGNHPDVEVVKPAKASIGIEQILDWQERVYRKHYEGNYKV
                     FILEEADKLTIPAANALLKVIEEPPERTLIVLSAQNAEVLLPTIQSRAQAVYFPFRGE
                     EEWLKSLEESLDPWEAREAFRLSSHNPELAYEILTLGVEKVKEWVRGFEQAVEEGDFL
                     KLFPLFPVEKKEAELYLHILALGTAQKHQVNPQAMLAVGKAIEQIQMQANPRLVIEGL
                     ALKLFQ"
     gene            129535..130383
                     /locus_tag="DSY_RS00685"
                     /old_locus_tag="DSY0123"
     CDS             129535..130383
                     /locus_tag="DSY_RS00685"
                     /old_locus_tag="DSY0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815014.1"
                     /db_xref="GI:492341027"
                     /translation="MVEVVGVRFKRAGKIYYFSTGDLALNANDKVIVETARGVEYGEC
                     VLAPRQVPEADVVMPLKPVIRKATPEDERIVEVNRTKEKEAFDICLKKIGDHQLPMKL
                     VDVEYTFDGNKIIFSFTAEGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGS
                     CGRVLCCSSFLGDFEPVSIRMAKDQKLSLNPTKISGICGRLMCCLKYENGAYDESHCK
                     GQCGKQCHQREEDILVLSEESVLKALEEQELKGERGSAVPTAGKGRQEGRHKKGEKNR
                     GKSEKV"
     gene            130380..130691
                     /locus_tag="DSY_RS00690"
                     /old_locus_tag="DSY0124"
     CDS             130380..130691
                     /locus_tag="DSY_RS00690"
                     /old_locus_tag="DSY0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005815013.1"
                     /db_xref="GI:492341025"
                     /translation="MSQLTQALTEVEEKLNSLIEEVQRLLPYVKSLEDENARLKRELC
                     ALPEKERSRVIANAEHLQGVAHDNLERLYREGFHVCHLHFGQPLEEGDCLFCMGFLRK
                     D"
     gene            130697..131557
                     /locus_tag="DSY_RS00695"
                     /old_locus_tag="DSY0125"
     CDS             130697..131557
                     /locus_tag="DSY_RS00695"
                     /old_locus_tag="DSY0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_005815011.1"
                     /db_xref="GI:492341022"
                     /translation="MGAVLLATVQRGTLYICGTPIGNLGDITLRALEVLKGVDLIAAE
                     DTRHSRKLLDHFGIATPLTSYHEHNEKGKALELVRRLEQGEAIALISDAGMPGISDPG
                     QEVIQLCLEKGIPLDVLPGANAGLTALLLSGMPNDHFLFHGFLPSQSGARKKELQNYA
                     QLPFTQIFYEAPHRLVATLEDLWEVFGERETAVVREITKLHQSVHKGTLSTLIHEFKD
                     TAPRGEICVLTSPYIPVPPTGGEKEWRQEVQELTEQGMKPNDAMKVVAQKYGVSKREV
                     YQAVLSQKKN"
     gene            complement(131690..131959)
                     /locus_tag="DSY_RS00700"
                     /old_locus_tag="DSY0126"
     CDS             complement(131690..131959)
                     /locus_tag="DSY_RS00700"
                     /old_locus_tag="DSY0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_005815009.1"
                     /db_xref="GI:492341019"
                     /translation="MKSTGIVRKVDELGRVVLPIELRRTLGIDEKDALEIYVDQEKII
                     LKKYEPACVFCNNATDVQIFRGKNVCRECATAMGEAASGNQPEAV"
     gene            complement(132659..132856)
                     /locus_tag="DSY_RS00705"
     CDS             complement(132659..132856)
                     /locus_tag="DSY_RS00705"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272185.1"
                     /db_xref="GI:752602798"
                     /translation="MRLVLVINSIIREGVLQTGLGEKVSARGLSRKAILQDFDLHRSL
                     HKLRGQNYRSSPPLRKVHLRR"
     gene            132905..134848
                     /locus_tag="DSY_RS00710"
                     /old_locus_tag="DSY0128"
     CDS             132905..134848
                     /locus_tag="DSY_RS00710"
                     /old_locus_tag="DSY0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA synthetase"
                     /protein_id="WP_011458904.1"
                     /db_xref="GI:499778170"
                     /translation="MKYYITTPIFYPNASPHIGTAYTTVAADAFARYHRLKGHDVYFL
                     TGTDENAQKIVRTAESQGMEPLAYVDGVVERFKALWEELDISYDDFIRTTEERHHEVV
                     KKIFTKLYEQGDIYKSEYEGWYCTPCETFWTENKLIDGKCPNPDCGRDVELLKEESYF
                     FKLSKYQDALLRHIKDHPDFIQPASRRNEMIKFIEGGLEDLCVSRTTFQWGIQVPFNP
                     KHVVYVWLDALINYISALGYPDGELYQRYWPAEVHLMGKDIVRFHAVIWPIILMALDV
                     PLPKVVYGHGWYLSKEGGKISKSRGNVQDSFKLIRRYGSDAIRYFLLREMQVGTDGAY
                     SEDSLVERLNSDLANDLGNFVSRSLAMIVKYRGGVIPKAGEPTELEAELRALGQEVVA
                     KVEERLEAHDPAGALENLWRLVSRMNKYVDETAPWTLAKQEGQQERLDTVLHTFAEAI
                     RVLGILCAPFMPKLTGKMFRQCGISDELLAWEAAKEWDVLGEGIQVQRGEALFPRIDL
                     AQFSIEEEKASVNEIKETPAVEENKVEFEPIKEEISIDDFAKIDLRVAKVLHAEKVEK
                     TDKLLKLEIEVAGKPRTIVSGIAQHYAPEDLVGKHVVIVANLKPAKLRGITSEGMILA
                     ASHEGVLEVLVLDKELPAGARVK"
     gene            134845..135606
                     /locus_tag="DSY_RS00715"
                     /old_locus_tag="DSY0129"
     CDS             134845..135606
                     /locus_tag="DSY_RS00715"
                     /old_locus_tag="DSY0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase TatD"
                     /protein_id="WP_005815002.1"
                     /db_xref="GI:492341008"
                     /translation="MIWDTHAHLDDPRYQGDFQGVLDNMARAHITRVTNVGYDLPSSE
                     RSVRLAHQYDAVYAAVGVHPHDAQGAAEETWESLTQLAREDKVIAWGEIGLDYYRDLS
                     PRKIQQEVFIRQIELADQAGLPIIIHNRDAHQDLLEIVKAHTPKKGGVFHCYSGSWEM
                     AKLILNLGFYISFAGPLTFKNARHTVEVAEKVPLDRFLVETDSPYLTPEPYRGKRNEP
                     AYVRQVVERFATIRGLEVEEAARLAFENGNRLFGL"
     gene            135824..136672
                     /locus_tag="DSY_RS00720"
                     /old_locus_tag="DSY0130"
     CDS             135824..136672
                     /locus_tag="DSY_RS00720"
                     /old_locus_tag="DSY0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458905.1"
                     /db_xref="GI:499778171"
                     /translation="MYSLPIATYTDYWRLAKNRSLTMGGTLVLAGSTLLYAPADAFPK
                     RMELTLPVFERNSQSPASAPGSQALGREETLLNPEGTALPLAEGIGAAEGVGVEIGQI
                     AMTYRIEDVEIPINTEYIESDRVLPGTSQVQEEGQVGIERQVIRRTTIGGELSDEQIV
                     NQFFLNAPKKRVVIQNTRPVERSDVDLSQYTVLKTFEVEATAYTYTGNPTATGVWPRE
                     GLIAVDPRVIPLGTEVYVEGYGHAIAADTGGAIKGNIIDVFFPSLQRCIQWGRRPVVI
                     HILDNK"
     gene            136766..137935
                     /locus_tag="DSY_RS00725"
                     /old_locus_tag="DSY0131"
     CDS             136766..137935
                     /locus_tag="DSY_RS00725"
                     /old_locus_tag="DSY0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814996.1"
                     /db_xref="GI:492340997"
                     /translation="MLEKTRTSVFSLVRSSRKAQISVTLLTVAFIVASVFLLKAKTVT
                     VEIDGGKQSLTTLYSTVGAALEHSRLGIYPEDIVEPNRETDIAKGLEIKITRSLPVEL
                     TVDGETYPARTPAPTVGEALVDLSNRLGLDLKVTDEVNLHREAVLVADAKLEVRRAVP
                     VKVKVDGKEIDTYLAPRTVEEALEKLDIVLNEKDKVSLPMKHMIEAEDEIQVVRVEEK
                     IETMTNEIPYQTVAQPADFPIGLPDKVVTKGVNGQHEQTVKITMEDGIEVAREVLQQE
                     VLRAPVNQVVSRGSQTTISRGGKTIEFKRAYLMRASAYSGGGRTATGHNVRYGVIAVD
                     PRVIPLGTEVYVDGYGEAVALDTGGAIKGNRVDLYMNTEESCWSWGVRSVVVYVK"
     gene            138147..138863
                     /locus_tag="DSY_RS00730"
                     /old_locus_tag="DSY0132"
     CDS             138147..138863
                     /locus_tag="DSY_RS00730"
                     /old_locus_tag="DSY0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011458906.1"
                     /db_xref="GI:499778172"
                     /translation="MRRPIVIPGRQTQGMAIIIVLTVMFGLVLSVFYQGSAAVLGPLE
                     TKYKVVVDAGHGGYDPGAITKQGVYEKEINLEMAKRVKELLEPAGIEVILTREEDIDY
                     VPEGVRGRQSKKQADLNHRISLAAEAEADTLISLHLNATPSGRNTGAETFYYFDSEEG
                     KRLAETIQQELIKVPGMNRRIAKPGDFYLIKNAPMPAVIVELGYISNPKEFARLRQSW
                     YQDQLAQAVAKGVANYFGLP"
     gene            139085..140239
                     /locus_tag="DSY_RS00735"
                     /old_locus_tag="DSY0133"
     CDS             139085..140239
                     /locus_tag="DSY_RS00735"
                     /old_locus_tag="DSY0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase, family 18"
                     /protein_id="WP_005814992.1"
                     /db_xref="GI:492340990"
                     /translation="MKRFLTLNLIAVLVLSFSLVGCNTAQQQNTQAPNQIATESGEPP
                     KAEAETRQDVLGEEKRVVMGFYTDPEGEIPGSKESMMKNIKLMDEVSFFWYSFDANGK
                     ILTTGKKDLSIKEAAQKNGAKAYALIHNMRGGLFDANLAHSVFANPQTRSKFINNIVQ
                     LVINEKWDGVAIDIEKTPPADRNNFTAFLGELHGALKAKDKVLNVSIPAKFIDYPSDL
                     WSGAYDYASIGKNADQIVLMTYDEHGLGTTHGPISSHAWVNKVISYAVTKIPREKIVL
                     GLPVYSFDWGSNKPTMPDYLSYEQSMARAKKHGVEVGYDEEHKVPWYTYTANGVRHEV
                     YFENKQSLQPKMEYAREHKLHGVAIWRLGMEDPSIWDSLVKTYGTNKNKK"
     gene            140384..140992
                     /locus_tag="DSY_RS00740"
                     /old_locus_tag="DSY0134"
     CDS             140384..140992
                     /locus_tag="DSY_RS00740"
                     /old_locus_tag="DSY0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease M5"
                     /protein_id="WP_005814991.1"
                     /db_xref="GI:492340988"
                     /translation="MIEELIVVEGKNDAHAVRRALGNVDILWTEGYGLTQEKLAYIAE
                     AAKRCGVIVLTDPDSVGEQIRERIRRQVPEAKHVYLSKKDARSPKDDDIGVENASPED
                     IQKAFQKIRTDTLYSEPKNNEYPTAGTSFTMKDLLEAGLAGLSHSAERRLAVGKILGI
                     GDANAKQFLRRLNRFGITHEEFNKAVREAIHGERSELYPAHP"
     gene            140955..141791
                     /locus_tag="DSY_RS00745"
                     /old_locus_tag="DSY0135"
     CDS             140955..141791
                     /locus_tag="DSY_RS00745"
                     /old_locus_tag="DSY0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase A"
                     /protein_id="WP_005814989.1"
                     /db_xref="GI:492340985"
                     /translation="MENAANYTRRILKGGAKAHKSLGQNFLMDDRVIEAIAAASIKDP
                     EIPVVEIGPGLGVLTRVLAQKAQKVWAVELDRGKVNLLQRELQGLPVDILNMDALKLD
                     LKDIWGTGKGVLVGNLPYYITSPLLMHFLEQKDSLASMVVMVQKEVADRLVAKPGGKD
                     YGILSIAAQVSAQGEKLFEVPPQAFWPAPKVTSAVVRFELRSYPGFRVKEKDFFRVVK
                     AAFSQRRKTLGNSLAGGLGLPKQQIGEILAAAGVDEQRRAETLSIDEFQAVTEAVMKN
                     LD"
     gene            141907..142254
                     /locus_tag="DSY_RS00750"
                     /old_locus_tag="DSY0136"
     CDS             141907..142254
                     /locus_tag="DSY_RS00750"
                     /old_locus_tag="DSY0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814987.1"
                     /db_xref="GI:492340982"
                     /translation="MVKKYNYRPGREKKSRTIKKVQHRHPSEYLNDLEEWQRYQYDPG
                     HYLGGNIHPQLKYASGTKAGKYFAALCLMLGVISGIGTVFTFIEGVGNILALLMTLLF
                     ISVGLTCFGGSKE"
     gene            142329..142730
                     /locus_tag="DSY_RS00755"
     CDS             142329..142730
                     /locus_tag="DSY_RS00755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814985.1"
                     /db_xref="GI:492340979"
                     /translation="MEEELLRQILTQLQGLTSEVQGVKDEIQDLQGLKGEVQGLTGEM
                     QGLKGEVQGLKSDVQGLKSDVQGLKSEVQAIKDSQERMESDLSILQYDVGNLKRDVKD
                     IKRDLGHVWTDIKHFDNRLAAQKEKVDKLIK"
     gene            complement(142812..144383)
                     /locus_tag="DSY_RS00760"
                     /old_locus_tag="DSY0138"
     CDS             complement(142812..144383)
                     /locus_tag="DSY_RS00760"
                     /old_locus_tag="DSY0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="WP_015942559.1"
                     /db_xref="GI:506422840"
                     /translation="MENRFKQSLLDPNTLSVTWELVPGRGAREKAQESALLAAEQAAK
                     GGKVHALTITDNPGGNPAILADYLGQEILKLGIEPLVHFTCKDKNRNQMESQLYALDR
                     AEVRSLLVMTGDYTVSGFKGRPKPVFDLDPTHTLELIAQMNEGLGIPGPKGMSYHQPS
                     DFFAGAAVSPFKGTEAEQMVQYYKLKKKVTSGAQFIVTQLGYDARKIHEVLQFMKLND
                     LNVPLVGNIYILPFGAAKIMNQNQLPGCVVTDKLLAEIDKERTAEDKGVSARLLRAAK
                     MYALMKGMGFAGVHIGGHNIKYEQVEYVIEKGEELSKDWLALVPEFDYPMPNGFYYYE
                     KDPKTGLNTTTPVNRKNLPLDAPVGVAYSGMRLMHSMLFTPGKNFFPVMRKIYKGRKD
                     NRKHGLEHLAKVITNDCKDCGDCAMFELAYLCPMSQCPKNQRNGACGGSYQGWCEVYP
                     NQKQCIYVRAYARLKKYDEEGDLDSHHIPPANWDLYQTSSWSNFFLGRDHSGKILGIP
                     TPEEEAKAKGADPAK"
     gene            144824..146590
                     /locus_tag="DSY_RS00765"
                     /old_locus_tag="DSY0139"
     CDS             144824..146590
                     /locus_tag="DSY_RS00765"
                     /old_locus_tag="DSY0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_015942560.1"
                     /db_xref="GI:506422841"
                     /translation="MKSIRTRLILVFLLTSIMMAGIVGGFNIYNQTVLTQNNVDEYRK
                     TLYEEYDRGLKMNVEIAISIIQGVYREQQEGLLTEAEAREKAAALVRTILFDQGNYIW
                     VDTVEGINVVYLGKDSEGKSRIDAVDPSGFLYIRELIKNGMQEGGGYTDYEFAKPNES
                     EPKPKRSYTQLFEPYAWIVGTGNWVDDIESKVSEKEMYYNQHMLNDIIKVVAAMVIGL
                     GVVAVLAFVISGRIAQRVQRIAQGAREVAQGNLTIDKIVVDTQDELGQLAGDFNQMTD
                     NLAEVVKKVAYASEQVSLTAQELSSGAEESAQAAMEVAAAVTDVAQGTERQIRSVSEV
                     SEVVKEMAAGMEQVLTNTGYVVRSAEETSQAAAKGQGSVETTIEQMNHIQKVVNHSAE
                     LVERLGLRSQEIGQIIETISGIAAQTNLLALNAAIEAARAGEQGRGFAVVAEEVRKLA
                     EQSQGAAKQISALILEIQGDTVKAVEAMQEGTHEVGKGAKVVVEAGSAFAEIAELIQE
                     VTGQVRDISAEIEQISQGNERIIRAVEEVDQISREITDQTYGVSASTEEQSASVEEIA
                     SSCQVLENMAMELEKILAKFKV"
     gene            146823..148589
                     /locus_tag="DSY_RS00770"
                     /old_locus_tag="DSY0140"
     CDS             146823..148589
                     /locus_tag="DSY_RS00770"
                     /old_locus_tag="DSY0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011458911.1"
                     /db_xref="GI:499778177"
                     /translation="MKSIRARLILAFIFTSMLMSIIVGGYNIYRQIDILKNNVQSYRE
                     TLFAEYDRGIKTDVEIAISVIDKVYKEQQAGLLSEEEAKTKAADLVRELRFDGENYFW
                     VDTTEGINVVLLGRDTEGKSRLDAVDPNGYAYVRDGFIKNALSGGGYSDYEFAKPNET
                     EPTPKRGYTQLFEPYGWVIGTGNWVDDIETEVIAQELIYQKQMSKDIISISVAMILGL
                     IIVSAVGFKISQGITRQVKQVAQGANEVAQGNLRIEKIQVDSRDELGQLAQDFNHMAE
                     NLTQLVKQVSLASEHIASSSQQLSAGAEQSAQAANEVASAITEVAQGTEKQMTAVNDV
                     AAVVEEMAAGMGQVLNNTEYVVRSAEGTAKATDKGQQSIHTTVKQMESIQKAVNHSAS
                     LVEHLGVRSQEIGQIVEAISGIADQTNLLALNAAIEAARAGEQGRGFAVVAEEVRKLA
                     EQSQIAAKQIADLIGEIQEDTHKAVDSMKNGTQEVEIGSKVVHEAGSAFEEIAGLIQE
                     VTGQVRGISHEIEEISQGNERIVASIHEVNQISKSIAEQTLNVSASTEEQSASVEEIA
                     SSSQLLAKMTEDMEQALHKFKI"
     gene            complement(148579..149292)
                     /locus_tag="DSY_RS00775"
                     /old_locus_tag="DSY0141"
     CDS             complement(148579..149292)
                     /locus_tag="DSY_RS00775"
                     /old_locus_tag="DSY0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458912.1"
                     /db_xref="GI:499778178"
                     /translation="MTSTRFPIIDSLRTLALALMITYHLIYDLDQWTGLAVDVDALFW
                     FSIGKTAALLFIFLSGLSSGFSKHPLKNGLRVLFFGMIITLVTYVTFPEQYVRFGILH
                     FLGVMMVLYPLIQKLPNGALILGSVLIIAGGLIIKDQAVNTPLLLPLGFMYPGFATMD
                     FYPLFPYSGVTLLGVPCYRYFFAEHSRTNASVPPAEKSKAAYPMVTWVSRHSLWIYLI
                     HQPILLGLIFALKAIAIIS"
     gene            complement(149378..150235)
                     /locus_tag="DSY_RS00780"
                     /old_locus_tag="DSY0142"
     CDS             complement(149378..150235)
                     /locus_tag="DSY_RS00780"
                     /old_locus_tag="DSY0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_011458913.1"
                     /db_xref="GI:499778179"
                     /translation="MYDVVIPAQNEEKSILAVLATVLKLPIKRVILVLNGCTDRTLDL
                     TRTILDQRIHTIYFAEPLGIDVPRAIGALYARSLHTQGVLFVDGDTSGDIYDGLAKLL
                     AALADGTDIALTNCYPYITHRAKLANLVLRFRGSLNKELGYFQLLGNATPTHGPHALS
                     AKALEVLMPEAIAIPPLTLVLAKRFDLKVKVATSIRHQDLKSPRKHRRHARLIAETII
                     GDCVMGLTLARNEEVTRSLGKHKMLGYHPERRFDILQLWTESLITTHSYCENHLIIPR
                     DTPWLGGYS"
     gene            150382..151215
                     /locus_tag="DSY_RS00785"
                     /old_locus_tag="DSY0143"
     CDS             150382..151215
                     /locus_tag="DSY_RS00785"
                     /old_locus_tag="DSY0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011458914.1"
                     /db_xref="GI:499778180"
                     /translation="MLKVGDIVARKSHKQDLFFRIEQIMSIKGERIAILKGINLRLIA
                     DAPLQDLVEKEPSEVAHYQREDYQDIYNKLKIVVNQRKYVPEVQDEFYEIPGRVLHLD
                     GDEEYLSQCIKTYQQLGLDAKGICISEAEQPKKIRQVLQENPTDIVVLTGHDGFLKGK
                     KDFKSLDSYRSSRFFVQSVLEARRFQPNRDALVIFAGACQSNYEAIIRAGANFASSPK
                     RTLIHAFDPVFIVERIAFTPIDQMVSLKEIIQHTVTGTDGLGGIETRGQLRKGYPRSP
                     Y"
     gene            complement(151269..151616)
                     /locus_tag="DSY_RS00790"
                     /old_locus_tag="DSY0144"
     CDS             complement(151269..151616)
                     /locus_tag="DSY_RS00790"
                     /old_locus_tag="DSY0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458915.1"
                     /db_xref="GI:499778181"
                     /translation="MNPLPQRRIIIRRSSRQIELYDGNQLLACYPCAVGKSSTPTPLG
                     NYAVATKVMNPGGAFGTRWLGLSLPDYGIHGTNKPASIGTQASLGCIRMHNHHVEALY
                     DQVGAGTPVIITE"
     gene            151757..152578
                     /locus_tag="DSY_RS00795"
                     /old_locus_tag="DSY0145"
     CDS             151757..152578
                     /locus_tag="DSY_RS00795"
                     /old_locus_tag="DSY0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyanophycinase"
                     /protein_id="WP_015942561.1"
                     /db_xref="GI:506422842"
                     /translation="MNHYVEGKLLIIGGAEDKKGECKILKRFIQEAGGRESRVVVLTA
                     ATEMPEQVGSEYKELFENLGAAEVQVLDIAERVSANRESISQELQKATGIFFTGGDQL
                     RITGILGGTRLGRTLHNLYQRGVIIAGTSAGASVMSDTMIVGGEAGTPKKDTLTMAPG
                     LGLLHSVVVDQHFAQRGRIGRLLTAIAQNPYVLGVGIDEDTSILVYSDGHFTVVGSQT
                     VTVVDASPTMASNVSEISPGQALVLTPVLMHILSDGYRFDLKRRAASLNETPSGG"
     gene            152698..155355
                     /locus_tag="DSY_RS00800"
                     /old_locus_tag="DSY0146"
     CDS             152698..155355
                     /locus_tag="DSY_RS00800"
                     /old_locus_tag="DSY0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyanophycin synthetase"
                     /protein_id="WP_005814969.1"
                     /db_xref="GI:492340953"
                     /translation="MEILKIQAIPGANVYSYRPVIRAVVDLQEWTERTSDTFGDFNTR
                     LVQCLPSLYEHFCSRGKPGGFVERLKEGTLVGHIIEHVTIELLTRAGQNIPYGKTLCL
                     PEHPGHYEIIFNYDSLEGGLEGFKQGYALVQELLAGQKPNVTNRIERIREVIQRFELG
                     ASTRAIIEAAEGRGIPVIRLNDSSLLQLGYGRNQKRVQAAMSDQTSCIGVDIACDKGL
                     TKKLLYEGGIPVPDGVVTRNEDEAVEVFRQLDRLVVVKPYNGNQGKGVTLKLGTEAEV
                     RAAFRVAQTYEEQVVVEEYIEGKNYRLLVVDGKMAAAAERIPAHVIGDGVSTVGELVQ
                     LANSDPQRGEDHEKALTKIKIDPVVLMTLTQKKIALETVPADGEVVYLRDSANLSTGG
                     ISVDVTERVHPDNAALAEYAARIVGLDIAGVDMVLEDIERPHQEQRGAIIEVNAAPGL
                     RMHQYPTVGRPLDVGKIIVDHVMPKGNGRIPVISVTGTNGKTTTTRMIGKMLMDRELA
                     VGMTTTDGIYVGGKLLLKGDTTGPESAQIVLRHPDVQVAVLETARGGILRAGLAYDYA
                     DVAVVTNVANDHLGQYGMESLEDIAHVKSLIAEVVRPHSYVVLNADDPLVASFARKTK
                     GKVIFFSTEKDNLTIRKHLAVGGIAVFVRRGNILLCQGDQSHKICGVKDLPVTWNGKA
                     LHNLQNALAAIAVGWSLGLKAEGIRISLSEFTSDPECNRGRLNPYTIGGVQVFIDYGH
                     NAAGIKAIAQTLRKFKAPAVVGCVTVPGDRPDETIREVARVAARGFHRLIIREDGDLR
                     GRRPGEIAGMIMEEAIASGMDPRRISVVLPEREAFCHGLDTCKPGEIFVMFYEHLEPI
                     EEEIALRLESGPLAKEEEGFLEVANLGAI"
     gene            155583..156497
                     /locus_tag="DSY_RS00805"
                     /old_locus_tag="DSY0147"
     CDS             155583..156497
                     /locus_tag="DSY_RS00805"
                     /old_locus_tag="DSY0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein Fic"
                     /protein_id="WP_005814967.1"
                     /db_xref="GI:492340949"
                     /translation="MGYISVQQAAEQWGLSDRRVRLLCEQGKIEGVIREGRSYRIPAD
                     SVKPLDGRILRGKIIPQEYTTLFARVDALKSQISKRRPFTQGELKRLQEKFLVEFTYN
                     SNAIEGNTLTLRETALVLEGVTIDQKPLKDHLEAVGHRDAFLYIQRLVTEKAPVSERI
                     IKDIHSLVLMDRPDDKGVYRRIPVTIMGTYHEPSQPYRIPVQMEQLIAAQKEEKRHPL
                     ENAAVFHLKFEGIHPFIDGNGRTGRLLLNLMLMQQGYPPIDVKFADRKRYYACFDSYY
                     KDKTAAPMVEMVAGYLEERLKRYLDILL"
     gene            156698..157570
                     /locus_tag="DSY_RS00810"
                     /old_locus_tag="DSY0148"
     CDS             156698..157570
                     /locus_tag="DSY_RS00810"
                     /old_locus_tag="DSY0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q251V5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="WP_011458917.1"
                     /db_xref="GI:499778183"
                     /translation="MIRNQVEMFAYAKINLALAITGRRPDGYHELESVMQSIGIYDRI
                     RVTLAEGGIQCSCGEWSGPENLAYRAAEAFLSGLGSSQGIHIDIEKNIPVQAGLGGGS
                     ADAAAALQALNKLFKEPYTEEELKSFAAQLGADVAFCLKGGTQWATGVGEELKGLPHA
                     PKINLVLIKPDQGVNTAEAYRAFDQEGKFSHLDYAGWQEALASGRAESLIPLLYNDLE
                     PASMKLLPEIAWVKEELMKQNGCLGALMSGSGSAVFGIVQTEEQAEKIAAIWRERNYH
                     VWVTHTMERGNIYG"
     gene            157563..158282
                     /locus_tag="DSY_RS00815"
                     /old_locus_tag="DSY0149"
     CDS             157563..158282
                     /locus_tag="DSY_RS00815"
                     /old_locus_tag="DSY0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_005814961.1"
                     /db_xref="GI:492340940"
                     /translation="MGRKLVPVKLDSYKPLREIVFESLREAIINGVLEPGERLMEIQL
                     AEEMGVSRTPVREAIRKLELENFVVMIPRKGAYVAGVSHKDVADVFEIRSALEGLAAG
                     LAAERATDQEIEEMERFLLYYEGQEMSLDQMVDSDTGFHALVYKASRNERLIQILANL
                     REQIQRFRATSLSVPGRLKNAIDEHRSIVEALARHDVEEAQTLAMAHIVTAENVMFEA
                     LRLSKEQGDSKEDSEANSEKE"
     gene            158294..159130
                     /locus_tag="DSY_RS00820"
                     /old_locus_tag="DSY0150"
     CDS             158294..159130
                     /locus_tag="DSY_RS00820"
                     /old_locus_tag="DSY0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_011458918.1"
                     /db_xref="GI:499778184"
                     /translation="MEKMKRAERMVAVMQVLMSKPNMLIPLTTLAERFGAAKSTISED
                     LLAVKESMRCTGQGRLETVSGAAGGVRYIPEISAEDAGGFLISLAERLSSQDRVLAGG
                     FLYMTDLLYDPAVLRPLALIFAGVFREKKPDVVVTIETKGIPLALVTAEALGVPMVII
                     RHGNKVTEGTAVSINYVSGSSKRIQSMTLGRRALEPGRKVLIIDDFMKAGGTALGMIN
                     LLKEFDADVVGLGVLMETPREEEPKLVDHYLSLLQLRELDPVKGVVQVIPQNSFLHYQ
                     KL"
     gene            159378..159632
                     /locus_tag="DSY_RS00825"
                     /old_locus_tag="DSY0151"
     CDS             159378..159632
                     /locus_tag="DSY_RS00825"
                     /old_locus_tag="DSY0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015260634.1"
                     /note="stage V sporulation protein G; essential for spore
                     formation and a negative regulator of asymmetric septation
                     in Bacillus; involved in methicillin-resistance, biofilm
                     formation and capsular polysaccharide synthesis in
                     Staphylococcus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814955.1"
                     /db_xref="GI:492340929"
                     /translation="MNITDVRVRKVNVEGKMKAVVSVTFDNSFVVHDVKVVEGTNGLF
                     VAMPSRKTPEGEFRDIAHPISSAAREVIQNAVLKAYQEAM"
     gene            159820..161181
                     /gene="glmU"
                     /locus_tag="DSY_RS00830"
                     /old_locus_tag="DSY0152"
     CDS             159820..161181
                     /gene="glmU"
                     /locus_tag="DSY_RS00830"
                     /old_locus_tag="DSY0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8FY55.1"
                     /note="forms a homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein GlmU"
                     /protein_id="WP_011458919.1"
                     /db_xref="GI:499778185"
                     /translation="MPHWAAVIMAAGKGTRMKSKLPKVMHTLAGKPMLQHVLDCVRSV
                     EIPRSMVVLGHGREQIEATLDDRTEVVVQEEQCGTGHAIMQAIPHCHEVDHIIVLSGD
                     QPLIRPETLRNLIRIHIEHNAAATLLTACFENPHGLGRILKEGDQFLRVVEEKDATPE
                     ERLVQEINTGTYCFNVAKLREALKNITPKNAQGEYYLTDVFAVFHAQGEVIRTYCTED
                     VHEALGINSRAQLAAAEDVARQRILSYWMEEGVTIIDPRSTFIEAGVVLQPDVVLQPF
                     TILKGRTQVAEDAVIGPHTTLTDCTVGAGSEVSHTVGNQAVIGGHCTIGPYAYLRPGT
                     VLQDKVKVGDFVEIKNSQIGEGSKIPHLSYVGDSQVGKSVNIGAGTITCNYDGVNKYK
                     TIIRDKAFLGSNTNLVAPVEIGEGSVTGAGSTISKNVPANTLAIERSTQKHIENWVRN
                     KKK"
     gene            161196..162137
                     /locus_tag="DSY_RS00835"
                     /old_locus_tag="DSY0153"
     CDS             161196..162137
                     /locus_tag="DSY_RS00835"
                     /old_locus_tag="DSY0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814952.1"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-phosphate from D-ribose 5-phosphate and ATP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_005814952.1"
                     /db_xref="GI:492340924"
                     /translation="MSVKELKIFCGNANRALAEEIVDYLGVPLGEAKVKRFKDGEITI
                     AIDESVRGADVFVVQPTCNPTNDNIMELLIMIDALKRASARRITPVIPYYGYARQERK
                     SKARDPITAKLMANLITTAGADRVVTMDLHAPAIQGFFDIPVDHLPGVPILAEYFKSK
                     ELENVVVVSPDHGGVQRARNLAERIGAPLAIIDKRRPEPNVSEIMNVIGDIQGKQVIM
                     IDDIIDTAGTITQGAQALKDRGAQDVYACCTHPVLSGPAFERLENSVIKEVVITNTIP
                     VHPEKMISKIKVLSVAPLLGAAIVRIHEDLSVSKLFS"
     gene            complement(162300..164159)
                     /locus_tag="DSY_RS00840"
                     /old_locus_tag="DSY0154"
     CDS             complement(162300..164159)
                     /locus_tag="DSY_RS00840"
                     /old_locus_tag="DSY0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_011458920.1"
                     /db_xref="GI:499778186"
                     /translation="MLTFFKNEEKRTILFLVLSLPALIMSFFEIGSFPVDPAWIAILL
                     CGIPIIKGAIVGLVTEFDIKADVLVSLALIAAIFIGEIFAAGEVAFIMAIGAYLEERT
                     VAKARAGIEKLVHLTPTTARLVNNGEERIVPAEQVKVGDVLRVLAGETIAVDGIIISG
                     QTSVNQAVMTGESLPVDKSTGEKISSGTVNQFGTFDMQATKVGEDSSLQRMIRLVQSA
                     DAGKAKIVGIADRWATWIVVIALFSAGATWFITDEIIRAVTILVVFCPCALVLATPTA
                     IMAGIGNATKFGILVREGDALERLSMVKRMAFDKTGTLTFGKPDVAAVESFDPSLSAD
                     ELLALAASAELRSEHPLGKAVVAHYRTAAKASLPEPHDFRMLAGRGVYAVVNNRTIYA
                     GNGELLQDNGIPLAQAIIEKAASYRNDGCTIIFVAIDGHASGFIALSDTLRPDAVDIV
                     RNLEKLNVTSVLLTGDNHHAASHMAKIAGIHDIHTDCLPENKLAVIEQYQSKGDLVCM
                     VGDGVNDAPALKKAHVGIAMGGIGSDIAVDAADIALVRDDIKNIPHLFALSKRTMNTI
                     KINMALSMALNFGAILLAMFGHLGPVVGALVHNVGSVVVIINSSLLLNWRKSK"
     gene            164365..164577
                     /locus_tag="DSY_RS00845"
                     /old_locus_tag="DSY0155"
     CDS             164365..164577
                     /locus_tag="DSY_RS00845"
                     /old_locus_tag="DSY0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_005814946.1"
                     /db_xref="GI:492340914"
                     /translation="MKNRLEEIRKQRGIRQEELAAALAVSRQTIGSLENGRYNPSIIL
                     AFKIARFFGMSIEEIFIYEEEEYDEK"
     gene            164567..165004
                     /locus_tag="DSY_RS00850"
                     /old_locus_tag="DSY0156"
     CDS             164567..165004
                     /locus_tag="DSY_RS00850"
                     /old_locus_tag="DSY0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814944.1"
                     /db_xref="GI:492340911"
                     /translation="MKNDSVKKYMGLTVLGLVLLAVGLGLIKWQGDAEGMLRTLPYIC
                     VGVGAGVFGSNLGTAIKLRQFKKHPETARQVEIEEKDERNIAISNQAKAKAYDLMLVL
                     YSALLLGFALMQVALQVILALVGAYLLVVFTMVYYLAKYQKEM"
     gene            165008..165625
                     /locus_tag="DSY_RS00855"
                     /old_locus_tag="DSY0157"
     CDS             165008..165625
                     /locus_tag="DSY_RS00855"
                     /old_locus_tag="DSY0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_005814942.1"
                     /db_xref="GI:492340907"
                     /translation="MVGMLERTIAGLQRNNMAGYFVHNRQELMALLSGLMEKGQTVGC
                     GDSVTLEELGVFDFLRKGDYIFYDKYVPGLTSEDKRRLYIQNFAADTFITGTNAVTTD
                     GKLFNIDGNGSRVAPMIYGPRQVIVVVGTNKITEDVESAIQRVRQIAAPMDAKRLKKE
                     TPCTKLNRCVDCRHPQRICNDFVLITGQFVKDRIKVIIIDMEIGY"
     gene            166007..166204
                     /locus_tag="DSY_RS00860"
                     /old_locus_tag="DSY0158"
     CDS             166007..166204
                     /locus_tag="DSY_RS00860"
                     /old_locus_tag="DSY0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942567.1"
                     /db_xref="GI:506422848"
                     /translation="MNYAAIANLVHECVKNPTCLVTQKEKSGESKIKPDEFSVIQNVF
                     SRHEVSGNGAAIGVLPMGFWS"
     gene            166211..167167
                     /locus_tag="DSY_RS00865"
                     /old_locus_tag="DSY0159"
     CDS             166211..167167
                     /locus_tag="DSY_RS00865"
                     /old_locus_tag="DSY0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814937.1"
                     /db_xref="GI:492340898"
                     /translation="MNLQLDQIFFREIDSVLAKARLDAEMERLIRLSLNADSPTGELF
                     RWAHLTRMSCECAGGDPEDALPGAIGMEFFALALDIFDDVQDQDNENMPWRQLPDAQA
                     INLAICLLMLSDEAISAIPDNRLFREVAATLHRTGICASNGQFREFIYDDRQQVSFEQ
                     YFEMAGQKAGSLTACACKIGAILGGAEEPVIHGLEQFGINLGILNQIRNDLNDFLDFF
                     RKSDFVNNKKTLPYVYLLNTLKAEAAERFKELTQGHGEGAYGFGDREREYVRQLAAEE
                     GVAPYCTVMFEIYCQKAREILEGIPVPEKNKENMKELVGESV"
     gene            167148..169505
                     /locus_tag="DSY_RS00870"
                     /old_locus_tag="DSY0160"
     CDS             167148..169505
                     /locus_tag="DSY_RS00870"
                     /old_locus_tag="DSY0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011458923.1"
                     /db_xref="GI:499778189"
                     /translation="MLEKVFKRQIYYIASLVFVVLGLGYFAACLTQPFIGLDLKNSNG
                     QWLVATSDPNGEGYRSGIRVGDEILKINGEDAGKYRFAQKWETAEGASTIEFRSPGEL
                     TDQTVTITPQPVLLTVLSEIPLLILGLVFWCLGFMTWYKRPFLEQARILFWMNWAFGL
                     AIVLAHASSRCLLLSKEMEHITFSLAPVFLIIFISVFPVSNQNKLNKFGRKIATILFI
                     LILVLTILQSLGFVQLISLIKKLSLSNMVIGILFTLWNLGILIKLPKNQPGKNEAYII
                     LLGMGIGFLPFVLLSALPIIFNLEQLIYSQVSSLSISAIPISLYYVIINKYLPDSRRL
                     YATALSYIGAAAILSFIVFLALFFLQVLPAIRLEYYTALLLFTLLSILCFHLIQIGIT
                     RLWERSSFFQDKHTLKQKVAVLNENLTSLVAEERILDEIVNTLGIDGIFMIMENEQIG
                     CLKKTAGRFKEHPRELETLENYFYHNQRLDLEAKMLPDDCPAGIYVPFIAQDSTCGIF
                     FGRRSSRIKFEQSELPFFTLLAGQLEYQIIMSLVIGKLTKEINALTKSSGRSYRRKME
                     LQGITNALFRKVEQKRKRLTDEICAGPLQWSMDLSRWLKYLKKECPADNKTLKVIAYL
                     QERAEDLNYELNCIANDWGPPILTDLGLVPAVQWLCQEIMTEELSLISLEISRLGQQS
                     RFKEDVEVTAYRFLQEGIMNSVRHSRSNMQTVRMTLNETWLELTVSDSGRGFDTGQIE
                     NWLLTGTHFGLVEMKERIEGLGGELQIISGINRGTTLKALIPVFS"
     gene            169559..170245
                     /locus_tag="DSY_RS00875"
                     /old_locus_tag="DSY0161"
     CDS             169559..170245
                     /locus_tag="DSY_RS00875"
                     /old_locus_tag="DSY0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_005814933.1"
                     /db_xref="GI:492340890"
                     /translation="MSVHWEKSQETAEQIHMLIVDSHRPFAEGTRALLSFEPRIVTIG
                     IAGDEDSCLNFLRHSVPDVVLLDFYLRDISGLDLMDKIKAAHPALKVILMVEQSQEGY
                     VLAASRKGAEGLLLKTCAVEEMIQAVLSVSKGGVYYSPSPLAFSQVEIDFHDLHFPAK
                     PAEVLKRLLTPREKEIMSLLTKPLHNREIAAALGITARAAHLQVKIILLKFGIKTRLE
                     AVLSWAYVDE"
     gene            complement(170369..170644)
                     /locus_tag="DSY_RS00880"
                     /old_locus_tag="DSY0162"
     CDS             complement(170369..170644)
                     /locus_tag="DSY_RS00880"
                     /old_locus_tag="DSY0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458924.1"
                     /db_xref="GI:499778190"
                     /translation="MRQCMDFDNLHRRLNKVIGQIKAIDKMLEEDIPCEDILIQINAA
                     KKALHKVGQVVLEGHLNHCVREGIEHGDADKTINDFAKAVEHFSRLT"
     gene            170933..171943
                     /locus_tag="DSY_RS00885"
                     /old_locus_tag="DSY0163"
     CDS             170933..171943
                     /locus_tag="DSY_RS00885"
                     /old_locus_tag="DSY0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458925.1"
                     /db_xref="GI:499778191"
                     /translation="MRKEAGLELWRKLHEVTRLIGSLQPWDYLWDMDMITLVLPEYEQ
                     PFFVSVMGRNGECYAITVMEGPEALRGFYRLAESREIPPGQLIRYQNNLTCYFGDRDE
                     LSKAERDRIKALGLKFRGRNQWIFFRAFERGYAPHTLDEEQVLKLTRVFQELFMALRA
                     LLEHGIAVDFEKGQTLYRCFDPEQKLWLTSAMPRFMPSPQYLVPVLEDEVMAARLKRQ
                     KKVKEKLEIDTLFLDTFIDESKSGRPTIPILLILASRSSGMILDQEFLDPGDDEVAAV
                     LGQVINYIEDSGRPQKIFVRDEEMAHLLSDLCRRVDIPIAIEGSLQVIDDFAENFELL
                     SF"
     gene            172106..173293
                     /locus_tag="DSY_RS00890"
                     /old_locus_tag="DSY0164"
     CDS             172106..173293
                     /locus_tag="DSY_RS00890"
                     /old_locus_tag="DSY0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_015942570.1"
                     /db_xref="GI:506422851"
                     /translation="MKDKSNSPLIKELKLANLLSFGSETTDIQLNSLNVVVGPNGSGK
                     SNLIDAISLLQASPSDLAVPIRKGGGIRDWLWRGMELPTASMEVITPSAPHGNKDLRY
                     YLAFTALKQRFELIDECLETKEPYTNHSEPYFYYRYQNGNPVINNIKDQKRMLKREDI
                     DPEQSILSQRKDPDQYPEITWLGKQFAAIRIYREWNFGRKALLRQPQGADAPNDYLAE
                     DCSNLGLVLNKLRTNYKVKKKVLDLLSQFYEGIDDFDVIVEGGTVQLFLQEGEFMIPA
                     TRLSDGTLRFLCLLAILCNPDPPPLICIEEPELGIHSDIIPVIGQLLKDASKMTQLIV
                     TTHSEILVDELTDMPEAVLVCEKHEGMTRFRRLEKDLLKDWLERYSLGELWRKGEIGG
                     TRW"
     gene            173287..173916
                     /locus_tag="DSY_RS00895"
                     /old_locus_tag="DSY0165"
     CDS             173287..173916
                     /locus_tag="DSY_RS00895"
                     /old_locus_tag="DSY0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814926.1"
                     /db_xref="GI:492340876"
                     /translation="MVRSIRNTVKIYIEGGGEQEHLKRECRKAFSSFFDKIGFRGRMP
                     RVVACGSRNEAFRDYCISLKTSQSTGELAFLLVDSEGPVDAAFCNRPGQYLRTHESWN
                     MPRNAQDEQIHLMIQCMESWFLADIDALREFFGNGFREGSLPRGSNIEDISKTDILDG
                     LKNASGSSYKGKYGKAAHSFKLLEKVDPQKVKIAFPSVNRLHEELDKVL"
     gene            <174118..>174816
                     /locus_tag="DSY_RS00900"
     CDS             <174118..>174816
                     /locus_tag="DSY_RS00900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458927.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272808.1"
                     /db_xref="GI:752603421"
                     /translation="NIRPKATEALLQRPRLLDKIALPGTQLTYIHADAGYGKTTLLLQ
                     YAKGRDDVVWMALDGKDREPIFFLQHLESSLKEKLIQFEFHATDYIPFAGSDTFAAVV
                     LSALLKAIGSSVLTIIFDDVHVITHHQLTDLLTEWVKSSPPNLTLIMASRHELWSSLF
                     RLKIAGEVVELTKRDLCFSQEEAERLWGFFDEAAYSATEGWTLAIQSYRLAAEGNKEF
                     SLARLDADRDVSRYL"
     gene            175480..>176061
                     /locus_tag="DSY_RS00905"
     CDS             175480..>176061
                     /locus_tag="DSY_RS00905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458927.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272809.1"
                     /db_xref="GI:752603422"
                     /translation="MAAWYGVVIEKIHNLTLTSQLTEALALTIAMMNKCLVNGDLRIK
                     GWFERYLTVVYFYKGDYKNCLQAYEKSLAIPQEEQDQLMRHGVGVYAAKAYQIAGQED
                     KARPLLDAELYRMRQLGLHEEFSINYLLYAETLNTAEQLNYYLGKAADFSAADRYLNM
                     AEDYALLNRSTREHWLFVKIWKDCAEIFKQPEKA"
     gene            177160..177762
                     /locus_tag="DSY_RS00910"
                     /old_locus_tag="DSY0167"
     CDS             177160..177762
                     /locus_tag="DSY_RS00910"
                     /old_locus_tag="DSY0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sigma-70 region 2"
                     /protein_id="WP_005814921.1"
                     /db_xref="GI:492340869"
                     /translation="MNKSILAKGGATIVTQVEKRELIGLVQKDETSLTELYNVYFPRI
                     NNYVHYRVADYHDAEDLVSQILEKVFTKSHSYQENKAPFSVWLFRIARNTITDYYRSR
                     KGVHNISLDGYTRDIVAREPEPAEIVELNELQHHLLKAIASLSQREQEIIALKFWSDL
                     SNREIARLVGISESNTGVILFRAMRQLRLILASQGMCIYE"
     gene            177755..178129
                     /locus_tag="DSY_RS00915"
                     /old_locus_tag="DSY0168"
     CDS             177755..178129
                     /locus_tag="DSY_RS00915"
                     /old_locus_tag="DSY0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814919.1"
                     /db_xref="GI:492340865"
                     /translation="MNEKQQAEIYLAYLERLIAGEKDLGVVEEPEIRKLLFLAETMLT
                     HDLSSNSKLRDSLKEKILAQLGQVNPVGLREFSRDEELAEEDLEYVAAGFSQQLGWQK
                     CPRCGSRLGKSTGDRECPNCKL"
     gene            178249..178491
                     /locus_tag="DSY_RS00920"
                     /old_locus_tag="DSY0169"
     CDS             178249..178491
                     /locus_tag="DSY_RS00920"
                     /old_locus_tag="DSY0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin"
                     /protein_id="WP_005814917.1"
                     /db_xref="GI:492340861"
                     /translation="MSIESAKAFMEKMKTDQDFAKKVMAAKDAEERRALVKEDGFDFS
                     AAELKELGEEMSDSELDAVAGGSCLVDTCGMKELIW"
     gene            complement(178560..179957)
                     /locus_tag="DSY_RS00925"
                     /old_locus_tag="DSY0170"
     CDS             complement(178560..179957)
                     /locus_tag="DSY_RS00925"
                     /old_locus_tag="DSY0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM domain protein"
                     /protein_id="WP_005814916.1"
                     /db_xref="GI:492340859"
                     /translation="MSKKEVSPFHLFEYRGHPYLLNIEKMAAHSVSTELLPILHNIRE
                     PQTKLPADQEKILRSWDLISECQDNDAPVVQMEPVPITYLYLFLTQSCNLRCIYCYGD
                     GGEYGAGGSMDSATAKQAVDWLITWSGNMKKIHLGFFGGEPFINFPLMKATVDYAQSK
                     AQEAHKEVAFYVTTNATLLDDEKIAFIKEHQFSVQISFDGPREIQDAQRPYANGQGSY
                     DSVVPKIKKLLACVPEASGHGVLWGDTNPQLVKATLQDLGFTSLTLAPASSSLFTDES
                     EKKPSSRKTQAQLQALEQETAAWLHHLRSRDKDILHGLRASSGGYGIYPGMIALLHNR
                     RKYHFCGVGRKMAGVSVTGDIYPCHRFVGNDDYKLGHVGDENFNRDDYLQSPPALRAN
                     CASCFARYYCAGGCRHDNLSSSGSSHVPSEEICRLRRRELELAAVIVSNLSSDDQAFL
                     VNERIIAPKPCPLDF"
     gene            180165..181307
                     /locus_tag="DSY_RS00930"
                     /old_locus_tag="DSY0171"
     CDS             180165..181307
                     /locus_tag="DSY_RS00930"
                     /old_locus_tag="DSY0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_041272186.1"
                     /db_xref="GI:752602799"
                     /translation="MLKSRVIKKSLAMIFILGLSLWPLGCTQVNPSGEIFIGVAWPFA
                     SLDDLFAEGLELAVQEINEQGGVQGRRLSLVKADDEAELEKGLAIAQAFADNAGIQAV
                     IGHRNSFISIPTASIYDQAGLVMLSPASTSPDLTDHGYIHVFRNIPSDQEIARQLAIY
                     LAEQGHERMVIYYTDDSYGNGLANAFEDYARAQGITIVDRFNYYGNLKDLERLYDKWQ
                     AFGMDGIFIAKTATGGGTEFLVDAKSVGIEVPLIAGNSWDALSLTEDIENIGMTAEGL
                     LVGSFFNPQRPDSRTQDFVEAFRREYGQPPTSYAAAGYDAVILLAEALEKSDLTHPAT
                     LAQGLRDLGSWEGVMGMHRFDGRGDDIGDLVVLKKMKDGRFEYLGH"
     gene            181323..182261
                     /locus_tag="DSY_RS00935"
                     /old_locus_tag="DSY0172"
     CDS             181323..182261
                     /locus_tag="DSY_RS00935"
                     /old_locus_tag="DSY0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NHLP bacteriocin system secretion protein"
                     /protein_id="WP_005814912.1"
                     /db_xref="GI:492340853"
                     /translation="MRQGLFRDVSLTRLSSPEQLDQRIQVTSPKAWLALLAIGLILMS
                     GVVWGLLGSIPTKIQGQGILLNNGGVFSLQHHAPGQISDIRVKVGQEVRQGDVIARIE
                     QPELVAQIKGLLGSQAAMDKDGQGGEPALAGIEEQIRQLRSELVYRTQVVSEVDGRIL
                     ELNISKGSIVKPGDTLATLEQYGDTVKLEAIVYVPAEQGGLLRPGMECQISPTTVNKE
                     EYGYLLGRVNTVAEYPATAQSMMQTLGNESLVTFLAGQGAPLLVKIDLVPDSATESGY
                     RWSSPLGPPMSFQSGTIITTEIITQREKPIHKVIPF"
     gene            182287..184470
                     /locus_tag="DSY_RS00940"
                     /old_locus_tag="DSY0173"
     CDS             182287..184470
                     /locus_tag="DSY_RS00940"
                     /old_locus_tag="DSY0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_005814910.1"
                     /db_xref="GI:492340850"
                     /translation="MVKKKIVKVPTVLQMEAVECGAASLAMILAYYGKYITLEELRIA
                     CGVSRDGSKASNLLKAARNYGLEAKGYRKEPEALRRMPLPLVIHWNFSHFLVLEGFHK
                     GKAVLNDPAAGRRTVSEEEFNLAFTGIVLSFTPTTEFQKDSRKPGLSLALRRRLKGSE
                     QALIYIILLGLALVIPGLIIPVFSRVFVDDILLGGLHSWVWPLLLGMGITAMLRGVLT
                     WMQQYYLLRLETKIALATSGQFLWHIFRLPSEFFSQRAAGELTSRIQSNDKVAKLLSG
                     KLATTALNVLMIMFYFTLMLTYSWILALVGLAIAFINVGYLIAVSARRVDLNRRLLQD
                     EGKLIGSSMAGLQIIETLKATGSEANFFAQWSGYQAKLLNAEQELGVSSQFLSVFPSF
                     LTGINNALVLVIGGFLILDGQMTIGMLVAFQSLMSSFMTPVTGLVGLGAELQEMTGEM
                     NRLDDVLNYPLGRNQGDQGGQGGQEDLGGTAEPPAGQKLSGYVELRNITFGYSILEPP
                     LIEDFSLSLRPGSRVALVGGSGSGKSTIAKIIAGIHHPWSGEILFDGQPRSSFTKEVL
                     SNSLAMVDQEICMLQGTVKENITLWDGTISEFEMIRAARDACIHDEITARPGGYEQMV
                     EEGGKNYSGGQRQRLEIARALAQNPVILIMDEATSALDPITEKNVDEYIRYRGCTCII
                     VAHRLSTIRDCDEIIVLEKGKIIERGTHGSLYERAGTYAKLIATG"
     gene            184508..187303
                     /locus_tag="DSY_RS00945"
                     /old_locus_tag="DSY0174"
     CDS             184508..187303
                     /locus_tag="DSY_RS00945"
                     /old_locus_tag="DSY0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin ABC transporter ATP-binding protein"
                     /protein_id="WP_011458930.1"
                     /db_xref="GI:499778196"
                     /translation="MSEIDYGEFVKQAGMSIPLDGQEPLFLQEDGSVWLVEQGKVAVF
                     LATMENQLQAGAKIFLFEGRAGDWLFGITPEGSPHKKGLLVSGLPGSRLLRLDIRQLT
                     ELLRDRRETDGGAQRGLQGPAHGEKIYGAVGQWLHTLARISRHGDISREARVAPGLAF
                     SQDEVAATAEAVLSEYEYLTNDSLRARYHSQVLQGVSDLWDKKIAAEQKRLEEKGRSD
                     QRLMANAIARLAAITEEVETKVLADQTGDPLLDACRLVGRTMQIGIVAPPEVLGSSKV
                     MLLDEIARASRIRVREVSLHGNWYTQDSGPLLGYMKEDHRPIALIPATPASYCIHDYT
                     LGITRSVDSETAQEIDAFGFVFYRPLAERKITARDLLALGWGNSWRRDFLMILLMGVL
                     GGILGTATPLATGIIFNTIIPEGERGHLVQIAFFLGASALAAMIFQFVRSLAALRIEG
                     KMEGAIQAAIWDRLLSLPVPFFKQFPAGELAMRAMGISQIRKILSGVTLNTVLSSIFS
                     VFTLVLMFYYDRRLAAAATMLVAVELLIIGFLGYLQVHYERKILEVSNQIAGMMLQLI
                     GSITKFRVAGAEVRVFYRWAERFSEQRQFVFKKRILGNWLTTFHDVFPILAGMIIFYT
                     LIAGHSLLSPGEFIGFNAAFISFMMSMTSLTEALIGAYSVIPLYQRAKPILDTLPEYD
                     ETKIAPAPLRGSIAMDHISFRYKVDGPLVLKDVSCRIEEGDYVALVGTSGCGKSTLLR
                     ILLGFEKPETGKIYYDGQDLEKVDIRAIRKQLGVVLQNGQLMSGNIFTNIVGANPYLT
                     IDDAWAAVKMVGMEEDIQAMPMGMHTMISEGASTLSGGQRQRLMIARAIVNQPKILFF
                     DEATSALDNRTQAMVSQSLDRLKVTRIVIAHRLSTIINCSKIIVMDQGRIVESGTYDE
                     LMSKGGIFANLVHRQLT"
     gene            187512..188501
                     /locus_tag="DSY_RS00950"
                     /old_locus_tag="DSY0175"
     CDS             187512..188501
                     /locus_tag="DSY_RS00950"
                     /old_locus_tag="DSY0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_011458931.1"
                     /db_xref="GI:499778197"
                     /translation="MTLQPISKVSKAYGVSTRTLRYYEQLGLLQSSKLPGYAYRAYDE
                     EALSRLRQILVLRKLRIPLKQIGVILETRDARLAIEVFEQSITGLQSEKQALETIEGI
                     LRSFVRELEKLLPEPLSPHVFEQEHVMELVQALSVKTLSQKEETSMEELNRASELLEH
                     LKDIRILYLPPMTVASCQSTGDNQEEVVGAAISTFIKESGLGESKPDFRRIGFNNPAS
                     EQSGGSLGYEAWVSIPGDMEVPAPLVKKQFLGGLYAAHMIAFGEFQEWGRLWQWVMDN
                     GEYDVDFSPRTDPADLGADPSLEEQLNAIHHLEDTSPFGTQLDLLVPIKPKQG"
     gene            188512..189336
                     /locus_tag="DSY_RS00955"
     CDS             188512..189336
                     /locus_tag="DSY_RS00955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="WP_018305665.1"
                     /db_xref="GI:517116847"
                     /translation="MVEFQSRIGKDGRLTVMEIPFDARETFQMPKGTIFVCGTINGIP
                     YRGKLLSRGNGKQVLTIDKTLQKGLGYAGQDFPVNVAMACENQAEMVDEEKEAIPRLH
                     SDMEAITAIAGRASVRKYADKTVEPQKLEVILRAGLSAPSAKNKRPFHFVVVEDKAVL
                     GAWAAGNSNAKMLSHAPCCIVVCGDGNVEGTRDFLVGGCAAATQNMLIAIHALGLGGV
                     WCGVLRGKEWSRQVAADLYLPVKVEPLTVIALGYPTEQEKAPVPWDMKSHIHYERW"
     gene            complement(189410..189637)
                     /locus_tag="DSY_RS00960"
     CDS             complement(189410..189637)
                     /locus_tag="DSY_RS00960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272187.1"
                     /db_xref="GI:752602800"
                     /translation="MAVTPLPLKAALVVFFQAGISPSGAPIIKKKTLGNVRFDAAEQD
                     LYDVAHALFSLTDYPVLDVVLRKEYDLVDEG"
     gene            complement(189720..190583)
                     /locus_tag="DSY_RS00965"
                     /old_locus_tag="DSY0177"
     CDS             complement(189720..190583)
                     /locus_tag="DSY_RS00965"
                     /old_locus_tag="DSY0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase SecA"
                     /protein_id="WP_011458933.1"
                     /db_xref="GI:499778199"
                     /translation="MHDSTDKRTPLVIAAEINAINQESRRMLLKSAIEVGRRLKEAKE
                     LLNHGEWMKWLKESVSYSKSTAANLMNLYEEYGHLLLNPSDNDSNFQTFGNLTYSQAL
                     LLLGIPEEERQEFAVQNDVANMTARQLNQAVKEQKTPAPVKEPPKTGTETGAEAGAGA
                     MAESQTQPQPQLPPQTQGDIQIKYVSRTVRPRRQSITKTEPAPATSSLVTSYEEKCTA
                     CCQTIANTFQELLTALGHLARLDPRTKEKCSRNADQLASYMVDRLKDWPPVAGTNMKG
                     VQTYSTCEWGG"
     gene            complement(190792..191697)
                     /locus_tag="DSY_RS00970"
                     /old_locus_tag="DSY0178"
     CDS             complement(190792..191697)
                     /locus_tag="DSY_RS00970"
                     /old_locus_tag="DSY0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="photosystem reaction center subunit H"
                     /protein_id="WP_005814898.1"
                     /db_xref="GI:492340828"
                     /translation="MKPSKEFLSLPIVSLSEGQHIGYVKSLVIDAQAKALAALVIDPK
                     GFFRDQRIIPYAKVVSVGADAITIDKGAYVEKSASLPEILSLIKEKLTIIGTRVITQS
                     GKTLGVVEEYYVDPDTGKITQMEISGGKIEGFFSGKAILEADYVVTIGQDVIVAQKGC
                     ETSLMIADKGINDTFKSVLRSTSNLASGTGQAFGKIFSKKDKDKTKHAAKGKVKGKGK
                     GTAEDSASPIPIIEGENMAPLQDPPAAEDENILSSANNQPIEAVIIKDSSPEVPEISP
                     AEQPAETGPELSQVAEAPSTKEPLG"
     gene            191796..192353
                     /locus_tag="DSY_RS00975"
                     /old_locus_tag="DSY0179"
     CDS             191796..192353
                     /locus_tag="DSY_RS00975"
                     /old_locus_tag="DSY0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_005814896.1"
                     /db_xref="GI:492340824"
                     /translation="MKLIAGLGNPGGQYAETRHNAGFLLLDCLAEELKLDFRPKFQGL
                     VAETMMGGEKVYLLKPQTFMNLSGRSIRELAQFYKIAPKDIMVVYDDMDLPIGRLRLR
                     SSGSAGGHNGIKSTIAELGTEDFWRLKVGIGRPTAGWDSARYVLASFTKEELPVLEEI
                     LDKGIKAVTLWAKEGGDKAMNLYNR"
     gene            192416..192991
                     /locus_tag="DSY_RS00980"
                     /old_locus_tag="DSY0180"
     CDS             192416..192991
                     /locus_tag="DSY_RS00980"
                     /old_locus_tag="DSY0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814895.1"
                     /db_xref="GI:492340822"
                     /translation="MPLPQERGNFTYADYLSWPQHERWEIIDGVAYMQAAPSSVHQEI
                     LTGLLVQFHQYLAGKAGKVYPAPFCVRLIENDEKNDEEIIKVVEPDITVVCDKSKVDE
                     KGCCGVPDLIVEIISPTSTEMDKLVKFNKYEKAGVREYWIVEPEGRFVSVFVLREQKY
                     GRPEIYAENDKIKVAIFPDLLIDLKPVFEGI"
     gene            193222..194232
                     /locus_tag="DSY_RS00985"
                     /old_locus_tag="DSY0181"
     CDS             193222..194232
                     /locus_tag="DSY_RS00985"
                     /old_locus_tag="DSY0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_041272188.1"
                     /db_xref="GI:752602801"
                     /translation="MKRRFLILIVITAMLLSGCTHQEKAVSAPPAPTQEVKPDNVYNT
                     MSETAAHYGITHENYPRIDGLTSTQGIAMAINQAMYRYLENENLPMEVSKTVPSYKRL
                     IAGEVELILVPYPSAAVLALAQESGVELEFHPVAAEALIFITPAENPADNITGDQVRT
                     IYLDYGIRSWSELGGSDKELIPICRNADSGSQSQLDNLVLHDQPMHPGIQKNYVELTM
                     EGMLELVAFYHHGGLDGKPTDSYALGYTLYTYLQNMNEVTEIGSRLKILSFEGVEPTE
                     ENIAKGSYSLADGYYAVVRKDLPAAHSARGILKWLQSDEAAAAIKARGFIPKQDRTKL
                     SW"
     gene            194299..194526
                     /locus_tag="DSY_RS00990"
     CDS             194299..194526
                     /locus_tag="DSY_RS00990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_005814889.1"
                     /db_xref="GI:492340812"
                     /translation="MFITATELKENMGKYLTLASKEEIIIMRNGKAVAKLSKVEDNKI
                     EVAKSLFGILPKEASLELAREERLKKHESTD"
     gene            194510..194935
                     /locus_tag="DSY_RS00995"
                     /old_locus_tag="DSY0182"
     CDS             194510..194935
                     /locus_tag="DSY_RS00995"
                     /old_locus_tag="DSY0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_005814887.1"
                     /db_xref="GI:492340808"
                     /translation="MRVLIDTNVILDAVIRRVPYNNPAERLFLLIAGDRLKAYITASS
                     VTDIYYLLHRHFRDADQAKQVLAKLFVLFEVLEVTQSDCERALSLAMDDYEDALLATC
                     AKRKKLDMIITRNLPYFKDSPVKAIAPDEFIAHYFDEEG"
     gene            complement(195034..196260)
                     /locus_tag="DSY_RS01000"
                     /old_locus_tag="DSY0183"
     CDS             complement(195034..196260)
                     /locus_tag="DSY_RS01000"
                     /old_locus_tag="DSY0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011458936.1"
                     /db_xref="GI:499778202"
                     /translation="MAYIKRTIETTIENAAKMFSTVLITGARQVGKTTVLKHITEDIS
                     YLTLDDPILLLNAFEEAGSFFKSTPPPVIIDEIQYAPNLFPYIKMIADENGKRGQFYL
                     TGSQQFKMMKNVSESLAGRIGIINLLGLSLREIKGDADFNKAFIPTESYLETRRLSAK
                     ELNYKEIWKIIYKGSMPAMYADELDWQLFYGSYTKTYLERDVRELTQVGDELKFIKFM
                     TAMASRTSQMLNLTSIANEVGISVPTADRWLSILVSSNIVYLLKPYYNYIMKRAVKTP
                     KLYFLDTGLAAYLTKWNSPDVIEAGAMSGAFFETFVLAEILKGYYNAGILEPALYYYR
                     DKDAKEIDIILEENGTLYPIEIKKTANPSKEHIANFSVLDRLKDMKIGTGCVICMYDK
                     VIHINDNNVSIPVTWL"
     gene            196640..197932
                     /locus_tag="DSY_RS01005"
                     /old_locus_tag="DSY0184"
     CDS             196640..197932
                     /locus_tag="DSY_RS01005"
                     /old_locus_tag="DSY0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_026198765.1"
                     /db_xref="GI:648507014"
                     /translation="MRRKLEEKLVQWKDRSEGRMPLLLYGARQVGKTYLLAELGEKHF
                     ANTVYINLETNPAVAGYFADDITPERLIRFLETTVNQEIIPGKTLIIFDEIQSCERAL
                     TSLKYFCESAPEYHVAAAGSLLGVAINREHYSFPVGKVESMTLFPLDFEEFLWAMGEE
                     RLAQEIRRCFSLLEPMAEVLHQKAIELYRYYLIVGGMPACVELFKRTGKLVLIPTSQN
                     EILNNYVADMAKYAGAADTVKIRACFNSIPAQLAKENKKFQYKVVQKGGSASLFGVSI
                     DWLTQAGIVLKCQKLEQAMNPIAVYVDLSSFKLYMSDVGLLVMKSGLPQQSVLTGEAN
                     LFMGSVAENYVAQALAANGHSLYYWTSEHTAELDFVLQKGRDIIGIEVKKGTKVKSKS
                     INVFSQRYHSAYCIRFSEKNFGKTDNLWSVPLYGAFCV"
     gene            complement(198022..198699)
                     /locus_tag="DSY_RS01010"
                     /old_locus_tag="DSY0185"
     CDS             complement(198022..198699)
                     /locus_tag="DSY_RS01010"
                     /old_locus_tag="DSY0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_005814882.1"
                     /db_xref="GI:492340799"
                     /translation="MDTTEQKDLLEIRQFMYSFLSAVFLYPPQAEQVTMILQRQLFKE
                     FPLDIADEQYQEALANLVRWTNENCASDLVNVTSSLNKDYTALFIGPGHLAAPPWESV
                     YRTEERLTFGEPTLEVREWYQRCGLEFVHKNSEPDDHFGLELEFMSKLIASELEAWEE
                     DDVIKAEGLAREQPAFLDEHLLRWAKEFTQDVQASAQTLYYQGLAQLAYSYLIWDGKQ
                     LRDGKNT"
     gene            198925..201324
                     /locus_tag="DSY_RS01015"
                     /old_locus_tag="DSY0186"
     CDS             198925..201324
                     /locus_tag="DSY_RS01015"
                     /old_locus_tag="DSY0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit A"
                     /protein_id="WP_005814881.1"
                     /db_xref="GI:492340797"
                     /translation="MSKQPELQNKTKISRRAFVKWSAAATATAAIAPSLVGCSTQTQA
                     SGEPAVVQAGQRLAGAEEKPSICWHNCGGRCQLKAYVKDGVVVRFGTDNVGPDTPEDL
                     QARACLKGRTQRQRLYHPDRLKYPMKRVGERGSGEWARISWEEAFDTTAKELRRIIDQ
                     YGNESVYFNYACGAYGLLNQTNSNNSLRRLLNIMGGYLQSYGNYSQANYMYAVPYMFG
                     NPYSGSSPTTFPDAKLIVMFGDNPACTRVGGFNSTYYLKLAKQNGARIIVIDPRHSDT
                     VSTFADQWIPIRPTTDSALVAGMAYVMISEGLHDQAFLDKYCLGFDEEHMPEGIPAGN
                     SYKSYILGESDGKPKTPEWASEITGIPVETIKQLARDIAGTKPGFILQGRGIQRHGNG
                     EFQSLAVPVLSFMTGNVGILGSNPGLYEGGPSVKTGNYPIGTNPIKTKISIFMWTDAI
                     ERILTKEQDRIEGADKTKSTIKMIINYGGNTLINQHSDSGRTAALLKDDSKCEFILGM
                     DNFMTPSMQYCDIVLPGVTQFEVNDMITRSMGHGVAYYGQKLVEPMFECKTINEVGRA
                     LAERLGVLAQFDDGKSEEDYLREFVGVSQASHPDFPSYEEFREKGIYKTKATKVVAYE
                     KFIKDPEANPLTTPSGKFEIFSKDLYDIQNPQIPAIPKYMPTEEGPEDPLKEKYPLQC
                     IGHHTKRRVHSTFDNMPWLEEAEAQMLWMNPQDAAARGLKDHDMIKVYNDRGTVKVKV
                     KVTPRLIPGVCSLPQGAWYTPDQSGVDVRGCINTLTKWTPNPLSKGNPQHTNLVQIEK
                     A"
     gene            201338..201910
                     /locus_tag="DSY_RS01020"
                     /old_locus_tag="DSY0187"
     CDS             201338..201910
                     /locus_tag="DSY_RS01020"
                     /old_locus_tag="DSY0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_005814880.1"
                     /db_xref="GI:492340795"
                     /translation="MAKQYGFYMDQSNCIGCFTCQIACKDKNDLEVGQCWRKVHEFQG
                     GDTILEGGVYRSNVFAYWLSMSCNHCQEPKCVQNCPAGAMYKREEDGIVLVDQNKCLG
                     CGYCTWSCPYGAPKLAGKTVSKCNFCIDLLEQGKNPACVDACIMRVIEFGPIDELRAK
                     YGNVDEVKGLPSAQITKPCIVISPHKKAIE"
     gene            201925..202743
                     /locus_tag="DSY_RS01025"
                     /old_locus_tag="DSY0188"
     CDS             201925..202743
                     /locus_tag="DSY_RS01025"
                     /old_locus_tag="DSY0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit C"
                     /protein_id="WP_005814877.1"
                     /db_xref="GI:492340790"
                     /translation="MHELPLLTFTLCLQAAVGAVLWAVVFRIKAQDAPLFKRNTLAAL
                     ILAAVGIVASLLHLGKPMLALTSMFNLATSWLSREIFFSGAFFGLLLIFWWVERREKA
                     PGARTALGVITAGVGLIDIYAMARLYMESIMPAWQNANTLISFYATAIVLGGIVFYVT
                     AGEQREKLPRVDLMLWAVVLVQAAFALGYVASLGALSGAGKETAALLAGSQATLILSW
                     LFTLGGVFLLSLSRTGRLAKQTSFLYLAMAVIVVGEIVGRYLFYTSGIPIGLGL"
     gene            203124..206717
                     /locus_tag="DSY_RS01030"
                     /old_locus_tag="DSY0189"
     CDS             203124..206717
                     /locus_tag="DSY_RS01030"
                     /old_locus_tag="DSY0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_005814875.1"
                     /db_xref="GI:492340786"
                     /translation="MGVLLADVHGFVLPERKDFLKTLSHYLRLGFDIEAVDKAVSYKE
                     WPQMIYNLTGSQKPAFAAQLIQKGKPGLIITYSEELAQKWVNDLRSWLPGEDVLYFPS
                     SEWLPFEVLGKSRETTIERIRVLNRLAQDNQCTVVVPALAVNQRSFSRRRWQEYILEL
                     KEGTSYDLKDLAQKLSTAGYERLDVVDGKGQFAIRGGIMDIAPLDGEPLRVEFFDDEV
                     DSIRVFDLETQKSTETLKSVKIPPALEVVIRPEELEKLGWEVRAQARKQAGRLNRSGR
                     SDVAEQVMKQAQRIEERLKTGRVDESIYPYLSLLEEPLEPFFSLLSQDHYVILDEPLR
                     LKEQLEFQQKERLEEYTQALAKGEEFYSPEDQFVSYEQFLRYGEKHPFVLISTLPREI
                     PGVAPKRIFNLNARPLTGFMGKTGILVDEIEHWQKSGHIVNLFVGDEEHAERMLQGLR
                     DRGALAKKHELHEPVQEGGVYVYSSSLDQGFELPLSKLIVLSEAEIYKRERKAAVKRK
                     KAPEKTGQRLQFADLKPGDFVVHVHHGIGQFMGIERIAVGGVEKDYFSVKYAGQDKLY
                     VPLDQLNFLQKYLGSDAETLPKLYKLGGSEWKKVKAKAKSAIKEMAFDLVKLYAQREA
                     TKGYAFSPDNVWQQEFEEKFPYQETPDQMQCIVEVKQDMMRQRPMDRLLCGDVGYGKT
                     EVALRAAFKAVMDSKQVAVLVPTTILAQQHFNTFQERFMGYPVSIQMLSRFRSAKEQK
                     LILQGLKEGSIDIVVGTHKLVSDSIKFKDLGLLIVDEEQRFGVAHKEKLKTLKANVDV
                     LTLSATPIPRTLHMSLVGVRDLSIIETPPEDRFPVQTYVAEFRPDVVREAIRREIQRG
                     GQVFFVHNRVEDMEQVVHFLSQLVPEARYGIAHGQMSEKELEQEMLAFLEHESDVLVC
                     TTIIETGLDMPNVNTLIIDEADRLGLGQLYQLRGRVGRSNRRAYSYFLYKPQKVLTEV
                     AEKRLAAIREFTEFGSGLKIAMRDLEIRGAGNLIGAQQHGHLAALGFELYSQMLKEAV
                     QELKGEQVEEKIETSIEVQVDAYLPDIYIGERQLKAALYQRMVAIDNEEDLSMMIDEL
                     IDRFGTPPREVENLLKIVRIKWMASGMKIEQIQQLKQQMVFRFAADPGISGEMLMTMA
                     TQSPYPVSFGTTGNGNLEIKVRLRSVVQEELLEAIHKVLMVFNGIASKTAS"
     gene            206756..207703
                     /locus_tag="DSY_RS01035"
                     /old_locus_tag="DSY0190"
     CDS             206756..207703
                     /locus_tag="DSY_RS01035"
                     /old_locus_tag="DSY0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_005814873.1"
                     /db_xref="GI:492340784"
                     /translation="MRSFRKGIIAALVLTLALTGCSSAGGDQWAAKVNGETITEQDFA
                     ARVSNVQKAYEGMGMDFSTDQGKEALNQVKSQVLEAMIASRLVIQEAQRLKLDVNDPS
                     ILEQEKNIIQMVGDESQYQEWLKQQAMTEDEVKNYFALSAEITKDVTVTPEQEKTFFE
                     NNQELYGGKGEEVQARHILVETEDEAKAIIAQLDGGADFSELAKEKSTDTGSQSSGGY
                     LGSFGKGKMVPEFEEAAFAQEVGTYTKTPVKSEFGYHIILVEDHKAATKADYEAVKSQ
                     VAEDALADAKAQKFGGYFDELREKAKANIEYSEKYKPAA"
     gene            208018..208560
                     /locus_tag="DSY_RS01040"
                     /old_locus_tag="DSY0191"
     CDS             208018..208560
                     /locus_tag="DSY_RS01040"
                     /old_locus_tag="DSY0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage V sporulation protein T"
                     /protein_id="WP_011458938.1"
                     /db_xref="GI:499778204"
                     /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEV
                     ILKKYSPIGELGDFAKEYADSLYEATGHIACIADRDVIIAVSGASKKEYLNKPIWSSI
                     EQAMAERKTVQLKAGEGKPDEDEEHVKLTSQVAAPIIAEGDPIGAVILMSKDPNVKMG
                     DLELKLVETAAGFLAKQMEQ"
     gene            208687..210168
                     /locus_tag="DSY_RS01045"
                     /old_locus_tag="DSY0192"
     CDS             208687..210168
                     /locus_tag="DSY_RS01045"
                     /old_locus_tag="DSY0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide pyrophosphohydrolase"
                     /protein_id="WP_011458939.1"
                     /db_xref="GI:499778205"
                     /translation="MSNILHVVGLGPAGLESMTLGDYRMIKEAGRVFLRTVNHPCAQD
                     LLAEGLQAESFDYLYERENSFERIYEEIVSRLEKECELYPEVVYGVPGHPTVAERSVV
                     LLVDKLSERFQVKVHPAVSFLDPLFAAIPLDPVEGFLLRNYDALKGSGITGKEWLIIP
                     QVYDGFIASEVKLDLMDIYPDEVELYVVQALGTKMQKVWQCPLYQLDHQTFDHLTTVV
                     VPPCGEGISMTKLLEVMSTLRGRGGCPWDAEQTHDSLKPYLIEESYEVLEAIEAQDMY
                     NLAEELGDLLLQVVFHAQVAQEAGEFQFQDVLKGIIDKMIRRHPHVFGDVRVQNSAEV
                     LSNWDQIKKEEKGEKAEEELFSFPKGLPALMLAVKTQKKVAKFGFDWPDLKGPLAKVY
                     EELKELEEAMAEQKGIQEEFGDILFALVNLSRFIKCDPEDSLRQTIRKFQLRFLEMAK
                     LAGQAGEGLGDLNLEKMDYYWEIAKSKEKNKEIGNNPEIKAGV"
     gene            210226..210501
                     /locus_tag="DSY_RS01050"
                     /old_locus_tag="DSY0193"
     CDS             210226..210501
                     /locus_tag="DSY_RS01050"
                     /old_locus_tag="DSY0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_005814866.1"
                     /db_xref="GI:492340774"
                     /translation="MNKADLVAAVAEKAEVSKKDAEKAVNAVFASIEEALAKNEKVQL
                     VGFGTFEVKDRAERTGRNPQTKEAIVIPASKVPGFKAGKALKDAVQQ"
     gene            210589..210861
                     /locus_tag="DSY_RS01055"
                     /old_locus_tag="DSY0194"
     CDS             210589..210861
                     /locus_tag="DSY_RS01055"
                     /old_locus_tag="DSY0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458940.1"
                     /db_xref="GI:499778206"
                     /translation="MRIDKYLKVSRLIKRRTVAKDICEGEKIRLNGRIAKPSAEVKPG
                     DIVTLEMARHLLEVRVLSTPNSAKANEAHLLYEVLKDEKRGGQEEI"
     gene            211795..212064
                     /locus_tag="DSY_RS01060"
                     /old_locus_tag="DSY0195"
     CDS             211795..212064
                     /locus_tag="DSY_RS01060"
                     /old_locus_tag="DSY0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein YabP"
                     /protein_id="WP_015942592.1"
                     /db_xref="GI:506422873"
                     /translation="MEKNPSNHRLAMDNRQFLSLTGVSKVQSFDPKEILLETIQGVLS
                     IKGEKLGIKHLDLKAGQVEVEGLIDALVYPRNSGSRQNVWAKIFR"
     gene            212141..212629
                     /locus_tag="DSY_RS01065"
                     /old_locus_tag="DSY0196"
     CDS             212141..212629
                     /locus_tag="DSY_RS01065"
                     /old_locus_tag="DSY0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore cortex biosynthesis protein YabQ"
                     /protein_id="WP_005809719.1"
                     /db_xref="GI:492324399"
                     /translation="MIWVVAAGAAVGFVFDFYRSLRKWLGWGKVMTVVGDLIFSAAAL
                     FLLFKFFLKANHLDLRFYIVWGSVLGLFLYTRILSRITLWLFFKCYRFIEACLGLILL
                     VLKFPFKVLAVLMRPPYAALRWFSLLVFRIAEAFLGKPLTKTRKTMISFWERLFPPRT
                     NG"
     gene            212838..213077
                     /locus_tag="DSY_RS01070"
     CDS             212838..213077
                     /locus_tag="DSY_RS01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit sigma-24"
                     /protein_id="WP_015942594.1"
                     /db_xref="GI:506422875"
                     /translation="MHLEIRGLEKLSFRERQAVILKESGKSQEQIAKKLHLSPSSVAT
                     LLNRAKGKGYEIVCIIPEAELGLGGFDLDEEESDN"
     gene            213046..213372
                     /locus_tag="DSY_RS01075"
                     /old_locus_tag="DSY0197"
     CDS             213046..213372
                     /locus_tag="DSY_RS01075"
                     /old_locus_tag="DSY0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458941.1"
                     /db_xref="GI:499778207"
                     /translation="MILTKKSPTTKESRPKTRKQPFRPLSTLVVLFAFCALVSSAYQL
                     YELRKEVNQSIAQLNQEKEDLLQQQKLLEEEILQLNTPSYIEQLAREQLGLVRKGEIR
                     IAPKTE"
     gene            213495..213881
                     /locus_tag="DSY_RS01080"
                     /old_locus_tag="DSY0198"
     CDS             213495..213881
                     /locus_tag="DSY_RS01080"
                     /old_locus_tag="DSY0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein S1"
                     /protein_id="WP_005809726.1"
                     /db_xref="GI:492324413"
                     /translation="MAIAVGTIVEGVVTGITNFGAFVELPEKVTGLVHISEVADAYVK
                     DVRDYLKEQDRVKVKVIHVDEKGKIGLSIKQANPSPKNTTRERRQPTVSFEDKLAKFI
                     KDSDERQLEFRRATESKRGGRGSSRY"
     gene            214152..216245
                     /locus_tag="DSY_RS01085"
                     /old_locus_tag="DSY0199"
     CDS             214152..216245
                     /locus_tag="DSY_RS01085"
                     /old_locus_tag="DSY0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein phosphatase"
                     /protein_id="WP_041272189.1"
                     /db_xref="GI:752602802"
                     /translation="MAEWATLKTKQGLRKEKLTLEGHFWPFLLGLLIARGSILGLYPF
                     GIAFGAALMLHGRKGTMMGLLGVTAGVSSLFLKDLASGLQILLTLLILSLFVPRLRGN
                     KRESLYLGISTALVTGCVALAVLSFGQFEVSLGMQAAVLGILNGGLAVVFRFALRYQD
                     AVWRGNFTREQGMAWLLILIGVLSGLHGVMFKEINFSVVVLSFFILFIAQRFGAGAAA
                     GVGAMLGFLPQLEFNPQNLMAAGIYGLAGFGTGAFQKLGKLGLGVAFMSITLMFTVYL
                     QPEVLYSQLLSSGIGLLLFLLFPSTTSQHDFLKDKPMPEVESTVTKVKTVAEIFDQIA
                     YSAQAAEAEVGKSKPEIPELMNVLVERVCKNCPTLDTCWTREFYRTYHLLFNLFEWVE
                     REEEKVNVQNLPVEWKRHCGKLKEMLLGVQFIMEHEKSIESWRSRLTANQEALARQFQ
                     SVSQVIGHLAKELNARHNVEQVKPASLARRRKQFLDVGVASFTKKGNSISGDNYASLA
                     FAPTQHAFIVSDGMGVGEGAAKMSSTALNLLEQLLTTGFEPESAIQALNSILVLRSPE
                     ESFVTLDIGILDCESDDLKLIKVGACPSYIVREDKVHIFQSSSLPVGILNHVEIPVIE
                     EKLRPDEYLVLVTDGIQDILKDGKDWLKKFLDRQHPQTAQELAEAIVQEARAMSGNDL
                     ADDGIVLVVKKNIFH"
     gene            216268..217686
                     /locus_tag="DSY_RS01090"
                     /old_locus_tag="DSY0200"
     CDS             216268..217686
                     /locus_tag="DSY_RS01090"
                     /old_locus_tag="DSY0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="WP_011458943.1"
                     /db_xref="GI:499778209"
                     /translation="MYEKLKQQVLPQLIAPGSRILAAVSGGPDSVALAHILWRYIQDK
                     QEQKITLVITHVHHGVREESDDEEKMVQNMARDWEIPCLIHRFDSKNYAKSVGKSFQT
                     AAREWRYACWQEDMRKENCTLLATAHHLGDQAETVLYRLLRGSGTAGLAGIYPQKGKL
                     IRPLLTVTKEDILEYCRNEKLPYALDHSNEEPVYVRNKIRLQLLPELQREYNPKIIEA
                     LGRTAEVLRWDEEYLEEEVQSAWKRWAILDTEQRVGLRRTIFELPKAILSRLIRRAAT
                     LVSGEPRGIAFQYVEQVMASQGQVGWSQDLPGLNIGIDYQGVWFQRADWGQSINESPD
                     ILLPSLPVGAHWGEWLPWRDEAGVNWLVGLFCLEKEAEDNDYPGQCVDKVFFDGPGLI
                     RNSEKLQWRYRQEGDCLWLAGLGHKSLKKIFQDAKVPAKHRPVIPLLAMGNEILWIPG
                     VKRGDRYPLEQGKGAVGVLIKC"
     gene            217829..219802
                     /locus_tag="DSY_RS01095"
                     /old_locus_tag="DSY0201"
     CDS             217829..219802
                     /locus_tag="DSY_RS01095"
                     /old_locus_tag="DSY0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_011458944.1"
                     /db_xref="GI:499778210"
                     /translation="MKFFKNAAVYLLIILIAIMLIRFANPPATQPLDMDYTKFYEAVV
                     TGQVEEVVISTDDNVNTYEVKTKDGQQYVVLGEAKDVDLSAQMNEHKVNVRVNPPVTT
                     PWWAGLITTVLPFLLIGGFIFFMMQQSQGGGNRVMQFGKSRAKLVTDEKKKVTFADVA
                     GADEVKEELEEVVEFLKFPKKFNELGAKIPKGVLLFGPPGTGKTLLARAVAGEAGVPF
                     FSISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAGLGGGHDER
                     EQTLNQLLVEMDGFNGNEGIIIIAATNRPDILDPALLRPGRFDRQVVVDVPDVKGREE
                     ILKVHVKGKPMHSDVELDVLARRTPGFTGADLANLVNEAALLSARRNEKEIKMNALED
                     SVERVIAGPEKKARVISDYEKKLVSYHEAGHALVGEMLTHTDPLHKVSIIPRGRAGGY
                     TLLLPKEDRNYMTKSHLLDQVTMLLGGRVAEALVLHEISTGASNDLERATGLVRKMIT
                     ELGMSEELGPLTFGQKEGQVFLGRDIARDRNYSEAVAYSIDKEARRMIDECYLKAQTI
                     IQENMHKLNAIAETLMEKETIEAKEFAELMARFDQPVETAQVPEPSETENNTTEHDDL
                     LPATEETSVEEEGRTEAEGLSGSTLEEEKNKID"
     gene            219814..220263
                     /locus_tag="DSY_RS01100"
                     /old_locus_tag="DSY0202"
     CDS             219814..220263
                     /locus_tag="DSY_RS01100"
                     /old_locus_tag="DSY0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8FZD1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="WP_005809738.1"
                     /db_xref="GI:492324432"
                     /translation="MEKTFIMLKPDAVQRGLVGQIIARFETKGCKLVGMKLMSVDQAL
                     AEQHYAEHKGKSFFEPTVQYIMSSPVVAMVWEGKNVVALARELMGATNPANANPGSIR
                     GSFGMDISRNVIHGSDSVASAEREIALYFRPEELCDYRKAGEEWLSE"
     gene            220372..221082
                     /locus_tag="DSY_RS01105"
                     /old_locus_tag="DSY0203"
     CDS             220372..221082
                     /locus_tag="DSY_RS01105"
                     /old_locus_tag="DSY0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809740.1"
                     /db_xref="GI:492324435"
                     /translation="MNLPKNGKMMLTVAGLILGILFISLLKTTGAAGSTARTDTTLAS
                     LIQIGQENEQLKNDISKLKEDLSKFQAGQNASKVVLEQLDTAKRNAGLTKVTGPGLRI
                     TLDDAQDRDINNEDIQYYVIHEEYIRTIVNLLWHGGAEAVAVNGQRITGNTEIFCSGA
                     FIQIGQTRQMPPYVIEAVGDVNYLQSSLNFYFWDRLGEYQEQYGITRKLEVPTEPLVI
                     PAGKAQQFRYSEPMKEAK"
     gene            221082..221774
                     /locus_tag="DSY_RS01110"
                     /old_locus_tag="DSY0204"
     CDS             221082..221774
                     /locus_tag="DSY_RS01110"
                     /old_locus_tag="DSY0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809742.1"
                     /db_xref="GI:492324438"
                     /translation="MKKRTLAIPLTLVALVLGFLLTLQMQTQKSVLELEKIQAQRAAS
                     ARDFLAEAQEENKLLKEQHTALTAQLEEARTQGGTSPALLAELDRYRMMEGTVNVQGP
                     GIVITIDDRQQEHKVVLPMSNEDLLEIINTLKFAGAEAISVNGQRVVASSAIVLSGTS
                     TKLINQVPITRTEGVPYEILAIGNQDQLLDYFTQLKAQRLKQLGMSVSVSRKTVQIPS
                     YKGVSPVKSPES"
     gene            221957..223627
                     /locus_tag="DSY_RS01115"
                     /old_locus_tag="DSY0205"
     CDS             221957..223627
                     /locus_tag="DSY_RS01115"
                     /old_locus_tag="DSY0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015260661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Formate--tetrahydrofolate ligase 1"
                     /protein_id="WP_005809743.1"
                     /db_xref="GI:492324441"
                     /translation="MKTDIEIAQEATMKPITEIAQGLDLLEDEIELYGKYKAKVNFSA
                     WERLKDKPDAKLILVTAINPTPAGEGKTTTTVGLGQAMSKIGKNAMIALREPSLGPCF
                     GVKGGAAGGGYAQVVPMEDINLHFTGDFHAITSTHNLLAALLDNHIQQGNLLNIDPRQ
                     IVFRRVMDMNDRALRKIVIGLGGRTEGIPRENGFDITVASEIMAILCLAKDLMDLKER
                     FGRIVVAYTYDGKAITAHDLEAEGAMALLMKDAIKPNLVQTLENTPVFIHGGPFANIA
                     HGCNSVVATRMAMKLADYVITEAGFGADLGAEKFYDLKCRFAELKPAATVIVATVRAL
                     KMNGGVAKEDLGPENLEALAKGIVNLEKHIENIGKFGVPAVVAINRFPTDTDAELEFV
                     AERCRQLGAEFALSEVFTKGGEGGIELAKAVLNIVDNKESNFHVLYELDLPIAKKIET
                     ICKEVYGADGVNFTKEALTSMKKYEELGYGQLPICMAKTQYSLTDDQNVLGRPSGFTI
                     TVRELRLSAGAGFLVAITGAIMTMPGLPKRPAALRMDIDAAGRITGLF"
     gene            223784..224338
                     /locus_tag="DSY_RS01120"
                     /old_locus_tag="DSY0206"
     CDS             223784..224338
                     /locus_tag="DSY_RS01120"
                     /old_locus_tag="DSY0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_005809745.1"
                     /db_xref="GI:492324444"
                     /translation="MIPMPRVNRILQHRNYEEFTEKNKQAEQKRIYCRHGSDHGLAVA
                     RIAYLYLLEKYIEDRDSLPGTGTNKASVRLEESYGLGKESIYAAGILHDIGRWVEYEN
                     QEDHALAGARLARPILKDCGFTEAEMEKIVLGISEHRLPPDQTSSILGQALALADDWA
                     RDCQSCSSKATCYKYTKAMEDILI"
     gene            224370..225593
                     /locus_tag="DSY_RS01125"
     CDS             224370..225593
                     /locus_tag="DSY_RS01125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_005809746.1"
                     /db_xref="GI:492324446"
                     /translation="MKDYSPRWISLNNETEAKKAMQQIGSDPGGIAHMVGKPIGRALK
                     LENVPLPAAHIIKQEMLSLGGDAAVHRNVIVNKIEASDILLVGTAKHFRRLSQKLAAQ
                     PFGLKDLGKSLKGLLDALEPPKQRVLPCRGKDIVLGERTLIMGILNLTPDSFSDGGKF
                     NTLERALKQAEALVEQGADILDIGAESTRINHEPVSAEEEWERLEAVLKALLPRIAVP
                     ISVDTYKADVAERALAAGVHMINDVWGLQKDPRMAEVVGRAQAPVIVMHNQEGSNYHH
                     LMGDIMAYLKKSIHLAEEQGLAGDQIIIDPGIGGTAFGKSLDIDLEIMSRLEEFRSLG
                     RPILLGTSRKSMIGQTLNLPTEERLEGTLATSVVGVAAGVDILRVHDVQANKRAVQMA
                     DAIYRRKRGENFSGS"
     gene            225583..225951
                     /locus_tag="DSY_RS01130"
                     /old_locus_tag="DSY0208"
     CDS             225583..225951
                     /locus_tag="DSY_RS01130"
                     /old_locus_tag="DSY0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="WP_005809748.1"
                     /db_xref="GI:492324450"
                     /translation="MDRDRIALRGLKFFAYHGMLREEKILGQTFIVDIDLYADLSKAG
                     KSDQVEDTINYAEVYARIKTIVKREKYQLIERLAERIAEDVLGEFPCEGVRVVIHKPQ
                     APIPGIFDEAFVEIYREKKR"
     gene            225948..226421
                     /locus_tag="DSY_RS01135"
                     /old_locus_tag="DSY0209"
     CDS             225948..226421
                     /locus_tag="DSY_RS01135"
                     /old_locus_tag="DSY0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_005809749.1"
                     /db_xref="GI:492324452"
                     /translation="MKAYLSIGSNLGDRGHYLQQSCQRLAEHPDVKIIKKSGTYETKP
                     WGNVDQPDFWNQVLEIETSLAPLDLLNLCQEVEKSLGRERLIRWGPRTIDIDLLNYDN
                     KVWEDERLILPHPRMEEREFVLAPLREIAPHYILPSGKKVTEVCGDGEVWRLESK"
     gene            226652..227530
                     /locus_tag="DSY_RS01140"
                     /old_locus_tag="DSY0210"
     CDS             226652..227530
                     /locus_tag="DSY_RS01140"
                     /old_locus_tag="DSY0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent glycerol-3-phosphate dehydrogenase
                     domain-containing protein"
                     /protein_id="WP_015942601.1"
                     /db_xref="GI:506422882"
                     /translation="MNFGIIGAGIVGTAIAIRLRQAGHHLVGVHSRSRRSYERFCTYL
                     HHGERRPLEEWLPEADLLFITTQDCMIRAAAEELTRRGLYKEGQTWIHCSGSVSSRVM
                     QVDKDLPINYLSLHPLQAFAGIDQAVELIPGTHFGIEGDREDIGLAIVTQLGGIPHQL
                     DPQQKPLYHAGAVVASNYLVTLVGLAVQLFEEAGITNQEALESLLPLMKGALQNLENV
                     GLPQALTGPIARGDVDVIRGHLEHMPAKIDPVYRALGLYTLDIGQKKMELNGGAYAKE
                     VWEEMNSLMVKGTNEL"
     gene            227527..228375
                     /locus_tag="DSY_RS01145"
                     /old_locus_tag="DSY0211"
     CDS             227527..228375
                     /locus_tag="DSY_RS01145"
                     /old_locus_tag="DSY0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate synthetase"
                     /protein_id="WP_011458948.1"
                     /db_xref="GI:499778214"
                     /translation="MIICKKISAVRDIVKEQRGQGRSIALVPTMGYLHEGHLTLVEEA
                     RKSGAFVVMSIFVNPLQFGPNEDFARYPRDLERDAKKAEGAGVDLIFNPEVEEMYPAK
                     NLTHVEVDELGDSLCGASRPGHFRGVTTVVSKLFHIVQPDRAYFGQKDYQQYLIICQM
                     VKDLNFPIEVIGVPIVREEDGLALSSRNIYLSPEQRAEALVLQRSLGEAENWFRQGER
                     SALSIEERIKELIRNESSGEIDYVEIRSAENLHRVEQIEGKIFIALAVRFGSTRLIDN
                     KVLEGM"
     gene            228376..228759
                     /locus_tag="DSY_RS01150"
                     /old_locus_tag="DSY0212"
     CDS             228376..228759
                     /locus_tag="DSY_RS01150"
                     /old_locus_tag="DSY0212"
                     /EC_number="4.1.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q251P1.1"
                     /note="Converts L-aspartate to beta-alanine and provides
                     the major route of beta-alanine production in bacteria.
                     Beta-alanine is essential for the biosynthesis of
                     pantothenate (vitamin B5); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="WP_011458949.1"
                     /db_xref="GI:499778215"
                     /translation="MFRTMMKSKIHRATVTEANLKYVGSITIDEELLEVADILPNEKV
                     QVVNNNNGARLETYVIPGKRGERTVCLNGAAARLVQVGDEVIIIAYGIFTDEAARTYE
                     PKVIFVDEGNNPVKIAHEEIHGQQS"
     gene            228918..230544
                     /locus_tag="DSY_RS01155"
                     /old_locus_tag="DSY0213"
                     /note="aspartate oxidase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            230510..231394
                     /locus_tag="DSY_RS01160"
                     /old_locus_tag="DSY0214"
     CDS             230510..231394
                     /locus_tag="DSY_RS01160"
                     /old_locus_tag="DSY0214"
                     /EC_number="2.4.2.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942603.1"
                     /note="catalyzes the formation of
                     pyridine-2,3-dicarboxylate and 5-phospho-alpha-D-ribose
                     1-diphosphate from nictinate D-ribonucleotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="WP_015942603.1"
                     /db_xref="GI:506422884"
                     /translation="MFAPFQYQELIERALQEDLGTGDLSSAIFPKTAKTHAKIYAKQK
                     GIACGLEITKQVFKTVDPELEVSISKADGELVERGTVVMEITGAICSILSAERTALNF
                     LQHLSGVATATFEAVTECYGLPTRITDTRKTIPGLRMLQKYAVAMGGGQNHRFGLYDA
                     VMLKDNHIAAAGGIRPAVAAARSRIGHMVKIEVECENLEQVQEAVAAGAEVIMLDNMN
                     LETMGKAVEIVQGRAVVEASGGIRKGDLRAVAETGVDVISMGAITHSVQAMDFSLDIG
                     DIKALTKERWEKGENCAK"
     gene            231384..232364
                     /locus_tag="DSY_RS01165"
                     /old_locus_tag="DSY0215"
     CDS             231384..232364
                     /locus_tag="DSY_RS01165"
                     /old_locus_tag="DSY0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458952.1"
                     /db_xref="GI:499778218"
                     /translation="MRNKILDVLKNQQGEFVSGESLSQALSITRAAVWKQIQGLKEAG
                     YEIEGQTRKGYRLVGTPCALDLWALQQELRTQALGRQLFFFAELSSTNDLLKDMVRQG
                     REHGTVVIARRQTTGHGRMQRAWESPEGGLWLSLLLKPRLSLGDAAKLTLSTGVALAQ
                     TLQDLYGLAAGIKWPNDVVVQGRKIAGILGEVAGEWTTVQTLILGIGVNANFSGQTFS
                     SKLPATTLQDILGYEVNLNHLAAQLLFNLEKEVQSLEQGDVQGLIQRWTSFAVGINQP
                     VRIERAGTVYAGIFKGIREDGELILDLEGQEMTFSSGEVSLRAGDQYSPE"
     gene            232420..233196
                     /locus_tag="DSY_RS01170"
                     /old_locus_tag="DSY0216"
     CDS             232420..233196
                     /locus_tag="DSY_RS01170"
                     /old_locus_tag="DSY0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase"
                     /protein_id="WP_005809761.1"
                     /db_xref="GI:492324470"
                     /translation="MILVFDVGNTNIVLGVYEQKDLIYHWRISTDKSRTVDEYAVIIK
                     NLFDLNGLDMSRIKAVVMSSVVPPVMPTLESLARKYFDVEPLVIGPGVKTGMPIVYDN
                     PREVGADRIVNAVAAYHKYGGPLVIVDFGTATTFCAISKRGEYLGGAIAPGVGISTEA
                     LFQRASKLPRIEIVKPKSIIAKNTVAGMQSGIYYGYTGQVDRIVTLMKQELGRDTRVI
                     ATGGLAELIQEDSQEIETVDPFLTLEGLLLIYERNSNQQP"
     gene            233215..234180
                     /locus_tag="DSY_RS01175"
                     /old_locus_tag="DSY0217"
     CDS             233215..234180
                     /locus_tag="DSY_RS01175"
                     /old_locus_tag="DSY0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942604.1"
                     /db_xref="GI:506422885"
                     /translation="MRLGKFELGIPAFLAPMAGVTDKAFRETVRSVGGLHVWTEMISD
                     KALTYMNSRTLEMLDLSGEASPRIVQLFGSEPEVMAKAAALAVERDAEIIDINMGCPT
                     PKIVKNGEGSALLQDLPLAQRIAEAVVKAVEVPVTVKMRLGWTAERIVAPELAKRVEA
                     VGVQMVSVHGRTREQFYAGTANRDGIKKVKGGVSIPVIANGDIFSPQEAKTVLEATGC
                     DGVMVGRGSLGNPWLIPQINVFLNKGVLLEEPSLEQKLKVATEHFERVLNYKGERIGL
                     NEMRKHAVWYIKGIRNAAQMRDYIMQTKTPLEMKNLFRRILQENA"
     gene            234379..234849
                     /locus_tag="DSY_RS01180"
                     /old_locus_tag="DSY0218"
     CDS             234379..234849
                     /locus_tag="DSY_RS01180"
                     /old_locus_tag="DSY0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_005809765.1"
                     /db_xref="GI:492324476"
                     /translation="MAEKEVILTIEGLKRLEDELETLKTVKRREVAERIKQAIEFGDI
                     SENSEYDDAKNEQAFIEGRIITLEKMLRNARVIDDLEGSEVVALGTTVILKDKEFGEE
                     EEYTIVGSAEADPGSNKISNESPVGKAVLGQPKGTVVEINVPAGILYYEIVDIR"
     gene            235042..236508
                     /locus_tag="DSY_RS01185"
                     /old_locus_tag="DSY0219"
     CDS             235042..236508
                     /locus_tag="DSY_RS01185"
                     /old_locus_tag="DSY0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="WP_005809769.1"
                     /db_xref="GI:492324482"
                     /translation="MDEMNDLWRVRLDKLAQLRENGVEPYADRYQRTHMAQEILDGFD
                     TLEGQEVKIAGRMMSKRDQGKVVFTHIQDFSGQIQAYIRKDDVGEDWFELISKFDIGD
                     IVGIKGTVFRTRRGEISVHANEVQILSKSMRPLPEKFHGLTNVELRYRQRYVDLIMNP
                     EVRNVFVMRSKIIRSMRNFLEGQGFLEVETPTLHTIPGGAAARPFITHHNTLDMDLYL
                     RIALELPLKRLIVGGFDKVFEIGRNFRNEGISIKHNPEFTMMELYQAYANFEDIMELT
                     ENMISAIAKEVHGTTEVTYQGQMIDFKTPWRRLPMLEGILEYGGVDFSQIHTDEEAQQ
                     AAKEKGLKVEPGSSRGKIINEFFEEFVEPNLIQPTFVIGHPVEISPLAKRNAEHPEYT
                     DRFEAFAYGRELGNAFSELNDPIDQRQRFEAQVAERDKGDDEAHMMDEDFVQALEYGL
                     PPTGGLGIGIDRLVMLLTDSASIRDVILFPTMRPREDD"
     gene            236993..238667
                     /locus_tag="DSY_RS01190"
                     /old_locus_tag="DSY_16SrRNA1"
     rRNA            236993..238667
                     /locus_tag="DSY_RS01190"
                     /old_locus_tag="DSY_16SrRNA1"
                     /product="16S ribosomal RNA"
     gene            238891..238966
                     /locus_tag="DSY_RS01195"
                     /old_locus_tag="DSY_tRNA5-Ala"
     tRNA            238891..238966
                     /locus_tag="DSY_RS01195"
                     /old_locus_tag="DSY_tRNA5-Ala"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:238924..238926,aa:Ala,seq:ggc)
     gene            239065..241982
                     /locus_tag="DSY_RS01200"
                     /old_locus_tag="DSY_23SrRNA1"
     rRNA            239065..241982
                     /locus_tag="DSY_RS01200"
                     /old_locus_tag="DSY_23SrRNA1"
                     /product="23S ribosomal RNA"
     gene            242120..242236
                     /locus_tag="DSY_RS01205"
     rRNA            242120..242236
                     /locus_tag="DSY_RS01205"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(242655..244280)
                     /locus_tag="DSY_RS01210"
                     /old_locus_tag="DSY0220"
     CDS             complement(242655..244280)
                     /locus_tag="DSY_RS01210"
                     /old_locus_tag="DSY0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_005808965.1"
                     /db_xref="GI:492321110"
                     /translation="MQRNKDVYVSNSKRNQALRLISHIAREMENVLNQSPHGDWAQVI
                     GPLRQVIDANIGDNEFLVINSLEGQALVHSNRFREGNFVTKGELGILGTTKPVSQIYH
                     RDTGEILLDVICPIYIKGEHRYVARMGIPLQKNKLSYNFALSSIPLFVLGLGWSWSSP
                     SLISIGVTLGAFTLWAAYSYIFHHKIISTLNEIFRVTKSITRGNLTNSAAIKTTNELS
                     TLSYEVNKVNNGIKSIIANITTISQKSHEISNSQAAHTKTLAESYEQLAALFQEFSAG
                     SVEQIDGMKRASEQVLEIQAASERIRYSTQEVQISSNSARQVSQDGLRAVEDIIQEME
                     VISSSTYKANTSIQSLEEQALKIGEIVSIINSISGQTNLLALNAAIEAARAGEHGRGF
                     SVVADEIRKLASDSAESAHQIMELIHSVQDMIGSASNDMSRGLVEVENGKIIIRQAGD
                     AIHSLDQVIQGTGEKIQANINNVDQLLLQSKNLAEVQSNAVSIASQFSLAAQQAATTM
                     DGQMQSTQQVASMAKDLAEASEQLDNFIKRFTL"
     gene            244851..246371
                     /locus_tag="DSY_RS01215"
                     /old_locus_tag="DSY0221"
     CDS             244851..246371
                     /locus_tag="DSY_RS01215"
                     /old_locus_tag="DSY0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine-phosphoribitol ligase"
                     /protein_id="WP_026198836.1"
                     /db_xref="GI:648507085"
                     /translation="MNLISRIDSYAESCPDRVAHHYRESRLTYRQLKEASDALACYLI
                     ETLKDDRTPIVVYGHKQHEMLICFLACVKSGHAYIPVDFSLPSQRIEDIIQSSRTRLI
                     LSPGESPEREGIRTIRSDAISRLIRSYLGKSPSKDYQVKDHETYYIIYTSGSTGKPKG
                     VQITLANLESFVHWGVGVGRFPEAEVFLNQAPFSFDLSVMDLYLALTSGSTLYSIDKA
                     MIAEPKELFAHFKQSGLTVWVSTPSFAEMCLGDSSFNDELLPDLKVFMFCGETLSNQC
                     AEKLYRRFPQGKVINSYGPTEATVAVTALIVDLEMCARKEPLPVGRVKEDCRLLIVDS
                     EGVPQEEGSQGEIVILGASVSPGYYRNEEMTDKAFFARSWDGDVKRCYRTGDEGYLKE
                     GLLHYGGRIDFQIKLNGYRIELEDIENNLRKVEGVANAIVLPIKKDGRVHYLAGVVVP
                     NKKLDKREFEIGQMIKAELKNYLPDYMIPRKIMFRDSLPMTVNGKVNRAALMEEFQ"
     gene            246368..247516
                     /locus_tag="DSY_RS01220"
                     /old_locus_tag="DSY0222"
     CDS             246368..247516
                     /locus_tag="DSY_RS01220"
                     /old_locus_tag="DSY0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl transferase"
                     /protein_id="WP_005808967.1"
                     /db_xref="GI:492321112"
                     /translation="MIPYSNLFFFYIIGLILLPGICLGVMEKPLKLYGLAASLLIIGL
                     LFSDSKLQLFLLVLFYLGELFLVKGYSLLRPKYPQRWILWLTILLALIPLALSKWGHL
                     FTDRLLGFLGISYLTFKVIQMLLEISDGLIKEVKLVDFTYFLLFFPTLSSGPIDRSRR
                     FLSEVNQSIPRHEYLHRVYQGLRKLLLGAGYKFILGNSIYTYWLSKIPTEAHGLAETV
                     NYMYGYSFYLFFDFAGYSLMAIGISYILGVKTPENFDKPFISKDIKDFWNRWHMTLSF
                     WFRDYLYTRFVMASMKKKRFKNRYTASYLGYLLTMGTMGIWHGTEIHYLLYGLYHGGL
                     IVGTDYFQRHSALYKKYKNTPLWIGASTLVTFHLVCFGFLIFSGYLFK"
     gene            247548..247781
                     /locus_tag="DSY_RS01225"
                     /old_locus_tag="DSY0223"
     CDS             247548..247781
                     /locus_tag="DSY_RS01225"
                     /old_locus_tag="DSY0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C552"
                     /protein_id="WP_005808968.1"
                     /db_xref="GI:492321113"
                     /translation="MEEKILSLLERVCGTDEVRNERDMNLFEAGILDSLGVIELLVGA
                     EELGIKIEPTEIERTDIDTPAKIIAAFSKRVAG"
     gene            247778..248977
                     /locus_tag="DSY_RS01230"
                     /old_locus_tag="DSY0224"
     CDS             247778..248977
                     /locus_tag="DSY_RS01230"
                     /old_locus_tag="DSY0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DltD protein"
                     /protein_id="WP_005808969.1"
                     /db_xref="GI:492321114"
                     /translation="MKRFLPIVLALVISCLVVWGGNEILVSKIADNYDPSFGYKLNIQ
                     KNQGLILQRVGLEKGGSIPVYGSSELSGSTDPFQPVNFFAGQYEGVYYNLIGRGYCQS
                     LIHLINFGALGDSLKGEKIVFFLSPQWFSKTGITSDDFQKNFSQQQYLTFLNNEEISP
                     QLKRLTAQRVDSLLAQDESMDMRILSYLSANDAEQAQISLGALQPYYRLKEALLSTKD
                     HVQGYRTLVEESPLKGKDKSNMKPAIERSTVKIDWEAEKKRAQEVGKARSDNNQFGID
                     NGYFNDYLKEKLPNYKDSMHDQSYLESPEYGDLELLLSLCQELEIEPLFVSIPVNGLW
                     YDYCGFPRQDRAQYYEKVKQLVTKAGYEFADFSDHEYDPYFLRDTMHLGWKGWVEVNE
                     AILAYAR"
     gene            complement(249181..250704)
                     /locus_tag="DSY_RS01235"
                     /old_locus_tag="DSY0225"
     CDS             complement(249181..250704)
                     /locus_tag="DSY_RS01235"
                     /old_locus_tag="DSY0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:sulfate symporter"
                     /protein_id="WP_018306203.1"
                     /db_xref="GI:517117385"
                     /translation="MANAETQTMNLDPRTPLFTKADRMMYIHSAIGFAIMAIFWLAPA
                     AAPLTPIGMKLVGIFLGMVYLWSTVSCLWPSVLGLFLIGLSGFAGQGFAGMKAVVLTG
                     FGNDTVVMMLFIMVLFGAMDEVGCTQYIARWFLTRKIITGRPFAFLAVFYLGCYVLST
                     LVSPITSLLLLWPVSLKIMKTLGVERTDKIWPIFFVGMFFISAIGMPFFPFLSAQLVV
                     LSAFDAMTKGTMPVPYLPYMALNFIMSMLLIVTFLGAVKFIFRPDISKLKAIDAERIA
                     EQEKLPPMNIQQKIMMAVLPTFILMLLAPSFLPKSLAIVKLLGSLGTIGVAMFWIAIL
                     CFIRIGGKPIINFKEVAYRQLSWDVFFLVAAAVYAANAISHESTGVNAFVIQLLNPIL
                     GDASEMVFVAILFTAAIVLTNFANNAAMAIILMPIILAFCGQLGLPPIPIAMGVTQLV
                     FLAMLTPAACPHASMMFGRKDIYEVKDIMKYGFPMVTIGLLYFIFIGYPLAKFLFGA"
     gene            251108..252988
                     /locus_tag="DSY_RS01240"
                     /old_locus_tag="DSY0226"
     CDS             251108..252988
                     /locus_tag="DSY_RS01240"
                     /old_locus_tag="DSY0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_018306202.1"
                     /db_xref="GI:517117384"
                     /translation="MRTYLNTEKHLITLQAESEERFLAELRAGNYTAESPLVVKNPYI
                     INPLAAVICFNTDEETTAEITVKGKAIEGDLSHTFAAAKEHVLPVYGLYDDYVNTVVI
                     KLSNGKTSEVKIEVEELNVNKALYCRTTPEYFGKDFMLISTTTPLIESARTVGFDYAG
                     DLRWCITNLQSWDIKKLENGRLLYTSHRTVQKPYYNVGVMEMDFCGKIYKEYRLPGGY
                     HHDAVELENGNILAASDNDFNDSVEDFVVEIERATGAVIKSWDLQKILPRGQGKAGDW
                     NHHDWFHNNAVWYDKPTNSITMSGRHMDAVINFDYDSGALNWILGDPEGWSEEWQKYF
                     FKNVTKGDFDWQYEQHAARILPNGDVFLFDNGTYRSKNEATRVDPEQNFSRGVIYRID
                     TDKMEIEQVWQYGKERGAEFYSPYICNVDYYGEGHYMVHSGGIATYRGKHTDGLGAML
                     LNKYKDEHIHLTLESITVEVQNDQLKYELKVQGGNYYRARRVSPYDEKTNLVLGKGEL
                     LGGFGVTPEFMKVNFKDAETELSEKHNLNVILEEDRLAIRASFREGSQVFLELKGAEQ
                     SKFYNIPTEVHDVTAACVSFEEQNDNDFQFYVSREGLSGEFGIYLNIDSKRYDTHLSV
                     KL"
     gene            253185..254726
                     /locus_tag="DSY_RS01245"
                     /old_locus_tag="DSY0227"
     CDS             253185..254726
                     /locus_tag="DSY_RS01245"
                     /old_locus_tag="DSY0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_005808979.1"
                     /db_xref="GI:492321140"
                     /translation="MKIDHTKGKYYLDKSQGTPPSFWLDSTPKTNYPSLTGDISVDAV
                     VIGGGMAGISSAYLLTQEGLKVAVLETDRILQGTTAYTTAKLTSQHGLIYDKLLGQMG
                     AEKAKQYAEANESAIEFVAKLVEREAIDCDFTRQPAYIYTQQNKSKEKLEKEMKAAQQ
                     CGIDAHYVTELDLPLAVKGALRFDQQAQFHPRKYLLALAGKIAEKGGHIFEQTKAVDI
                     RGDGPFIVLTQQGSRVKADYVVMACHYPFNILPGLYVSRIYQEREYAVVVKAKEAFPG
                     GMYINAEEPARSLRGLPIPDGERILIVGEKHRTGHGKNLTEHYKNLMEFAQGLFTVEE
                     FPYYWSTQDCTTLDDLPYIGPISRSKPNLLIATGFRKWGMTHGTVAALIIRDRIVRGA
                     SPWQEVYAPSRSISLNFAASFMANSSLLAFDLVAGKLMRGKEIYSLRPGEAVIANMDG
                     RRVGLYMDSEANLHRVDTTCPHLGCEVQWNDAELSWDCPCHGSRYDVDGNPIEGPTLK
                     PLAKY"
     gene            254825..256522
                     /locus_tag="DSY_RS01250"
                     /old_locus_tag="DSY0228"
     CDS             254825..256522
                     /locus_tag="DSY_RS01250"
                     /old_locus_tag="DSY0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458957.1"
                     /db_xref="GI:499778223"
                     /translation="MDVQTMLFHFLGGLGLFLYGIKSMSDGLQAVAGDRLRVILEKGT
                     KTPLRGVLTGLIVTGLIQSSSGTTVLTVGLVNAGLLNLRQAIGIIMGANIGTTVTAYL
                     IGIKLEDYALPIIAVGVLILFFIKNKRLTYFGQVLLGFGLLFYGMSIMGDGLGPLKES
                     AYFIGLMSNVDNNPLLGVLIGTVFTCIVQSSSATIGVLQELANQGVVTYQQAVPILFG
                     DNIGTTITALLAGIGASVSARRAAATHFLFNFIGTFIFLPLTILGIFPLMVEQFTNFI
                     AFLIPGGGGWETLAIKMKIAQTHGLFNMTNTLMQLPFVGVLAAIVTKLIPEKDEVVVD
                     ANAQYLDRRFFGNPSVALANASREVMHMGKVAGQAVDNAMNYFFKRQSANRQYVIQME
                     SATDRLENQITEYVLKATSGTNLTKEQSDQRYRVLQVIGDMERVGDHSVNLIELTDYA
                     LENKVKFSEEAQKDLMEMFANVQDIYQASLDALQKNDVELAKKVLEYKKVLEYDDVID
                     EMEAKLRDGHIHRLNEGTCNGSYGAVFLNIISNLERIGDHSVNIAKYAMAEPKHKLT"
     gene            complement(256838..257398)
                     /locus_tag="DSY_RS01255"
                     /old_locus_tag="DSY0229"
     CDS             complement(256838..257398)
                     /locus_tag="DSY_RS01255"
                     /old_locus_tag="DSY0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase XerD"
                     /protein_id="WP_011458958.1"
                     /db_xref="GI:499778224"
                     /translation="MTVEPIRDKAQIRTLYNHLNQSHPKYAMIFKFGINTGLRISDII
                     TLKVSDIYGSKKQFKDYLVLTEQKTGKLKKIKLNDTLRKALNIYIHKQNLELMDYLFP
                     SQKGGYIGRIQTYRVLKHSALTLGIENFGTHSLRKTWGYWTYKLSQYNIGLVMDIFNH
                     SSQSVTLRYIGINQDQRDQLYDIVQL"
     gene            257623..258468
                     /locus_tag="DSY_RS01260"
                     /old_locus_tag="DSY0230"
     CDS             257623..258468
                     /locus_tag="DSY_RS01260"
                     /old_locus_tag="DSY0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458959.1"
                     /db_xref="GI:499778225"
                     /translation="MKSNGGESADMKRIVCPKDYYNEQGLLLSAKGTKITLSQFLRLQ
                     RKYDFLSETEANERTLASYEKIKQKICREDERYKRADDQLLDQASALLVNIVFESKRK
                     PWYMYLTALGNHINWLYTHSIDVALLSLMMAIESGVSQRSLWDLGVGGILHDVGKLLI
                     PKKIIQKRTELSDIEKDILRQHCELGVECTTDCAFPILSQDIIAQHHERLDGSGYPNQ
                     LQEGQINEYVKIVMIADAFDTITAGRPYRKTVEVEEALAYLEDQEGAFSRMYLETLKN
                     ILVRP"
     gene            258782..259099
                     /locus_tag="DSY_RS01265"
                     /old_locus_tag="DSY0231"
     CDS             258782..259099
                     /locus_tag="DSY_RS01265"
                     /old_locus_tag="DSY0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458960.1"
                     /db_xref="GI:499778226"
                     /translation="MLNRLFRELRIEFYWVKKELTRRWHLDTPIGIVGVIVLLSGLGL
                     FLLIGQGIAKIFRAAIPWVTGNSVSTVYWSSIGLALKVSFVFLVFATSLLLLFWLKTH
                     YRR"
     gene            259246..260523
                     /locus_tag="DSY_RS01270"
                     /old_locus_tag="DSY0232"
     CDS             259246..260523
                     /locus_tag="DSY_RS01270"
                     /old_locus_tag="DSY0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_005808136.1"
                     /db_xref="GI:492319618"
                     /translation="MDFMSGVTGSHLFNMIMIPVQLIIIFMTFYYFVLSMFGLFRRPD
                     KKVLEPEKSFALVVAAHNEEAVIGPLVDNLLNLDYPKELYDVFVVADNCTDKTALIAK
                     NAGALVHQRFNNEKRGKGYALEWMFHRLFKLERHYDAVIIFDADNLVNETFLVEMNSK
                     LCQGHQIVQCYLDSKNPYDTWVTNTFSITFWLSNRLLQLARYNTGFLNNVLGGTGMCI
                     STKVLKDLGWGATSLTEDLEFTMKALISGIKTTWAHDAIVYDEKPLTFIQAWNQRKRW
                     AQGQVDVAGRYFFPLIYKAFKERKLMYFDAAVHLFQPALVMIATFFMFVNLISGLQSS
                     YTQVFNVVMPWSGWQILSAFSLVFPVAALALERLPWRAYAGLILYPVFIYSWIPIVFL
                     GFVNRKDKSWSHTKHTRSIKYDDVVKEKKVSSS"
     gene            260717..261592
                     /locus_tag="DSY_RS01275"
                     /old_locus_tag="DSY0233"
     CDS             260717..261592
                     /locus_tag="DSY_RS01275"
                     /old_locus_tag="DSY0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="WP_005808139.1"
                     /db_xref="GI:492319626"
                     /translation="MSKETLMKMTESPGVFMGGETPYEEADAVILGIPMDYTVSFRPG
                     TRLGPLSIRNVSIGIEEYSVYLDKDLSDYAYCDCGDLSLPFGNVEKSLQVIEAAARQV
                     VEDGKFPIFLGGEHLVTYPLLKPFIEKYPELRVVHFDAHADLRTDYSGEPNSHATVMR
                     KISEALGPHRVYQFGIRSGTREEFLFAKEHNHLVVEEVLEPLKAVLPELKGKPVYVTL
                     DIDVVDPAFAPGTGTQEAGGCTSREIIKAVHALSELDVVGFDLVEVSPLMDTSERTAL
                     LAAKIVREAILSFVK"
     gene            261673..261748
                     /locus_tag="DSY_RS01280"
                     /old_locus_tag="DSY_tRNA6-Val"
     tRNA            261673..261748
                     /locus_tag="DSY_RS01280"
                     /old_locus_tag="DSY_tRNA6-Val"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:261706..261708,aa:Val,seq:tac)
     gene            261755..261830
                     /locus_tag="DSY_RS01285"
                     /old_locus_tag="DSY_tRNA7-Asp"
     tRNA            261755..261830
                     /locus_tag="DSY_RS01285"
                     /old_locus_tag="DSY_tRNA7-Asp"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:261788..261790,aa:Asp,seq:gtc)
     gene            261838..261913
                     /locus_tag="DSY_RS01290"
                     /old_locus_tag="DSY_tRNA8-Phe"
     tRNA            261838..261913
                     /locus_tag="DSY_RS01290"
                     /old_locus_tag="DSY_tRNA8-Phe"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:261871..261873,aa:Phe,seq:gaa)
     gene            261915..261989
                     /locus_tag="DSY_RS01295"
                     /old_locus_tag="DSY_tRNA9-Gly"
     tRNA            261915..261989
                     /locus_tag="DSY_RS01295"
                     /old_locus_tag="DSY_tRNA9-Gly"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:261947..261949,aa:Gly,seq:gcc)
     gene            261997..262070
                     /locus_tag="DSY_RS01300"
                     /old_locus_tag="DSY_tRNA10-Cys"
     tRNA            261997..262070
                     /locus_tag="DSY_RS01300"
                     /old_locus_tag="DSY_tRNA10-Cys"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:262029..262031,aa:Cys,seq:gca)
     gene            262088..262176
                     /locus_tag="DSY_RS01305"
                     /old_locus_tag="DSY_tRNA11-Leu"
     tRNA            262088..262176
                     /locus_tag="DSY_RS01305"
                     /old_locus_tag="DSY_tRNA11-Leu"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:262122..262124,aa:Leu,seq:taa)
     gene            262182..262258
                     /locus_tag="DSY_RS01310"
                     /old_locus_tag="DSY_tRNA12-Val"
     tRNA            262182..262258
                     /locus_tag="DSY_RS01310"
                     /old_locus_tag="DSY_tRNA12-Val"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:262216..262218,aa:Val,seq:gac)
     gene            262420..263256
                     /locus_tag="DSY_RS01315"
                     /old_locus_tag="DSY0234"
     CDS             262420..263256
                     /locus_tag="DSY_RS01315"
                     /old_locus_tag="DSY0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modification methylase"
                     /protein_id="WP_035213290.1"
                     /db_xref="GI:737228957"
                     /translation="MHKDRLVAPVVKWVGGKRQLLEDLTPLFPKRVMSYCEPFCGGGA
                     VLFKLQPDTAWVNDINSELIRMYEVIRDDVEELIRALGEHPNEEEHYYRVRDWDRDKE
                     KYGNLSKVQKAARVIYLNKTCYNGLFRVNNAGEFNTPFGHYKTPNIVNEHTLRAVSAY
                     FQRAQITFSSTDYAEVLAGVAKGTFVYLDPPYDPVSSTANFTGYAKGGFDRAEQIRLR
                     ECCDELDRRGIKFMLSNSATEFIKEQYGAYQITIVKAKRAINSNAAKRGQIDEVVVRN
                     YK"
     gene            263294..264550
                     /locus_tag="DSY_RS01320"
                     /old_locus_tag="DSY0235"
     CDS             263294..264550
                     /locus_tag="DSY_RS01320"
                     /old_locus_tag="DSY0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458963.1"
                     /db_xref="GI:499778229"
                     /translation="MFKKYDILSRIEAEGKFTISASQIKEYREPRLMAKFDHNINLPR
                     IFARNRLAILPISRGDYIISHFEAYQPFSSVDTSVTRVSLPPNLQSLSASHIPSEAIA
                     VNCALASGMLADFLEEKTLYATVSGRMGSGQFDFTIRNLRTQCPTEVAVSNSQIEIDA
                     ALEGVHSLSLLEAKRDLAEDFLVRQLYYPFRVWSGRVTKQVRPIFLVYSNGIFSLYEY
                     EFQDPNAYNSLVLVKHKNYSIEDTAIGAADLHDVAERTQLLQEPEIPFPQANSFERVI
                     NICELLSTQELSREQVTEEYAFDIRQTNYYTDAARYLGLVEKRYEEGRKPVYSLSSRG
                     KRIMQLSYQQRQLAFCEAILQHRVFRETFKLYMENGSLPDQNTIVSIMQQSDLYQIGS
                     MSTFVRRSTTVSGWLNWMLGLIGEEH"
     gene            264751..266202
                     /locus_tag="DSY_RS01325"
                     /old_locus_tag="DSY0236"
     CDS             264751..266202
                     /locus_tag="DSY_RS01325"
                     /old_locus_tag="DSY0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine decarboxylase"
                     /protein_id="WP_005808143.1"
                     /db_xref="GI:492319633"
                     /translation="MPSLRQSKAPVYEALLKYKSMRVVPFDVPGHKQGRGNPELTEFL
                     GEKCLSVDVNSMKPLDNLGHPVSVIKEGEELAAEAFGAHHAFFMVNGTTSAVQAMVMS
                     ACKLGEKIIMPRNVHRSAINALIISGAIPVYVNPGVNKELGIPLGMSVADVRKAIKEN
                     PDAKAILVNNPTYYGICSDLKTITELAHEHSMLVLVDEAHGTHFYFGENMPISAMAAG
                     ADMAAVSMHKTGGSLTQSSFLLIGKRLNVGRVRHMINLTQTTSASYLLLSSLDISRRN
                     LALNGQRIFDKALYLANYGRDEVNKLGGYYAFGKELNNGDSVYDFDCTKLSIHTRDIG
                     LAGIEVYDILRDDYGIQIEFGDIGNILAIISVGDRALALERLVSALAEIKRRYQRDKA
                     GMFDHEYINPVVVMGPQQAFYAQQRSLPIQESKGKVSGEFVMAYPPGIPILAPGEKIT
                     EDIIDYIAYSKAKGCFLTGTEDMDIENIKVVEE"
     gene            266205..267059
                     /locus_tag="DSY_RS01330"
                     /old_locus_tag="DSY0237"
     CDS             266205..267059
                     /locus_tag="DSY_RS01330"
                     /old_locus_tag="DSY0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808145.1"
                     /note="catalyzes the formation of spermidine from
                     putrescine and S-adenosylmethioninamine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="WP_005808145.1"
                     /db_xref="GI:492319638"
                     /translation="MELWYTEEHTENVRFSIKVDRQLYSGQSEFQRIDVFESKEFGTF
                     FTLDGLMMVTQKDEFIYHDMIVHVPMATNPQIKDVLVIGAGDGGTVRELTRYDSIVNI
                     DMVEIDKLVVDVCKEYLPQTACKLEDPRVRLFFEDGLRFIRTKENSYDLIIVDSTDPF
                     GPGEGLFTKEFYGNCYKALKDDGILVNQHESPYYETYAQNMGRAHQRIKEFFPVCRVY
                     QAHIPTYPSGHWLFGFASKKYDPLIDIDEQAWNDLGIKTQYYNTEIHKGCFALPNYVK
                     EQLADAVE"
     gene            267298..267723
                     /locus_tag="DSY_RS01335"
                     /old_locus_tag="DSY0238"
     CDS             267298..267723
                     /locus_tag="DSY_RS01335"
                     /old_locus_tag="DSY0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriohemerythrin"
                     /protein_id="WP_041272190.1"
                     /db_xref="GI:752602803"
                     /translation="MLKWKDEYSIGVEEIDEQHKHLFEIGNEIYDLLENYLLPDKYDK
                     IIQIIAELKEYTVHHFQTEEELMLKIKYPGYFKQKVAHDDFIKEVESVDFSAIDQDQD
                     GHTRKLLEFIFGWVLDHILKSDAILALRVLCRYTLVKGK"
     gene            267963..268838
                     /locus_tag="DSY_RS01340"
                     /old_locus_tag="DSY0239"
     CDS             267963..268838
                     /locus_tag="DSY_RS01340"
                     /old_locus_tag="DSY0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808149.1"
                     /db_xref="GI:492319645"
                     /translation="MEQHSVQVGTQYYRESIYERLRQLQEQEKLPVVLHEYQQGKHWL
                     IDCEFQLEAIEEDRETTKKIHSYYLANAIAETILQHWEKDHIRWLLKSKYKLKREEVV
                     QVFEKSLQYLNQESRQWKNYRIHRKASLVNQIVKCIEAQPFFDMEGFLRFRAKDYKEE
                     IYRAVNYVVNEHVIEAEYEEFINLLKRFVDSQKPRIHTLHVGITKHGKFNLYNEEGKK
                     ITKKYMDELSFMDTSQELTYEDLLVSALIAVAPRKIVLHIRYEGYQDTLQTICKVFEG
                     RVSYCTESCPICEKI"
     misc_feature    268885..269108
                     /note="T-box leader; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            269178..271094
                     /locus_tag="DSY_RS01345"
                     /old_locus_tag="DSY0240"
     CDS             269178..271094
                     /locus_tag="DSY_RS01345"
                     /old_locus_tag="DSY0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="WP_035213295.1"
                     /db_xref="GI:737228962"
                     /translation="MVKITLKDGSIREIESGKSLMELAASISRGLAKAALAGKVNGEV
                     KDLSYALTQDAEVEIITADSEEGLKILRHSTSHLMAEAVRNLFPGTILGIGPAIDNGF
                     YYDFDSEHVFTPEDLEKIEAEMRRLVKENKRYERKEISRSDALQYFSAEGEKYKVELI
                     EDLPEDEVISMYTQGGFTDLCAGPHIPSTGVVKAFKLMNLAGAYWRGSEKNKMLQRIY
                     GTVWAKKEDLDDYLFKLEEAKRRDHRKLGVELDLFSLHDEGPGFPFFHPKGMVLRNQL
                     EDFWRQEHRKRGYHEIKTPIILSRNLWENSGHWDHYKDNMYTTKIDDEDFAVKPMNCP
                     GGMIMYKQKLRSYRDLPLRMGELGLVHRHELSGALNGLLRVRNFTQDDAHIFMLPSQI
                     KAEISGVIDLVDRFYKVFGFEYHVELSTRPENSMGADETWEMATNALQEALEAKGVNY
                     KINPGDGAFYGPKIDFHLRDCLGRTWQCGTIQLDFQMPEKFDLTYIGEDGQKHRPVMI
                     HRVVYGSIERFIALLTEHYAGAFPTWLAPVQVRVLPISERHEDYAQDIVRRLNDLDIR
                     AEVDERREKISYKIREAQTHKIPFALVVGDQEAETDTVAVRRYGQANAGEKLSVAEFI
                     ALIQEEICSKKQLV"
     gene            271521..272384
                     /locus_tag="DSY_RS01350"
                     /old_locus_tag="DSY0241"
     CDS             271521..272384
                     /locus_tag="DSY_RS01350"
                     /old_locus_tag="DSY0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug DMT transporter permease"
                     /protein_id="WP_011458966.1"
                     /db_xref="GI:499778232"
                     /translation="MWIVYAFGSAFFAGITAILAKCGIKKTDSNMATAIRTIVVLAFS
                     WLMVLMVESHTTIGDISGKTLLFLILSGLATGASWLCYFKALQMGDINKVVPIDKSST
                     VLTIILAFILLNEGISIGKGVGVVGIGIGTYLMIQKKATEAAQPKANQAWLIYALLSA
                     VFASLTAILGKIGIEGVESNLGTAIRTGVVLVMAWLVVFVTRKKGISREIPLKELGFI
                     ILSGLATGGSWLCYYKALQDGPASVVVPIDKLSILVTIAFSYVVFHEKLAKKAALGLV
                     LIVSGTLAMLI"
     gene            complement(272432..273421)
                     /locus_tag="DSY_RS01355"
                     /old_locus_tag="DSY0242"
     CDS             complement(272432..273421)
                     /locus_tag="DSY_RS01355"
                     /old_locus_tag="DSY0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C2"
                     /protein_id="WP_005808153.1"
                     /db_xref="GI:492319652"
                     /translation="MNKIRIGIVGYGNLGKSVELGIRQNEDMELVGVFTRRDPSSIKT
                     VTPGVNVFTMDESKQMTEQIDVMVLCGGSMSDMPVQGPEFASLFNTVDGYDTHARIPE
                     YFAAMDKNALESQKVCIIASGWDPGMFSINRLYAEAILPAGDTYTFWGKGISQGHSDA
                     LRRIKGVKDAKQYTIPKDQAINAVRRGEMPELSTREKHWRECFVVLEEGADKERIKQE
                     IKTMPNYFADYDTEVHFITEEELIKDHPGLPHGGLVIHHGRTGLDEKHHHVIEYRLAL
                     DSNPDFTANVLVAFARAAYRLNREGVSGAKTVVDIAPAYLSSKSAEELRRSLI"
     gene            273723..275459
                     /locus_tag="DSY_RS01360"
                     /old_locus_tag="DSY0243"
     CDS             273723..275459
                     /locus_tag="DSY_RS01360"
                     /old_locus_tag="DSY0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808155.1"
                     /note="catalyzes the formation of acetyl phosphate and
                     sulfite from 2-sulfoacetaldehyde; is active when grown on
                     taurine as a sole carbon source; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfoacetaldehyde acetyltransferase"
                     /protein_id="WP_005808155.1"
                     /db_xref="GI:492319656"
                     /translation="MPKITMTPSEAICETLVAEGIDHVTGIVGSAFMDLLDLFPTAGI
                     RFIPVRHEQSAGHMEDAFCRVTGRAGVIIGQNGPGITNMVTSVAAANSAHTPMVVICP
                     SAGTPTVGWDGFQEADTVKIFEAITKETIRVPHPSRAADCLRTAFRIAYAERGPVLYD
                     IPRDYFYGEISEQILEPHQYRVDQRGCGDLASLDKAAELLISAQRPVIISGRGVVDTQ
                     SKDIVAKIAEILTAPVACTYLHNDAFPYDHPLWVGPIGYMGSKAAMNLVAEADVILAI
                     GTRLSVFGTTPQYDIDYFPESAKIIQVDINPRNIARTHPVEVGLIADAREAAREILKR
                     LEERIAEPKVSQSRLTQIKAQQNAWEEEIVQSAMVDGYPINPRRALYEIQKALPENAI
                     VATDIGNVSSTANSYLKFKGAGKHIAALTFGNTGFAYPAALGAQLAEPDSPVVAIIGD
                     GAWGMSLHEVSTAVEHNLPVVAIVFRNGAWCAEKKNQIDFYNNRFVGVDIPTPESFAP
                     VAIAMGAEGIRVSKAEEVGPALKRALDSRKPTVLEIVCDGTQLAPPFRKDALKLPTRL
                     LPKYKSLDVRNW"
     gene            275641..277092
                     /locus_tag="DSY_RS01365"
                     /old_locus_tag="DSY0244"
     CDS             275641..277092
                     /locus_tag="DSY_RS01365"
                     /old_locus_tag="DSY0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458967.1"
                     /db_xref="GI:499778233"
                     /translation="MGASTSANKNTSGETDAKIIVEELILKARKAMAEIQNYSQDQAN
                     TLVQAVAWAIYRQDHAEELARISVQDTGLGNVKDKITKNKRKTFGTLRDLLAPEAKSV
                     GIIKVDEAIGITEIAKPVGVIAAAVPSTNPGATPANVTMMGLKGRNAVIIAPSPKGAS
                     TTVKLLEYIHAELAKVGAPLDLVQSLPMPVSKELTTELMKQADMVTVTGSANNVRAGQ
                     TCGTPNACVSAGNVVTIVDASANLQDAAHKIMLSKTFDNATSCSSDNALVIEAAIYEQ
                     MIEALKKEGGYKCTVAEKEQMQKAMWDENGKRRGKTTAKDAGVMAQEAGLTNPAAQKA
                     SFFMVEETGVGKGYPFSGEKIALVLTLYKAGDFDEALELTKRILNHAGRGHSCGLHTT
                     NEEHIQRIGLEMEVCRLLINQIQCFGNGGSFNNGLNFTLSMGGGTWAGNNIKDNLSYQ
                     HFIQTTKVSRLIPEVIPEEEELFGSYWAKYGRS"
     gene            277107..278225
                     /locus_tag="DSY_RS01370"
                     /old_locus_tag="DSY0245"
     CDS             277107..278225
                     /locus_tag="DSY_RS01370"
                     /old_locus_tag="DSY0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-CoA ligase, beta subunit"
                     /protein_id="WP_005808159.1"
                     /db_xref="GI:492319663"
                     /translation="MKLFEYQAKELFAESGIPIPQNALIGDISELNSALEKLGLPCVL
                     KAQVLQGGRGKAGLVKFVRTKEEAQKEAERILEATGKKLLVEEAVPYEREMYVSITVD
                     AASGLAMVMACLEGGVDIEQIARTTPEKIIKEKVDMSLGLMAYQADNIMYGLGLEQSA
                     AKEGSKILLKLYQLFVKYNAELVEINPLMILRDGTMAAADGKFNLDDNALYKQNRFSL
                     TRDHYKSDFEYEAALDGIPYIAFEGDIGMMVAGAGLANVVLDLIHYYGGTVANYLEFG
                     GPNYHKAQQCMKMMLKAKPKCILIATFGTIARADVMAQGIVEAVKELKPEIPIVAVIR
                     GTGEEDAQKLLRSAGLPSLSDTEEAVRKAVEIVGGAEN"
     gene            278222..279100
                     /locus_tag="DSY_RS01375"
     CDS             278222..279100
                     /locus_tag="DSY_RS01375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012459335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase subunit alpha"
                     /protein_id="WP_005808161.1"
                     /db_xref="GI:492319667"
                     /translation="MSIIIDHTTPVLIQGITGKEGSFWAKHAKNYGTHIVAGVTPGKE
                     GQDVDGIPVYHTVRRAVQEHPIEASLLVVPPKAAKGAVLEALDSGIKVIVVTAEGIPL
                     HEMMQLRKIALEKQAMVIGGNTTGIISTGKAMMGFFPYWLDRVYKPGRVGVMTRSGSL
                     TNEVTAEIVKAGFGPSSIVGVGGDPVPLTRFAEILPLFEKDPDTDAVVMIGEIGGTME
                     EDVAEAIEQRIFTKPLIGFMGGRTAPKGQKMGHAGAIITAGKGTVEDKVEALAKAGAL
                     VADRPSMIGQLLQKVL"
     gene            279253..280749
                     /locus_tag="DSY_RS01380"
                     /old_locus_tag="DSY0247"
     CDS             279253..280749
                     /locus_tag="DSY_RS01380"
                     /old_locus_tag="DSY0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_005808163.1"
                     /db_xref="GI:492319670"
                     /translation="MSINSPVVPSRPYVFNKRNALIFFAAIAVMLIIYLLPSPPSFYK
                     GTEEIPLTFEGKAVFAVLVYAVILWLTEAIPFPITALSMIIILHLMGVSTFTALVKTG
                     LGSSVLFFLMGAMGLSAAITVSGLANRIMLGVLSKVGTRTDRIVFTFMALGTFLSMWV
                     TDMAVAAMLLPLGVNILRQSGCKPLQSNFGRCLMIGIVYGALIGGTSTPAGCGANILA
                     ISYLRELTEADASFLQWMIVGVPGALMMLPAGWFLLMKVFPPEIRNVPIELDDVRRQN
                     KELGPLTRQERNTTIVFFTAVTMWLGAPLIKSLTGISIPEDFTALFAFLLLFLPGLQV
                     FGSWKEANEHIDWSGLMLIAGGIAAGMLLAETGTARYIAWGALNGIGALHPMLRVAAV
                     LVLVEALKIFFSSNSVTGAVVIPLVIALALDLGMNPWIVAGPAGIATSMAFIMVTSSP
                     TNVIPYSSGYFSIKDFAKCGVLMTVIGIVAVTLSVAIFGRFAGMNIWL"
     gene            280950..281666
                     /locus_tag="DSY_RS01385"
                     /old_locus_tag="DSY0248"
     CDS             280950..281666
                     /locus_tag="DSY_RS01385"
                     /old_locus_tag="DSY0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_005808165.1"
                     /db_xref="GI:492319674"
                     /translation="MVLDPHNPLPLHAQITNILRKRIFEENLTGKIPSERELMDYFAV
                     SRSTVREAIEALVRDGILEKKHGKGTFVAVRPIKEEWIGTFSSYTETIERAGMRSGAK
                     LLSCNIKREPAYIAEMFGGEEFYMIKRLRYANDQVIAIERKCFDLETGRRLLDYDLNA
                     NIYKIMESSLGIVLWEADEIVTSAIPSKEDALLLEVPKRSSVLVTERSSFDSDHKLIE
                     FVQTMFRADKYSFRIKMSRN"
     gene            281833..282489
                     /locus_tag="DSY_RS01390"
                     /old_locus_tag="DSY0249"
     CDS             281833..282489
                     /locus_tag="DSY_RS01390"
                     /old_locus_tag="DSY0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808169.1"
                     /db_xref="GI:492319681"
                     /translation="MHNVADLVENVIQGNAKESVSIARDLLAKGYRINQLVEGLTTAL
                     DSLDAKCNMNQFNLLEILLAARAMKEVVDEVVCPEMEKLPAEFGPLQLKGVFVMGTIQ
                     GDIHDLGKNIVTTLLRTVGYKVIDLGKDVSPAQFVMAAKAEKADFIGVSSLIFSSAAV
                     IREIKRLLREEKMSDIMVIAGGAAVKQLGKEDLDVDMIAKDAFELIRFLQAHEGNVAE
                     "
     gene            282486..283490
                     /locus_tag="DSY_RS01395"
                     /old_locus_tag="DSY0250"
     CDS             282486..283490
                     /locus_tag="DSY_RS01395"
                     /old_locus_tag="DSY0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_005808171.1"
                     /db_xref="GI:492319684"
                     /translation="MNSLQRLEAALAGHAFEALCIPLVFGGAAFLTDVKLKRYLQNGE
                     ILAQCQLDSQQKFDYDAVFVYGDNCIEAEALGSRVYFPENAYPYIEKYRLEDPRQLKD
                     LPDFNPSTDGRMPELLRAVALLKTELGDSLPIAGVVLGPMSIASQLMGLERLLYLLLD
                     SPCEFADIIRFASGITLKAGLALLAQGAHISAVIDPSASQSILPSEMFGRYLLPTIRD
                     IFSQFKGAGAMASWLVITGNSQGLLPYYRQCGVDIAGIDYEVPLAEALKWEGDFLISG
                     NIKPYRFVNQTPQEIIREGKELISLAAGRRFILSSGCEVPLDTKPENLAALIKAVRDV
                     "
     gene            283483..284793
                     /locus_tag="DSY_RS01400"
                     /old_locus_tag="DSY0251"
     CDS             283483..284793
                     /locus_tag="DSY_RS01400"
                     /old_locus_tag="DSY0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_005808172.1"
                     /db_xref="GI:492319686"
                     /translation="MCDRMDVKQNTALSSEEELKKQIAALHKINNMTGFLPIKIEELL
                     PAIKEVMEDIFADYQCNFNIFPKRHGCNRLELGDCKAIRDQLPMISDQDQTCPCCTGE
                     ACRGIFHSHVCVPLVSGKEVFGVMTLKSLLKVRLSRDSLEMLLAIANQVAATLQRSQL
                     LNRLAQEKNNLEEANQEITQLNRSLFDTIKELEKTQRQLIYSERLAAAGRLAANLTHE
                     INNPTGIILSRLEWLLLEAPETELPEEVVKDLLVIKKHTERIAQTTRGLLSFSRRTKN
                     ETTLVDLENLIKETVVWLERQFSRKDIIIVLNLSRLPTVIGNKDQLEQVLVNILTNAK
                     DALPEGGKIKITTKYDTEKNNVQIDIEDNGTGIPEDMMNSIFDPFFSTKEKELGTGLG
                     LPISLTIMKEHGGFLRMESTPHEGSCFSMILPCVPENQEGDLNE"
     gene            284786..286171
                     /locus_tag="DSY_RS01405"
                     /old_locus_tag="DSY0252"
     CDS             284786..286171
                     /locus_tag="DSY_RS01405"
                     /old_locus_tag="DSY0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_005808174.1"
                     /db_xref="GI:492319689"
                     /translation="MSEDRHIVIIDDEPDMLETCARVIHRMGYKCTTYEDSCEALEEI
                     YRLQPDLIITDIKMPQCDGFEVLEKAKVCTPKARVIVITGYASVDSAVQAMKEGAYDY
                     LSKPFPIEQLQLTINKALQHIALTEENQLLRAQLQEGLNTDNIIGARGGLQDVFETIG
                     KISNSDASILILGESGTGKEVIARAIHKNSRRSTGPFIPVDCASLPENLLESELFGYE
                     RGAFTGANTTKQGLLEMAHGGTLFLDELGELTPAMQAKLLRTLEERAIRRVGGNRLIN
                     IDIRVLAATNRDLEKAIRAKEFREDLYYRINVITLKLPVLHERQQDIPLLVNHFCKKF
                     SQDMNKKVSGFTPEAMQAMKSYAWPGNIRELRNVVERAISLSGSEMVEISDLPEKVIG
                     GQKKILPEQENLGAFSFHEAKDICLKRFEMEYLKELLDKHHGNITQAAKSAGMDRKTI
                     HRLINKYDLQR"
     gene            complement(286172..286723)
                     /locus_tag="DSY_RS01410"
                     /old_locus_tag="DSY0253"
     CDS             complement(286172..286723)
                     /locus_tag="DSY_RS01410"
                     /old_locus_tag="DSY0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808176.1"
                     /db_xref="GI:492319693"
                     /translation="MGKATIKIIFSLAASLVLFVSGCSSGQEPGSAPITPQEKPEIEV
                     FSKTMELNKIVDLDTMKLRIINVSLVRNTDPDPDAPLGKIALGIEIGNTSDKDVLFYP
                     EDFEMTIDGKEIASPDLTLTSSLGGTYPPQRVQQGFITFPIKEKEVTSVKELHLTIPP
                     TTDQDGIATEAKEYTILIDDLEA"
     gene            287112..288314
                     /locus_tag="DSY_RS01415"
                     /old_locus_tag="DSY0254"
     CDS             287112..288314
                     /locus_tag="DSY_RS01415"
                     /old_locus_tag="DSY0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_026198834.1"
                     /db_xref="GI:648507083"
                     /translation="MFAKLIWRNAKRRPWQQGLTLFVVVACAAALTAGILLVWGIEKG
                     GQSAVDNLGADVMAIPADAHLEPGQVLFTGAPANIYMNSEVLKEIEKVPGVEAISAQF
                     FSQTLNQGCCSLPEEYRLVGYDPQTDFLIRDLLAKGVGRDLKNTEVIVGGNVPAFLGD
                     RVVVLAEPFDVAGYLEPMGGSIDDTIFVPIATARRLAGKSPYLQEYWQEAGSPEQLVS
                     SVLIKTKDGADPNQVAKAIDRISGIKSVAAGKLFSELKEELLVIKEILRLLVVIICGI
                     TMASLASRYSSLVLERQQELALLRALGTERGNLFKLVMLETLCSGLAAAVMGCLAGYG
                     LVLYLAKSLSKHSSFPFMLPGAAQLCAAGLGIIAFVLLICCLAAFWPARSSSRLDPVT
                     ALTEGELR"
     gene            288323..289036
                     /locus_tag="DSY_RS01420"
                     /old_locus_tag="DSY0255"
     CDS             288323..289036
                     /locus_tag="DSY_RS01420"
                     /old_locus_tag="DSY0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458970.1"
                     /db_xref="GI:499778236"
                     /translation="MEISLKNITHYYRDGTGDQVTPLRNIDLTMRSGDSLVLYGPSGC
                     GKSTLLFILGCLLRPSEGQVDIDGRSLLHYGEKELAELRNRKMGFMFQACYLLPTLTV
                     KENIMLPFWIQGGKARDGRTEKKTVELLLEQLELTERADFLPYQLSGGQRRRVAMARA
                     LANDPEVILADEPTAELDEEKKDFVGKWLGEQAGKKKIVVVATHDPQLAVYAGRVYSL
                     SQGQLQEKILGKGAVYSSG"
     gene            289068..289523
                     /locus_tag="DSY_RS01425"
                     /old_locus_tag="DSY0256"
     CDS             289068..289523
                     /locus_tag="DSY_RS01425"
                     /old_locus_tag="DSY0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808181.1"
                     /db_xref="GI:492319702"
                     /translation="MEVKLLNGKVTKVIGGLGAALGLLIALTPFQLAPVCQRLLELTS
                     GKMTHMRCHYTGQGEVFLGIVVVLVSLIYLFNTSIPAQKALGGVLMILGCAVIILPTN
                     LGIGVCMNPMECHTTARVLYVLGSLTIIDGLVAVFQEKLPVSPSKDIKA"
     gene            289573..289890
                     /locus_tag="DSY_RS01430"
     CDS             289573..289890
                     /locus_tag="DSY_RS01430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942625.1"
                     /db_xref="GI:506422906"
                     /translation="MRGLVTGKLSKALGLNMVVVGLVMGFALFASYAVPLPEKAEAAG
                     QAGYLTFQSTCTACHTVDTVQNYQGSSTWPEIIGLMKGYGAFMQEEEEAEILQYLEEA
                     YPR"
     gene            289925..290158
                     /locus_tag="DSY_RS01435"
     CDS             289925..290158
                     /locus_tag="DSY_RS01435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808185.1"
                     /db_xref="GI:492319708"
                     /translation="MSFFNEEGDKEGFVVLALGIWAAITLVFMIARSWAAGNAYWVAI
                     FMGLICFAAAFSVYTWRVLILDRKGGMENGEQQ"
     gene            290142..290588
                     /locus_tag="DSY_RS01440"
                     /old_locus_tag="DSY0257"
     CDS             290142..290588
                     /locus_tag="DSY_RS01440"
                     /old_locus_tag="DSY0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal sequence domain protein"
                     /protein_id="WP_005808186.1"
                     /db_xref="GI:492319710"
                     /translation="MENNNKGEISRRKFLGIMTGVPLVLSVGTPAVAVGKMISPPEAL
                     RPLPPRMAILKEDELLEKPKEIIYDGLPAMIFKKGNEYRAFSRVCTHLGCTVMWNEAE
                     KRFECPCHGGIFDEDGNVLEGPPPKPLTRLRAWVEDGYVMVQREVV"
     gene            290590..291228
                     /locus_tag="DSY_RS01445"
                     /old_locus_tag="DSY0258"
     CDS             290590..291228
                     /locus_tag="DSY_RS01445"
                     /old_locus_tag="DSY0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942626.1"
                     /note="electron transport protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b6"
                     /protein_id="WP_041272191.1"
                     /db_xref="GI:752602804"
                     /translation="MAIEPKEVGVKDMFKEIAEHPVPRHARNFIFCFGGISFLLFLVQ
                     VVTGIVLAVYYNPTMEGAYQSVMFINDEVFMGKALRSVHNIAANLMLIMVVLHFLRVV
                     FTGAYKPPRQFNWVVGVLLLLLVILFCFIGYLLPLDQVGYWAAIIGTKILGSIPIVGD
                     QLLLLGQAGTKITDHTLMRFFIIHIVVLPVVVIVLLIAHFLMIRKQGISGPL"
     gene            291241..291636
                     /locus_tag="DSY_RS01450"
                     /old_locus_tag="DSY0259"
     CDS             291241..291636
                     /locus_tag="DSY_RS01450"
                     /old_locus_tag="DSY0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b subunit of the bc complex"
                     /protein_id="WP_015942627.1"
                     /db_xref="GI:506422908"
                     /translation="MDINKKELDKDTVPFFPNHLTTEVSVALGILGVVFFLAGVIPKD
                     LGPPANPVMTPAHIEPDWYFMWLFGLLKIVPQLLGLLIPALLVVGVILLPWLDKSTSR
                     RPEERPWVIIGAEIVLILMVVLTYIALHF"
     gene            291694..292233
                     /locus_tag="DSY_RS01455"
                     /old_locus_tag="DSY0260"
     CDS             291694..292233
                     /locus_tag="DSY_RS01455"
                     /old_locus_tag="DSY0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_015942628.1"
                     /db_xref="GI:506422909"
                     /translation="MTGNGRNNPSFHLLSIFCIWLGMGFLVGITGSVIAAPHYVLPDD
                     REAKLVYASGLQPQQSAGTQSSEPSGASGTAREGELFLKKGCTQCHEVSYYGIAGGVT
                     GPDLTKAYGDVPDRFGKTLAEFLQEPEGTMAEMFVRMDITDDEKNQVLELLTAAGGET
                     AQQPAGEENESTENTNNPE"
     gene            292286..294184
                     /locus_tag="DSY_RS01460"
                     /old_locus_tag="DSY0261"
     CDS             292286..294184
                     /locus_tag="DSY_RS01460"
                     /old_locus_tag="DSY0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458974.1"
                     /db_xref="GI:499778240"
                     /translation="MEKGLFKKIVLSLAGLLVGLVIAVYLSAQLNPEAEAAAAFGGKN
                     ISVDGVPDDVVQAALKTYVPPGQLDEYYMFASGGHSGNVFVYGVPSMRRIRTIPVFTP
                     ESAVGYGWTTESKEMLGEWSWGDVHHPALSETKGDYDGRWLFVNDNANSRAARIDLDS
                     FRTSQILDIPNIYGPHSAVFMTPNSEYFMLGSRFAGPIPYGTYSPIENLSKDYNCVLA
                     AVAIDPNNGEMSVGWEVLMPPWSFDLSDAGKLDSEGWAFLTTYNTEEAYELLEVNASQ
                     REMDYVVALNWKMLEQAANEGKYKIVDGVKMIDPLDVPGSVYLVPAMKSPHGVDVTPD
                     GKYFIANGKVAPVATVFSFEKFKECIDNKDFQGEERGFPVVNYEKVRVAEVPVGLGPL
                     HTQFDGNGYAYTTLFIDSTIAKWSLDTFEVVDVTPVHYCPGHLCAAEGDTVSPDGKYL
                     VSLNKLAKDKFLSVGPSHPESAQLIDLTTDKMKILMDVPTDPEPHFAQMIKADKITTW
                     EVFEKDPSQPGAVYEKENARIERDGNNVTVYQMGFRSRYYPDHVEVNEGDHVTWYLTN
                     TDFDEDITHGFGICLYDLNAEAQPGETIKFEFVADKAGVYPFYCTNFCSALHQEMQGW
                     FIVKPKGL"
     gene            294271..294870
                     /locus_tag="DSY_RS01465"
                     /old_locus_tag="DSY0262"
     CDS             294271..294870
                     /locus_tag="DSY_RS01465"
                     /old_locus_tag="DSY0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808194.1"
                     /db_xref="GI:492319723"
                     /translation="MDFVRKLFKGNLNLIGRIMFGAAGLILLASLFLPWWHLDLVAPQ
                     YPEGLSVIVYPDKLDGRIDIINNINHYIGMKWISEEDFPEFQVITKVAYVIIGLALIT
                     ALVKKRWLAWLTAGLGAVGGMIGVYDLWRWLRDYGTQLDPMAAIKIDPFTPPIIGTNK
                     LANFITYTGFNSGGYLLGLSIILMLLAAWRFKEHEKQEE"
     gene            294851..296356
                     /locus_tag="DSY_RS01470"
                     /old_locus_tag="DSY0263"
     CDS             294851..296356
                     /locus_tag="DSY_RS01470"
                     /old_locus_tag="DSY0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808197.1"
                     /db_xref="GI:492319730"
                     /translation="MKSKKNRRCFWLSLFLFLWIIPLSAHAATLEVQGGGSAESIQSA
                     LARAAPGDTIHVYSGTYVGKIVIDKAVSLIGIGMPILDGGGEGDVVSIKGDGVTFKGF
                     QVMGSGKRLQDSDAGIKLYSAGNVIEDNKLTNNLFGMYLLKSPHNTLRNNTIIGRPAK
                     NKLQASKKDEAGEAGTYDILPSFEGESGDGIHLFAASHNLIENNEITDTRDGIYFNYA
                     HDNRLLYNHIDGVRYAIHYMYSDDNYFEGNIATNNVAGAAPMYSKRITFRENVFAYNR
                     GHRSFGVLFSNCNDCLAEGNVFFGNTRGALFDVSYHNIFRNNLVAANDIGIDLISSSG
                     FNTFTENNFMDNMEQIAFRAGRIGEGNVFYEEGTGNYWNDYRGFDLDQNGIGDTPYLT
                     GDIFTYLMNKAPAVRLFLNSPAAKALEFAENMFPVIEIPKAEDAYPLIKPVAIEINGQ
                     FHIEKNQVSNKIFGAYSLLMLLIAGMITARAFGVSSQGIKRVENYLRGGQK"
     gene            296353..296895
                     /locus_tag="DSY_RS01475"
                     /old_locus_tag="DSY0264"
     CDS             296353..296895
                     /locus_tag="DSY_RS01475"
                     /old_locus_tag="DSY0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein involved in nitrous oxide reduction"
                     /protein_id="WP_011458975.1"
                     /db_xref="GI:499778241"
                     /translation="MSRKIMVVLLSLWCLSLIGCSSGGAAGTPREIDPTIDICPVCRM
                     SVIDEHFAAQIIDSQGQVEIFDDIGCMSIFMRRLEAGAQDSILATYVKDFESMEWIQA
                     QEAFYVQGRIDTPMSFGIVAFAAEETARKFAQEVGGKQLTWEQVLTEPLTIGLDIEFN
                     QEDFNVQDLDTGETREERGN"
     gene            296896..297732
                     /locus_tag="DSY_RS01480"
                     /old_locus_tag="DSY0265"
     CDS             296896..297732
                     /locus_tag="DSY_RS01480"
                     /old_locus_tag="DSY0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808202.1"
                     /db_xref="GI:492319739"
                     /translation="MQLINVVTIAEKELLESIRSKWLGTFTVVFALIALLVSFFGLSS
                     LGVGGQQGFNRVTASLLNLVLYLLPLIALVMGSATVAGEKEAGSLHVLLTQPIDKAEV
                     IIGKFGGLALALIASILVGFGGAGVVIAWKTGSINITDYLMFVSLSMILAMVFLSIAI
                     LISVIVSRRAQGIGLGIFIWFLMILVYDFLAIGVAGLSNVSVIIPLLLLLLLANPADM
                     VRVLVILQLGGEETFGPTLVALTRMLTQGSGELLLYGALLIWMIIPLLIAAILFGRKQ
                     DY"
     gene            297744..298655
                     /locus_tag="DSY_RS01485"
                     /old_locus_tag="DSY0266"
     CDS             297744..298655
                     /locus_tag="DSY_RS01485"
                     /old_locus_tag="DSY0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_005808204.1"
                     /db_xref="GI:492319743"
                     /translation="MEVINTLEVKYAQKFYGPFQAVKDINLTVEKGEIYALLGHNGAG
                     KSTLIKMILGLVKASAGMIEIEGLNYDAKNKEIKKRVGYLPERMNFYDNLTAWETISF
                     YAKLKGITRKRCEEVLEQVGLREAEHRRVGTFSKGMQQRLGLAQAIIHKPDLLVLDEP
                     TTGLDPIGILELKAMIRNWNKEGTTILFSSHNLNDVEELAQRIGIMNRGEMIAQGSLA
                     ELQDRLGLPTKIKIDLAVIPVDLEEILVGKRIKTFQLEGKTVSIDCPKDKKTQVITAV
                     MDGMLKVLDLRLEEPGLNSIYQNIMAE"
     gene            298789..299364
                     /locus_tag="DSY_RS01490"
                     /old_locus_tag="DSY0267"
     CDS             298789..299364
                     /locus_tag="DSY_RS01490"
                     /old_locus_tag="DSY0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_005808206.1"
                     /db_xref="GI:492319746"
                     /translation="MEDGWNSARLFCDFFWRWFVISKDLRINDEIRAREVRLVGEEGE
                     QLGIVQLRDAQRIAAEKSLDLVEIAPTAKPPVCKIMDYGKYKYEQAKRDKEARKKQKT
                     MEIKEVKLRPNIEDHDFETKARNAQRFLNDGDKVKVTIMFRGREVTHPELGRTLCLRL
                     AEFCKAEANIERDPKLEGRNMIMILAPVKHD"
     gene            299385..299582
                     /gene="rpmI"
                     /locus_tag="DSY_RS01495"
                     /old_locus_tag="DSY0268"
     CDS             299385..299582
                     /gene="rpmI"
                     /locus_tag="DSY_RS01495"
                     /old_locus_tag="DSY0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014901138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_005808207.1"
                     /db_xref="GI:492319748"
                     /translation="MPKMKTHRGAAKRFKKTGTGKIVRHHAFTSHILEKKSPKRKRNL
                     RKGTVMHKTDAKRIARLVAYL"
     gene            299689..300051
                     /locus_tag="DSY_RS01500"
                     /old_locus_tag="DSY0269"
     CDS             299689..300051
                     /locus_tag="DSY_RS01500"
                     /old_locus_tag="DSY0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_005808209.1"
                     /db_xref="GI:492319751"
                     /translation="MARVKRGVTKHQRHKKVLKLAKGFRGAKSKLYRPANEQVMKSLA
                     YAYAHRRDKKGDFRKLWIARINAAARLNGLSYSRMMNGLKIAGVSVNRKMLADLAIND
                     AAAFTELVNVAKAQVSAK"
     gene            300109..300924
                     /locus_tag="DSY_RS01505"
                     /old_locus_tag="DSY0270"
     CDS             300109..300924
                     /locus_tag="DSY_RS01505"
                     /old_locus_tag="DSY0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_005808211.1"
                     /db_xref="GI:492319754"
                     /translation="MLTSLQNEQVKYVVNLHKRKFREENGEFLIEGWRFVEEGLARGA
                     HLTKVFFCSECKNESWPQLAEALKVKGVPVIEVDERVLRKMSDTENPQGILAVVKQSR
                     WTWDDFIEIVNPAGRSAIPMLLILDGVQDPGNCGTILRTALAAGVTQVCLTEGTVDLY
                     NLKVLRSTMGAIFSLNIATHCQPEEILKVCRSHKIPVFVGDAEGTDLYETHFAQPMAL
                     VVGNEGNGPSAAFRGPGVKRITIPMSHQVESLNVAMATGIILYEVRRRMTSTT"
     gene            301454..302476
                     /gene="pheS"
                     /locus_tag="DSY_RS01510"
                     /old_locus_tag="DSY0271"
     CDS             301454..302476
                     /gene="pheS"
                     /locus_tag="DSY_RS01510"
                     /old_locus_tag="DSY0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G0L8.1"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a heterotetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 1 subfamily; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine--tRNA ligase alpha subunit"
                     /protein_id="WP_011458978.1"
                     /db_xref="GI:499778244"
                     /translation="MKQEVHRIQEETLAELQQVSTLEALQELKVKVLGKKGSLTAQLR
                     KMGGLSPEERPIFGQVVNETRDILEAAWIRREEELSQTAMLKQLEEEKLDISLPGVSL
                     PQGHQHPLTKVIEEIEEIFLGMGFQIAEGPEIESDYYNFEALNLPKDHPAREMQDSFY
                     ITEEILLRTQTSPVQIRTMEKQRPQLPVKIICPGKVYRNDDDATHSPMFHQVEGLMVD
                     RRIRMSDLKGILLSFSRMMFGESREIRLRPSFFPFTEPSAEVDVSCMLCGGAGCRICK
                     GTGWIEILGSGMVHPRVLEMGGYDSKELTGFAFGMGVERIAMLKYGIEDMRLLFDNDL
                     RFLQQF"
     gene            302489..304894
                     /locus_tag="DSY_RS01515"
                     /old_locus_tag="DSY0272"
     CDS             302489..304894
                     /locus_tag="DSY_RS01515"
                     /old_locus_tag="DSY0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="WP_011458979.1"
                     /db_xref="GI:499778245"
                     /translation="MKVSLEWLREYVDIAQTAEDLAESLTRGGIEVGGVEYLNQGLEA
                     VVVGEITRMEHHPNADKLWICEVNLGDRSTTIVTGAQNLLVGDRIPVALPGTTLPNGV
                     HIEVSKLRGVESSGMLCSTEELHLDSGLGDPRSEGGILILEKETPLGATMDTVLGEGD
                     CVLDLELYPNRPDCLGMVNVAREVASLTGEALHLPAWAEGSQGPDYPGDPKARIVLDD
                     PELCQRYAGLVVEDVNIEPSPEWMQKRLKAAGVRPISNIVDITNYIMLEMGQPLHAFD
                     RDAIAGAVHVRRARAGEKLVTLDGIERELDPEMLLIADDEKALGLAGVMGGLNSEITD
                     STKRIFVESAHFSSVSIRRTSRRLGLRSEASNRFEKGVNPHGVAATLGRVAELVIQLG
                     AGKPVGFVEQAGQLPKPAAVSLTVEKTNSLLGTVLTEEEITGVLKRLRFPYQEKDRGY
                     EVQIPTYRSDITIEEDLIEEVARLTGYDRIPTTLPQGDQTQGRRTPEQEFKRTLRHLL
                     VGLGLNEVMTYSFTRPDADRQFGDMDQAIPLLNPLREELSVMRTALLPSIMEIAARNI
                     SRRNLDIRLFEMGSIYKSKERPLVKLPQEELHLAGVIWGKSSRHWLTPVTEYDFYTVK
                     GILEEVAREFGLEFDYKLPNNQELTHPGRSADIYLNGEKIGLMGEIHPALGKEWELER
                     ALIFELAVTPLMEAGNRTIRAFSIPKFPAMQRDLAVVVPLEVSAQDVMKRIKELGGTL
                     LVQVNIFDVYTGKPIPEDRKSLAFALKYQALDRTLKDEEVNALNQQVLEGIEKEFGAA
                     WRK"
     gene            304917..305174
                     /locus_tag="DSY_RS01520"
                     /old_locus_tag="DSY0273"
     CDS             304917..305174
                     /locus_tag="DSY_RS01520"
                     /old_locus_tag="DSY0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapA"
                     /protein_id="WP_005808223.1"
                     /db_xref="GI:492319772"
                     /translation="MAEENEKVIVEIFGEKHVIRGQESPEHILKVAREVDKKMRLIAQ
                     RTPRLAIHQIAILAALNLADELEKIKEEQETLMQLIEAQEE"
     gene            305346..305708
                     /locus_tag="DSY_RS01525"
                     /old_locus_tag="DSY0274"
     CDS             305346..305708
                     /locus_tag="DSY_RS01525"
                     /old_locus_tag="DSY0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458981.1"
                     /db_xref="GI:499778247"
                     /translation="MKIALPSRQNRIDDHFGHCEYFTVFSVDEGKKELVDQETVSSPV
                     GCGCKSNIAQTLAEMGVTLMLAGNMGEGAVRVLSNSGISVIRGCSGEVKSVAQQWLEG
                     TLEDSGDSCHEHEHSCQH"
     gene            complement(305852..306232)
                     /locus_tag="DSY_RS01530"
                     /old_locus_tag="DSY0275"
     CDS             complement(305852..306232)
                     /locus_tag="DSY_RS01530"
                     /old_locus_tag="DSY0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458982.1"
                     /db_xref="GI:499778248"
                     /translation="MNKKTSRFLLLMTLFLGLSLGIFFNAATTNAYPDMSEDGVTCTP
                     CHEEGEHGGSGEPATEPEPAPPAPAPVQPTPSPQEPAQESPQVAKEQPDSADTTGAVS
                     PALIVGVVVLLLLAVYLFAFKKHK"
     gene            complement(306268..307887)
                     /locus_tag="DSY_RS01535"
                     /old_locus_tag="DSY0276"
     CDS             complement(306268..307887)
                     /locus_tag="DSY_RS01535"
                     /old_locus_tag="DSY0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_011458983.1"
                     /db_xref="GI:499778249"
                     /translation="MENMNRRNFLKKATVGAAALAGASMLTACGTPETVKPNSDASPA
                     GRSWDYEVDAVVVGGGHGGLCAAATAAERGKKVLLVEISGIVGGGSAWSGGILHTFGT
                     QTYEEYMEYSEGLHDPVLGKLFFETFKGEFMPWVQNTVGAPVYIMGPQAGPNGRPQDK
                     VPNSIGDKEWKMGTKEDKGYAGLRNYFKAIEDYVKAKGGTVLLKTRGLNLITDGEKVV
                     GLKIVTQGEEPKYVKAGAVILATGNFFANKGLLTQFVGPYAYRTKVMGVPYATGDGLR
                     MGQGVGAMLSEGLSTWSGTLVCVTHNNAVTDDPAAYEKIIETDPNSMAGINKGRPNPP
                     WFGTGTVLPELVPAIVVNLNGKRFKDEAHPIDSKYPRLTDAVLVQPEGMAFVIGDQAM
                     YDANPSTSAMMKIIKDEGVKVIEGATLEEFAANMEKAGVYKANLLKTIREYNAAIDKG
                     TTMELEVPREYNLNKISTPPFYGVPVTGQIYCNFGGLAINENVQVLDHQKQPIPGLYA
                     VPPAAGGVMRSIYTGSIALAGTFGWLAGKQI"
     gene            308177..309529
                     /locus_tag="DSY_RS01540"
                     /old_locus_tag="DSY0277"
     CDS             308177..309529
                     /locus_tag="DSY_RS01540"
                     /old_locus_tag="DSY0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041272192.1"
                     /db_xref="GI:752602805"
                     /translation="MLQHNSLPEQHQNQLSLIFSSLKLSQLLRTAGIRKSYGISSFVV
                     FQIIFQLVFQGRNLFRLLEGSRAESLPGKDVVYRFLNDSRYNWRRFYQLLSLKIVGSF
                     EKLTSAQRIRVFIVDDSVMDRERSKKVELLARVFDHVSGRFVRGYTLLTLGWSDGFSF
                     APLDFTLMSSAKAKNRLCEMREDLDKRSVGYKRRMEAMIPKPDAVVQMLERALKAGFS
                     ADYVLMDSWFTHAPLLQKLRDKELHVIGMVKELKQRYLFEGESLSLRELYARVPKNSK
                     AEILGSVRVHTPSGLALKIVFVQNRNNRREWLAILTTDLSLENAEIVRIYGMRWSIET
                     FFKMAKSHLKLGTEFQGRSFDMMISHTSIVFSRYLILEWERRENNDERSLGGLFYLFA
                     DEVMDLDLKTAIRQLMAFVLNLLPNKPENNESLSQLHKWIAELPSYIRALFAQLGCES
                     "
     gene            309559..310500
                     /locus_tag="DSY_RS01545"
                     /old_locus_tag="DSY0278"
     CDS             309559..310500
                     /locus_tag="DSY_RS01545"
                     /old_locus_tag="DSY0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011458985.1"
                     /db_xref="GI:499778251"
                     /translation="MRLEQMEYLISLAETGSITQTAKYFFMSQQGISYSIQQLEKELD
                     VKILHNHRNRVTFTAAGECVLVRARDFVKQYQELQEELQSFQKDKTPSYKARLFLYID
                     PFMANTFLPRILKKLHKQSKIKLATKEQNLTLLLQTLSDPSEVDGIGLVGLTEHYTTE
                     QFKQKFDFEPIHSCHLQVLVSETSPLAKLPALSFEEIAQYPICLFASDYNSEEVGKDL
                     FFGRTVKNLSVILQTTNVDMYRDMVNKNIAIGLTTDYLESFFHKSSLTGIPLKEPIQF
                     HVGFIRRKGRPFSVMDEEFMAIAKDVLNSQLAKKVSQ"
     gene            310632..311462
                     /locus_tag="DSY_RS01550"
                     /old_locus_tag="DSY0279"
     CDS             310632..311462
                     /locus_tag="DSY_RS01550"
                     /old_locus_tag="DSY0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="WP_011458986.1"
                     /db_xref="GI:499778252"
                     /translation="MKEQYYSIGQVAKLSNISIPTLRYYDQIDLYKPAHVDTLTSYRY
                     YKESQLYILDMIKSLKYIGTPLTDIKTVLNYTPAELFCFLEHQEDVIEGKIQGLQEIH
                     KNLQQTKKQLQQQMKTALATDVFEKTEDLQIFTLPVENYAPQSIPNDCYGELIKLVEA
                     EGSRISSHYGCIYPLLDYNSMDEVRCTHIFTPLMTDRLNSHPAYRRNIRLISESRFIG
                     IAFQYHPDRYIEHYQRLYHYIRSKELPVADHVYDLFTPTRYSQHKEEEFMVELKVQLL
                     "
     gene            311581..312753
                     /locus_tag="DSY_RS01555"
                     /old_locus_tag="DSY0280"
     CDS             311581..312753
                     /locus_tag="DSY_RS01555"
                     /old_locus_tag="DSY0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily antibiotic efflux
                     pump NorA"
                     /protein_id="WP_011458987.1"
                     /db_xref="GI:499778253"
                     /translation="MNEQKTVLALLLMNIFIAFLGIGLVIPVLPTLMRELGVNGTVVG
                     YLTAAFAIAQLICSPFAGKAADKIGRKKVLVTGLFLFGFSEVLFGLGQEIEVLFLARI
                     LGGVSSALIMPAVTAFIADITTLETRPKALGYMSAAINTGFIIGPGIGGFLADFGTRT
                     PFFFAGALGAVAAILSIIFLKEPDRSNEAAEEEVPKLKTSIKRMLAPMYFIAFALILI
                     ASFGLSAFESFFALFVDGKFFFTPKEIAFVITAGALLGALIQVLLFERLARRWGEIKL
                     IRYSLILSGILIFLLTAVHSYVWILVVTTLAFIGFDLFRPAVTSYLSKIAGNEQGFVG
                     GMNSMFTSLGNIFGPIIGGMLFDVDIDYPFYFSVAVMILGVIITLFWKEPSRILQQ"
     gene            312995..313909
                     /locus_tag="DSY_RS01560"
                     /old_locus_tag="DSY0281"
     CDS             312995..313909
                     /locus_tag="DSY_RS01560"
                     /old_locus_tag="DSY0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloenzyme"
                     /protein_id="WP_015942637.1"
                     /db_xref="GI:506422918"
                     /translation="MHFVMIFLDGFGLGGDRDNPIMAAHTPYIDELLGGHYLWGQERR
                     IESEQLILIPLDASLDVTGIPQSATGQTTLWTGVNGAKALGFHLNAYPNEKLAEIIKE
                     KSIFKQLADQGKKVTFANTFTSHYDEMIASGKRRHTASTLSALAGGVPLRRIEDLLQG
                     KGVYQDMTNEILRELEQEADIPLITSYEAGKNLGRLALDYDFTLYEFFQTDVRGHKQD
                     WEKAVALIEQIDGFIGGFMSVVRHEDVTWLLTSDHGNIEDFRVKGHTQNPVPALGWSS
                     KPLEWPQWERLEDVTPGIVRMILGTREL"
     gene            313911..316529
                     /locus_tag="DSY_RS01565"
                     /old_locus_tag="DSY0282"
     CDS             313911..316529
                     /locus_tag="DSY_RS01565"
                     /old_locus_tag="DSY0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458989.1"
                     /db_xref="GI:499778255"
                     /translation="MSHIKDAELSSMELLAPAGSYESFKAAVENGADAVYLGGKSFNA
                     RASAANFGLDELRQVVQYAHERETKVYVTVNILIADQEFPELYDYIYSLYEIGVDALI
                     LQDIGVGSMIRSVLPEMERHASTQMTINTTWGVRHVERLGFQRVVLAREVSVEQMKTI
                     SAKTALEIEVFVHGALCICYSGQCLMSSYIGGRSGNRGRCAQPCRLTYQLMNEERKDL
                     LAEANLGNHLLSPRDLNFVEEIHTLKECGVYSLKVEGRMKRPEYVATVTRIYRRALDH
                     VLSQENGVNAGSAVTGEEKTELLQIFNRDFSRAYFHSHPGAELMSYARPNNRGIRLGR
                     IVQNRGNQLEIKLEAYLRPGDGIEVWTSRGREGITVQKVWQGKRESEEGKPGDIVQIE
                     FAGKSHPGDRVFKTHDEQLMEKARQSFQEGKERRKRPLKMRLSGSIGELMALEAWDQD
                     KHVRVDSATPAQQAMKRPLTQEYAFQQLNRLGTTPFWLEELDLEVEEGLMLPVSELNE
                     MRRLVVEGLLHKSFQQEKVTRGEYKQRLKEWQNRLKLEQEEQVQQAQQHKEPLPGSHS
                     KAASLAARRLTVAVSDLEGVKAALKAGARRIALGGERWRSRKGMSWEDIRAGVRLCKE
                     QGANCLLRLPRILNEEQSAWWYEALLKVKAWEDRPWIMVANLGELEMVKDIDPDWPFE
                     VDYPVNIFNEAAVAHLFRLGAQGVTLSTELEHSQIEPLARWPKTEVFAFGELEMMVSE
                     YCPVGATLGGKKGTKCTAPCVKEPHYLRDRLNYDFPIETDLDCRMHLYNVKRLNLYKE
                     LGSIAKMGVQRIRLQLDRANPVQIRDTVRVFLEGWERALAGERISEEQAEKVNGYLAE
                     RFPEGFTKGHYFRGVL"
     gene            316567..318936
                     /locus_tag="DSY_RS01570"
                     /old_locus_tag="DSY0283"
     CDS             316567..318936
                     /locus_tag="DSY_RS01570"
                     /old_locus_tag="DSY0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458990.1"
                     /db_xref="GI:499778256"
                     /translation="MVLNERVIRKLDFDKILERLANQCIMPRARELAEQLEPHSHLDL
                     VREALEETGEGKDILRINPLFSVRGAREIRPLVERCLKGGTLTTDELLQIRDTLKAAR
                     IVKQGLQEGKAEVPHLKGIMEQVILPKGIEEEITRCITEDGQVADQASSVLADLRRSI
                     SRLQTRIRETLDGIIRNPAYQKILQDPIVTQRSERYVVPVKQEYRQSFQGIVHDQSAS
                     GATLYIEPMAVVNLGNELREVVLKEQREVQRILLLLSARVEGEAEAIADAHEALARVD
                     FILAKARLSEEMNAGAPILTEKQEISLVQARHPLLTGKVVPLTIQLGTRFDTVVVTGP
                     NTGGKTVALKTIGLLAAMAQCGLHIPAESDSRVGVFTQIFADIGDEQSVEQSLSTFSG
                     HMKNIVEIVEKADWRSLILLDEVGAGTDPTEGSALAMAIIAELHERGARIVATTHYGA
                     LKNFAYNTTRVENASVEFDSETLRPTYRLLIGIPGKSNAFYIAGRLGLPEGVLDRART
                     FVTEREMQVADLIENLEDTQREIDLEKRRAREERQAIEKESLGLKEKSQKLEDDYQEL
                     MAKARDQATEIVREARREAERLIDELKLALKEERKDQQAIEKTRQGIRKLSNKVGDQD
                     TPLRTPHGVEPQEIKLGQMVYMTKLRQKGQVLKLPNDSGEVFVQAGVIKLNVPLSEIR
                     LIQEEKAAKPTRSVGGQGKVGMKKAETIRTEIDLRGMMVEEAGYELDKYLDDAVLTGV
                     GQVYVIHGKGTGALRQGIHEFLRGHHHVKSFRLGQHGEGDLGVTVVELK"
     gene            319013..319258
                     /locus_tag="DSY_RS01575"
                     /old_locus_tag="DSY0284"
     CDS             319013..319258
                     /locus_tag="DSY_RS01575"
                     /old_locus_tag="DSY0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase TatA"
                     /protein_id="WP_005808234.1"
                     /db_xref="GI:492319789"
                     /translation="MVTFAMITPTVAVIALVIALILFGPGKLPELGKGLGKGIKEFKD
                     ATDLSDDDGKKKKKEIAESKKEEPAESKKEEPVESKE"
     gene            319711..321282
                     /locus_tag="DSY_RS01580"
                     /old_locus_tag="DSY0285"
     CDS             319711..321282
                     /locus_tag="DSY_RS01580"
                     /old_locus_tag="DSY0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_011458992.1"
                     /db_xref="GI:499778258"
                     /translation="MTINRRDFIKRAAAGAAVVAGSSFLVGCNNTEAVAPASAPEAWD
                     QETDVVVVGGGNGGLSAAAAAVEEGKKVILCEISAFLGGGSAYSGGTIHSWGLDTWEK
                     YKEHTEDLHDPVLAKKYVETFRQVYLPWLEKNGIPLKKHPGGKGFNNDYGLGSGEAGY
                     LRHKAYFDALANFVTGKGGTIMTQTRVLRLVIDEAGMVCGVQAIKKGESKAIFIKAGS
                     VILATGGFQSNKGLMAKYIGPNGDVARNMGTPYNTGSGMLMAQGVGAMTQGSFSTFSG
                     TFSGIVPGPAVEDEPELYEEKRAGDPQSLPGIGGGRPAVPMWVNFLFPDETTGILVNL
                     QGKRFADETSPIEAKYARLPQEVLKQKRAMAFMIGDKAIYDKAAGSEAILKMYMDQGG
                     KVVEAATLEELAAKCQEIHGMHKGAFLKTVNEYNKAIDSGTTDSLEVPRVLNHNKIAQ
                     GPFYAVPVTANIYHTFGGVAINENAQVLDVQRTPIPNLYACPPCAGIFREVYTGGIAS
                     AGTFGYIAGKHIAGK"
     gene            321519..323510
                     /locus_tag="DSY_RS01585"
                     /old_locus_tag="DSY0286"
     CDS             321519..323510
                     /locus_tag="DSY_RS01585"
                     /old_locus_tag="DSY0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_015942638.1"
                     /db_xref="GI:506422919"
                     /translation="MHVHELLQRISQGTEKAYLEKCRDQRELFMEGKPVDPGIVPKVV
                     YNSWVRSQRYGVDPFEKPCHHPIDKSKSKELSRFIECLERYNFFIKQALELIDYQGFT
                     FTFSAKESLTKHIYDDLGSPFANLIGECSERTVGTNATAIALAENVPVALVSSLSYQY
                     WPAENGVNTAAPIHNHQGEVMGGIHIGLKDIKRTQDAFWLVTYLAQVFDRLYLPMTQK
                     HEKKIKDIIDLLPQGVAYINNKKSIHYNEKFQTLVNLSKGKNSLKKVSEFFSQEDWTS
                     IFACQEIKADGKTLIINSNSLDYEDFETSKIFIVEEKQSLTQRLQENSQGSKTTVGLY
                     SFDDIVGNNAELNEAKSIGLNVAGTSVPVLIFGENGTGKEMFAQAIHAASPRREKPFI
                     AINCGAIPAELVESELFGYEEGSFTGALKGGKIGKIEAASGGTLFLDEIESMPVQDQI
                     KLLRVISTGKVQKVGSTKEIPVDIRLISATKKDLLEESDKGLFREDLYFRISTFIIEL
                     PALRQRREDILLLTKEFISKFSRKYGLEQTVEMAQEFVEALENYSWRGNVRELEHSIE
                     RAIILMGAGLTLKVDYLSKRIQESYQNYQVKGLVEDVLAKGLKKQEQGLLYTAEAMII
                     DHVLKSVGGNVTAAAEKLGVTRKTIYNKLQEHPDLRVVK"
     gene            323618..324004
                     /locus_tag="DSY_RS01590"
                     /old_locus_tag="DSY0287"
     CDS             323618..324004
                     /locus_tag="DSY_RS01590"
                     /old_locus_tag="DSY0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808240.1"
                     /db_xref="GI:492319799"
                     /translation="MSKKGRFLLMFALFLSLSVGLFLSSAANTNAYPDLSPDGKTCTP
                     CHEEGTHGGEETPAETPGETPGETPAETPGETPAEQPAETPAEKPAETPAEQPAETHE
                     PMSPWIVVGGVIVILAVIYFLAIKKK"
     gene            complement(324134..326776)
                     /locus_tag="DSY_RS01595"
                     /old_locus_tag="DSY0288"
     CDS             complement(324134..326776)
                     /locus_tag="DSY_RS01595"
                     /old_locus_tag="DSY0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_005808242.1"
                     /db_xref="GI:492319803"
                     /translation="MASPPKRTPSKRPRKKKRVSKLRVFLVSFGSVFTLACIALLIYV
                     LYVVAGTPDWHPDTLTNQKQTSFVYDMDGNQIAELHAAENRQMVDSSEIPQLVKDTFV
                     AVEDKRFNDHFGVDPIRIVGSFIADLKSQSWKEGASTITMQLANNAFIENPREKTLVR
                     KLQQAALAIQLEREYTKDEILTFYLNRIFFGESSFGIQAAAKTYFGKDLKALNPDEIA
                     LLAGLPQAPSGYNPYYHPEEAKKRRTIVLGVMKDSGLITADEYDQYKDAPFEHVENVK
                     ANRAESEKPVVAGTNYQYPYFVDHVIEELINEHGLTEDQIFNGGLRIYTTVDTKIQAA
                     AEKEFANAANFPQSVDETLVQGAMTVLDPKTGAIRALVGGRDHNTARGFNRATRASRQ
                     PGSTVKPLVVYAPALEKGGFFPGTVLDDMPVKYNAGNGQVWAPVNYDTEYAGWRGLIT
                     MRFAVQNSVNVYAVKLMNLVGIEYSWNFAKNSLGLPLEEGDKVLSLALGTNQMSTLDM
                     ASAYGVFANNGVRVAPHAIEKVQDANGKEVLVPQVTKERTMKETTAYLMNSMLRSVVT
                     GGTGTRAQIGNWAVAGKTGTTSLDPDIYGYRTGNPDAWFAGYTPEYVGVVWMGYDKDD
                     ETLTHYLHKVYGGQYPAQIWKNVMTAAHEGLTVQTEFQQPSGIVGGDFDTKSGLIPSS
                     LTPKDFIRREIAAQGDFPTRVSDVWVEKEIDKDHPEYLAGTGTVNKEKKVFLNITGRD
                     SETPWPSDEQPYKMPEKEYNETPPPNETTSPPAGDPSIPIPTLGAVAYDAAQSSVTIP
                     VAYPEGSEGLHLIVYVKFPDHDFVQPFSPDAQPGGSNQIHIPLSIEGEPISPGNYSFW
                     ACLQSPETGATGNPSPVAVLTITD"
     gene            327061..328323
                     /locus_tag="DSY_RS01600"
                     /old_locus_tag="DSY0289"
     CDS             327061..328323
                     /locus_tag="DSY_RS01600"
                     /old_locus_tag="DSY0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G0N6.1"
                     /note="catalyzes the formation of tyrosyl-tRNA(Tyr) from
                     tyrosine and tRNA(Tyr); Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_005808246.1"
                     /db_xref="GI:492319809"
                     /translation="MNILDDLKARGLVYQTTDEEALYKRLESPMTLYCGFDPTADSLH
                     IGHLLPVLMLRRFQLAGHCPIALVGGGTGLIGDPSGKTSERTLNPTEVVQEWANRIKE
                     QLSCFLDFEGVGNPAIMANNYEWLGTINVIEFLRDIGKNFSLGSMLAKESVESRMSRG
                     ISFTEFSYQILQSYDFLKLNELYGCEMQIGGSDQWGNITSGTDLIRRMSVGEDRQVHG
                     LTVPLVTKSDGTKFGKTEGGAVWLDQDKTSPYKFYQFWINTDDRDVVKYLNFFTFLSI
                     EEIQGLAQEVESQPEKRNAQRMLAKEVTELVHGVEARERAEKISQALFTGGIANLTAK
                     EVEEGFSDVPSADVEDQEMLLVDALIKVGAVSSRRQARESMESGAVYVNGIRQTDTTL
                     TVAQLDKIESRFIVIRRGKKNYYLVKLV"
     gene            328920..330594
                     /locus_tag="DSY_RS01605"
                     /old_locus_tag="DSY_16SrRNA2"
     rRNA            328920..330594
                     /locus_tag="DSY_RS01605"
                     /old_locus_tag="DSY_16SrRNA2"
                     /product="16S ribosomal RNA"
     gene            330917..333834
                     /locus_tag="DSY_RS01610"
                     /old_locus_tag="DSY_23SrRNA2"
     rRNA            330917..333834
                     /locus_tag="DSY_RS01610"
                     /old_locus_tag="DSY_23SrRNA2"
                     /product="23S ribosomal RNA"
     gene            333972..334088
                     /locus_tag="DSY_RS01615"
     rRNA            333972..334088
                     /locus_tag="DSY_RS01615"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            334904..335725
                     /locus_tag="DSY_RS01620"
                     /old_locus_tag="DSY0290"
     CDS             334904..335725
                     /locus_tag="DSY_RS01620"
                     /old_locus_tag="DSY0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_005809818.1"
                     /db_xref="GI:492324577"
                     /translation="MEFELNELVERFTNISIRVEGVYNYKIDPGTAGWQKAAPFPGFI
                     FPLRGKAQYRFDGTPYTASIGRVVHGGASMGLDKQVLGDTKWEYISVLYDIRTSETKG
                     ICLPEVHFELTPGNSPRLQELLGRLYRTFNQPGSIPAFQAENLFRCVLEEVFVCARNQ
                     TNHGAQVLFEQVSSYIQDHFMDSLTVHGLAEQNEVTENRLFYVFSKYAGMGPGDYLIA
                     CRLNRAKELLTTIGAPISEVAKSIGYSDPLYFSRSFRKRFKMSPSEFREKFRNNP"
     gene            335835..336827
                     /locus_tag="DSY_RS01625"
                     /old_locus_tag="DSY0291"
     CDS             335835..336827
                     /locus_tag="DSY_RS01625"
                     /old_locus_tag="DSY0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrichrome ABC transporter"
                     /protein_id="WP_035213725.1"
                     /db_xref="GI:737229392"
                     /translation="MKRIIGMIVSLALLAGLLAGCSTSATGSNINTPAAQAEKTPGAG
                     GSGAEEAAWPRTIVDATGKEITLTEQPQRIAILHSLYLEYFLALGTPPIASAGASTGD
                     AMKALGEWETLKPYAGTAKIIDLGSARDLNLEAILGANPDVIVTFKGQGNLDKIYEQL
                     EQIAPVILVDFSAPWQEQILACAEIVNKEADAQKLIKEIEDSVQSAKEKLSRHQDKTI
                     AIFRTDGGKAFVTRGNKDYYDTFGIAKPEGYPDDYETLSLEAVAEMNPDYIIFQDFIT
                     TSQAFVKTQEASSVWQAMEAVKKGQVVYFDDSLNTFGPLATKLTAEKLIQIISD"
     gene            337045..337545
                     /locus_tag="DSY_RS01630"
                     /old_locus_tag="DSY0292"
     CDS             337045..337545
                     /locus_tag="DSY_RS01630"
                     /old_locus_tag="DSY0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458994.1"
                     /db_xref="GI:499778260"
                     /translation="MSSSKNNNVIDFQQYKEKRELQRAIPSAETSLENDFQGKLRLTQ
                     EDAEMIIYCMRLGREYFMIEVEKTPDEGGQAQRDFETVNSLLDRIQYEVLKLQTEEGY
                     IVGLSILELAFIIDCVEMTRNAVGKGINVFQSEPGDKEDYAKWLDGTFFYLLDVYEKW
                     RFYQGH"
     gene            complement(337571..338374)
                     /locus_tag="DSY_RS01635"
                     /old_locus_tag="DSY0293"
     CDS             complement(337571..338374)
                     /locus_tag="DSY_RS01635"
                     /old_locus_tag="DSY0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_011458995.1"
                     /db_xref="GI:499778261"
                     /translation="MQNLIVLGTGHALVTQCYNTCFALADDDDYILIDGGGGNGILSQ
                     LQKAKIPYAKIHHAFVSHGHTDHLLGMVWVIRMIGSAMAAGKYEGDFKLYCHDELASA
                     LHALVKITMDKQIIDLISRRIHIISVADGQQEELLGHTFTFFDLHSAKAKQFGFKIHL
                     DCDKKLAFIGDEPYHPLCQKYVENSDWLLCEAFCLYAERELFKPYEKNHSTVKDSCQL
                     ATLLNIKNLILWHTEDKNIGKRKALYTAEGKQYYKGNLFVPDDFDVIAL"
     gene            338629..339420
                     /locus_tag="DSY_RS01640"
                     /old_locus_tag="DSY0294"
     CDS             338629..339420
                     /locus_tag="DSY_RS01640"
                     /old_locus_tag="DSY0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792215.1"
                     /note="With Mot B forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotA"
                     /protein_id="WP_011458996.1"
                     /db_xref="GI:499778262"
                     /translation="MELSTLIGLLLGFIAVGVGMILKGASLTALINPAAILIIIVGTI
                     ATIFIGFPMEDLKRVPKLFKILFTKQQLISKKELVKQFAEWTTVSRREGILSLENRLE
                     EINDDFLKKGMGMAIDGNDAEFIRDVLFEDISAMEERHRDGALVFTQMGTYAPTLGVL
                     GAVVGLISALSNLNEVEALGHLISAAFVATLLGIFTGYVLWHPMANKLKLFSRREAEI
                     KRMMLEGILSIQAGDNVNAIHNKLFAYLSAAERRELTEEMGNEKA"
     gene            339407..340201
                     /locus_tag="DSY_RS01645"
                     /old_locus_tag="DSY0295"
     CDS             339407..340201
                     /locus_tag="DSY_RS01645"
                     /old_locus_tag="DSY0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_005809827.1"
                     /db_xref="GI:492324593"
                     /translation="MKKHKKEHHEDHMDETWLVPYSDILTLLLALFIILFAAGQIDQK
                     KYERIMAGFNSAFTGGTSVFESTSELNIDITDDNMGKNNDPVTTETDSLLAAARARED
                     RDMSDMKAKIDQYIKENNLSAQLETRITEEMLMISIRDYALFDSGSALVKTEAQKLAY
                     IISDILRQYPGYNVEVAGHTDNLPINTAEFPTNWDLSSRRSLNFMKYLLQSDGLDQSR
                     FRSIGYGEFQPIATNTTEEGRAKNRRVEVNILRNFGQPTSIFSSER"
     gene            340548..342222
                     /locus_tag="DSY_RS01650"
                     /old_locus_tag="DSY_16SrRNA3"
     rRNA            340548..342222
                     /locus_tag="DSY_RS01650"
                     /old_locus_tag="DSY_16SrRNA3"
                     /product="16S ribosomal RNA"
     gene            342446..342521
                     /locus_tag="DSY_RS01655"
                     /old_locus_tag="DSY_tRNA13-Ala"
     tRNA            342446..342521
                     /locus_tag="DSY_RS01655"
                     /old_locus_tag="DSY_tRNA13-Ala"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:342479..342481,aa:Ala,seq:ggc)
     gene            342620..345537
                     /locus_tag="DSY_RS01660"
                     /old_locus_tag="DSY_23SrRNA3"
     rRNA            342620..345537
                     /locus_tag="DSY_RS01660"
                     /old_locus_tag="DSY_23SrRNA3"
                     /product="23S ribosomal RNA"
     gene            345676..345792
                     /locus_tag="DSY_RS01665"
     rRNA            345676..345792
                     /locus_tag="DSY_RS01665"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            346059..346835
                     /locus_tag="DSY_RS01670"
                     /old_locus_tag="DSY0296"
     CDS             346059..346835
                     /locus_tag="DSY_RS01670"
                     /old_locus_tag="DSY0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011458997.1"
                     /db_xref="GI:499778263"
                     /translation="MNIFMGLAIGLLSGFFGGLVGLGGGIIMIPLMVGLLKINQHMAH
                     GTSLVGVVFTGISGAITYSLSGSIELVPALLLASTAMITARLGARYATSLPEWKLKRS
                     FGYFLIFVTIVFLLKPYLGEFSLSSTVWIKTIILLGIGAFAGFLSGMMGVGGGSIMVP
                     AMVIFAGMGQQMAQGISLLAMIPASAIGAFTHNRNGNVHTKILPGLVVGILPGTFLGG
                     SLAHILPEVALRIIFAIVVVYTAIKNIRAKKPETAMEPST"
     gene            346832..347587
                     /locus_tag="DSY_RS01675"
                     /old_locus_tag="DSY0297"
     CDS             346832..347587
                     /locus_tag="DSY_RS01675"
                     /old_locus_tag="DSY0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458998.1"
                     /db_xref="GI:499778264"
                     /translation="MKIIISPAKKMNMDGDFLSPRNIPVYLEKAKKLQRHLQSLPYEE
                     LRKLLCCNDEIAGLNYERYQTMDLSGYTSPAILAYDGIQYKYMAPQVFEDDYFDYIEK
                     HLRILSGFYGILKPFDGVVPYRLEMQAKLKTDFCRNLYDYWQDDIYRELTQEDTTILN
                     LASAEYSKTIEKYLTAGINYVKCVFGELRDGRVIEKGVYVKMARGEMVRFMAEKAIKD
                     LEQIKEFNRLGFRYREQLSDNNTFVFVKAMAEK"
     gene            347622..348521
                     /locus_tag="DSY_RS01680"
                     /old_locus_tag="DSY0298"
     CDS             347622..348521
                     /locus_tag="DSY_RS01680"
                     /old_locus_tag="DSY0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011458999.1"
                     /db_xref="GI:499778265"
                     /translation="MINSLADPSINLRESLDAKSYTHINNLQRLCLEHDRTNLKLELD
                     YKLSRAEGKPGSLKTINEFMCYEGELLIGYMGICDFGGEEIEVNGMVHPDYRKKGIFK
                     TLFSFAKNEWSKRRASRMLLLSDRDSLTGQAFIKRVSGVKYKHTEYEMFLQSDTKQEL
                     NSCKVVLRKATGNDTREIARQNFIYFEQESQDENMLIPEEEARAGMIIYMAEVNNCVI
                     GKVHLDISSNVGGIYGLGVLPEYRRKGYGRDILTLGIKELKSNNFQEIMLQVNVKNEK
                     ALDLYRSCGFEVTSTMDYYELKK"
     gene            348652..348975
                     /locus_tag="DSY_RS01685"
                     /old_locus_tag="DSY0299"
     CDS             348652..348975
                     /locus_tag="DSY_RS01685"
                     /old_locus_tag="DSY0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_005810532.1"
                     /db_xref="GI:492325350"
                     /translation="MALKQLDSNSFEEIIYDNGEACLVLFSRKSCHVCKEVGPMVEDL
                     APKYSGKFGFYYVDVEENMTLFQRFSLKGVPQILFFKDGEYQGKLSGNVEEEVLEEKI
                     AEIQA"
     gene            complement(349076..349528)
                     /locus_tag="DSY_RS01690"
                     /old_locus_tag="DSY0300"
     CDS             complement(349076..349528)
                     /locus_tag="DSY_RS01690"
                     /old_locus_tag="DSY0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_005810530.1"
                     /db_xref="GI:492325348"
                     /translation="MDKEKAIKLVSSKIKLIRVENGYSQDRMADIIGISKKTLVQIEK
                     GRDYASWGVVVATCAMFRESEIMQSIFGDDPLEVLRTIAHERIDSPKEKTMGGKIWWA
                     DVHKEGLFRLQQNLISKHYRILDDDGYRWFSSFDKEEALTRLFELSSS"
     gene            349667..350272
                     /locus_tag="DSY_RS01695"
                     /old_locus_tag="DSY0301"
     CDS             349667..350272
                     /locus_tag="DSY_RS01695"
                     /old_locus_tag="DSY0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810527.1"
                     /db_xref="GI:492325345"
                     /translation="MDMGKKRKIIIPAAVGLGLLIAGFAYLMQIRGEFKDYLSEKYPE
                     QTFQVGFIKIDPIYGSYFTTASCLNDDVSFPIRKSFRTENINESYLQTKSHNQYNAYI
                     KEVFNESGIKNHIISVTGGGKDHYQNDGHYDQINLYLTEEADLISVTKTALNLLREKG
                     VQADTVILTQEKDGHVYELYGSTADYALTEDQLREKIRKIK"
     gene            350481..351143
                     /locus_tag="DSY_RS01700"
                     /old_locus_tag="DSY0302"
     CDS             350481..351143
                     /locus_tag="DSY_RS01700"
                     /old_locus_tag="DSY0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_011459001.1"
                     /db_xref="GI:499778267"
                     /translation="MLYRLMKRFSDYNILHDVIDCLTASLEAKDNYTSGHSNRVGDMA
                     FDICKSLKLSIVERDRIHIAAHLHDIGKIGIPDHILNKPGRLSPAEWAQIQGHPEIGY
                     TILSKSRKLKDIGQIVLSHHERWDGKGYPHGLKGEEIPLGARIIGVCDSIDAMTSDRA
                     YRKAFTWAECKAEIIANKGSQFDPEVVEAITDSLWSKWQMEYCKERERERSLGQGIQS
                     AT"
     gene            351315..351764
                     /locus_tag="DSY_RS01705"
                     /old_locus_tag="DSY0303"
     CDS             351315..351764
                     /locus_tag="DSY_RS01705"
                     /old_locus_tag="DSY0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810523.1"
                     /db_xref="GI:492325341"
                     /translation="MDINYAIKEVIRHHRQAVQKSAWEFIDVDTLYTLRDIAITVEDE
                     KFHVVGDSDKYYVMVRKSSMDNDVIMFGRVDGGNLEKTLARDIPKVGLAILAIRHIED
                     DHYIDDLLSARREELLDQLILCFGSERFNLADGTSFTLQELKQAVSH"
     gene            complement(352064..353533)
                     /locus_tag="DSY_RS01710"
                     /old_locus_tag="DSY0304"
     CDS             complement(352064..353533)
                     /locus_tag="DSY_RS01710"
                     /old_locus_tag="DSY0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011459002.1"
                     /db_xref="GI:499778268"
                     /translation="MSTNTYARKKALQNEDWWAAWLGLFIFALGLGPYFGADLLGWVT
                     KASVWIEPAKAFAPVSKATGLNGFTSLLVTFLFVLAITTVAAKFVGSNLKKYAIGFSI
                     IFWVTMGCLMLGNIAYIGATPDKTASYGIGWSLGLGEMGYIIAMVVGLIIGNFFIKQA
                     DFLKEAAKPELFIKIGIVVLGASIAIKTLDAFGLATTIIIRGLCAVVEAYLIYWPVVY
                     LIARKFFKFTPEWAAPLASGISICGVSAAIATGSAIRARPVIPVILSAVIIVFVALEL
                     LLLPWLAQAFLFKDPMVAGAWMGLAVKSDGGAIASGAITDSLIRGRALRELGINWEEG
                     WILMVATTTKVFIDIFIGVWAFILAIIWSVFPIDKNASANPGERNKVSAVDIWDRFPK
                     FIIGFVLTFLILFLVGVNNPDGVKALSTGVNEGNAFRTIFFGLCFFSIGLVTNVRKLW
                     AEGMGRIVAIYGIALFGFILWFGLFISWLFYHGITPPTV"
     gene            354352..355251
                     /locus_tag="DSY_RS01715"
                     /old_locus_tag="DSY0305"
     CDS             354352..355251
                     /locus_tag="DSY_RS01715"
                     /old_locus_tag="DSY0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459003.1"
                     /db_xref="GI:499778269"
                     /translation="MFLVFYAILAMFLFLALSAYKAYEYTKMPMHGRLDLYPVPKEKG
                     HEHGGSYYEQAEWWAKPHETSTASEIVDMLKEILFIKKLFQNQKSLWWLSYSLHLGIY
                     FIIAWTVILVAAAATQLAGGTVAADGGLWGILLYYATPLVGWVGFFLASFGAVSLLVR
                     RVADPILKKYTTPQEYFNLLLLFVVTLTGVLVWSSDITMSNARDAMANVLSFQPLNGE
                     PLLTVHIILAGIMLIYIPISKMSHYVGKFFSFHMVIWDNDPNVAGSKVEEKIRQAAQY
                     RPQNKWSAPHIAGAPAPTEKSPK"
     gene            355285..356898
                     /locus_tag="DSY_RS01720"
                     /old_locus_tag="DSY0306"
     CDS             355285..356898
                     /locus_tag="DSY_RS01720"
                     /old_locus_tag="DSY0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine-rich domain protein"
                     /protein_id="WP_005810511.1"
                     /db_xref="GI:492325329"
                     /translation="MINHKDLKPSDLNRPDEQLVKVEELMPLPRPYDKPGMEPDFMEV
                     KPAWREKYCTSLDGFVAIDTLTRPKSKEEEEEFVRKFLSGLEKLFTDANNGMRQPLML
                     SFEYCAKCDTCSNACHIYEGSGNNELYRPIFRVEALRKIYKKYFTTSGKLLGGLVGAD
                     LEATWESIARLGESAYRCNLCRRCAQTCPLGLDNGIMAKEIRKIFSMEMGIAPSPIHK
                     KGTENQLKTGSSTGLTKPAFLDIVEFLEEEMDEKFGLKIKFPIDKKGADILLMHNAGE
                     YRAWPENPIAFAILFEAAGIDWTISSEMMGYDSVNYGIWYDDAQAKKIALAQMKVAKD
                     LGVRRVVQGECGHAHKAAAVSADRMAPGSDKVPVESFFPLLRDIVKSGAIKFDPSRNN
                     FPVTLHDPCNVVRQMGIVMPQREVLHQLAPQFREMTPHGVDNYCCGGGSGFAIMHSQN
                     FGDFLKKISARKKFAQILNAFQDTIEDPQIVKYICAPCSNCKGTMRDILEYYEATDKF
                     NVQYGGLIELVVNAMADLKRPFFEFLEEE"
     gene            356945..358639
                     /locus_tag="DSY_RS01725"
                     /old_locus_tag="DSY0307"
     CDS             356945..358639
                     /locus_tag="DSY_RS01725"
                     /old_locus_tag="DSY0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_005810509.1"
                     /db_xref="GI:492325327"
                     /translation="MKVVIIGGVATGPKVAARLRRLSIDAEITVVEKGKIVSYGSCGL
                     PLFLGNLVPKIEDLMKTSAGLIRDTQYFEDTKGINVLTQTEALAIDRQQKKVRVRNLA
                     TGEERDLDYDHLVLATGAKEVVPPIPGIQYQNVYTLHSLDDAVNIKALIKEKKIQHAT
                     IIGAGLIGIEVADAIAGPRLKVTLFESQGSVVPKLLDPDMALLVEHKMRSRGIDLRLN
                     CPVKELTGDEDGKVNGVILENESITTGLVIVAVGVRPEVTLARQAGLTLGITGAIQVN
                     QYMQTDDTYIYAGGDCAEQVNMLSGRQVFVPLASTANKQGRVIADNIAGRASEFPAIC
                     ATSVFQAFELNVGRTGLGEPEARELGYDVITSLSTGLDAVHYYPVHGAVTIKLIAERT
                     SGRLLGAQVCGTGEAIKRLDVLITILRFNGTVKDISNLDLSYAPPFATAIDVLIHAAN
                     TLENKQLGIVDTVNPFELLERLKKDKSIIFVDVREGDETRANPVEGSQIIVIPLGELR
                     KRYTEIPQGSPVVTFCELGIRGYDAACFLKGVGFQDVSFLEGGMSTWGALQPALNM"
     gene            358777..358965
                     /locus_tag="DSY_RS01730"
                     /old_locus_tag="DSY0308"
     CDS             358777..358965
                     /locus_tag="DSY_RS01730"
                     /old_locus_tag="DSY0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_005810507.1"
                     /db_xref="GI:492325325"
                     /translation="MFIITIDPDSCSGCDACADSCPAHLLKFNGEITEVVGDETECMG
                     CESCVSVCPTGAASIMEM"
     gene            359005..360198
                     /locus_tag="DSY_RS01735"
                     /old_locus_tag="DSY0309"
     CDS             359005..360198
                     /locus_tag="DSY_RS01735"
                     /old_locus_tag="DSY0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase"
                     /protein_id="WP_005810505.1"
                     /db_xref="GI:492325323"
                     /translation="MAEKRTPQLDELEKGQWPSFVTEIKKAAVKNEASKELLHLLERS
                     YEEKRGHWKHGGIVGVKGYGGGVIGRYTDLPEDYPNLAAFHTVRINSPSGWFYNTKSL
                     RTICDIWEKRGSGLMNFHGATGDAILLGTTTDQLQPIFDELSEGGFDLGGSGSDLRSP
                     SCCVGPGRCEHACYDTLEACYNITNQYQDELHRPMWPYKFKIKFSGCANDCTAAIARS
                     DCAVIGTWRDTLTIDQEAVKAYVAEGLNIQAVVCDRCPTKCLKFDAETQELSVIAEEC
                     TRCMHCINRMPKAIAPGKERGATILLGGKSTIVQSAFMGWVIVPFMKMEVEDDFQEFK
                     DMIERIWEWWDENGKTRERIGETIYRLGMTNFLTSVGLPAVPQMVYRPRANPYVFWPE
                     DEIKK"
     gene            360212..361270
                     /locus_tag="DSY_RS01740"
                     /old_locus_tag="DSY0310"
     CDS             360212..361270
                     /locus_tag="DSY_RS01740"
                     /old_locus_tag="DSY0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite reductase"
                     /protein_id="WP_005810503.1"
                     /db_xref="GI:492325321"
                     /translation="MAILDQGPLNYKEQLPPIIKENYGKWRYHENPKAGVLKHVSESG
                     AELYSIRVGSPRLVSLDFIREICNLADEYCDGYLRFTARHNVEFLVSDAAKVEPLIAA
                     LGAKGLPVGGTGASVSNIVHTQGWVHCHTPATDASGVVKAVMDDLYEYFVSMKLPAQM
                     KISLACCLNMCGAAHCSDIAIVGVHRTPPRIDHDKIRKGTEIPSLVASCPTGAIRPNP
                     KEKSVVVNDAKCMYCGNCYTMAPGMEIIDPQNDGIAILVGGKVANARTNPMFSRMVIP
                     FLPNNPPRWPEVTDAIRNIVETWAANANKGEKMGEWIERIGWERFFSLTGIEFSDKLI
                     DDFIFSRETFRTSAAFKY"
     gene            361314..361535
                     /locus_tag="DSY_RS01745"
     CDS             361314..361535
                     /locus_tag="DSY_RS01745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-binding protein"
                     /protein_id="WP_015942642.1"
                     /db_xref="GI:506422923"
                     /translation="MQKGAADPVIKEKVLAFLDTVEKAKSKEIAAQIGEKKGDVDLAV
                     KELAMEDKVEYLYITTTFIALKGKVKEPT"
     gene            361637..362227
                     /locus_tag="DSY_RS01750"
                     /old_locus_tag="DSY0311"
     CDS             361637..362227
                     /locus_tag="DSY_RS01750"
                     /old_locus_tag="DSY0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810499.1"
                     /db_xref="GI:492325317"
                     /translation="MDKTLRSLLTEKQDLIIEKWCREIINTYPKETAKFLKEKRDEFA
                     NPIGNTISQGIEQTFTALIQESKENEVHLFLKDMIKVRAVQSFTASQAVSFVFLLKRI
                     IREELGKVAEEERIAKALLDFETQIDQLALASFDIYSECRDKLADLKTMEIRNQTYRL
                     LQQANLLTLRSDMEPEEPHSEPEPFRVNTKRKEVVT"
     gene            362224..363225
                     /locus_tag="DSY_RS01755"
                     /old_locus_tag="DSY0312"
     CDS             362224..363225
                     /locus_tag="DSY_RS01755"
                     /old_locus_tag="DSY0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="menaquinol oxidoreductase"
                     /protein_id="WP_005810497.1"
                     /db_xref="GI:492325315"
                     /translation="MKALFSLIAVLILMLIPLVGVGLANLQGLFGIVLPYLALILFLG
                     GFIYRIMGWARTPVPFRIPTTVGQGKSFDWIKQNKIENPTSNLGVIIRMAMEVLLFRS
                     LFRNSKTELRNGENGPQLAHGSNKWLWLFGLMFHWSLLIILIRHLRLFLEPVPAVISS
                     LDSLDSFFQIGLPALYITDMLIVAALTFLFLRRVVAPQVRYISLAADYFPLFLLMGIA
                     ATGILMRYIFRVDIASIKEFAVGLLTFTPHIPDGIGTIFYIHLFFVSCLFAYFPLSKL
                     MHMGGIFMNPTRNMKSNNRMVRHINPWNYPVEVHTYEEYEDDFRTKMIKAGIPVEKE"
     gene            363235..364863
                     /locus_tag="DSY_RS01760"
                     /old_locus_tag="DSY0313"
     CDS             363235..364863
                     /locus_tag="DSY_RS01760"
                     /old_locus_tag="DSY0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr menaquinol oxidoreductase iron-sulfur
                     subunit"
                     /protein_id="WP_011459004.1"
                     /db_xref="GI:499778270"
                     /translation="MAKYKLPKSEELSKIDYKPGSTEWMDTPVTTPFEPGTFCWGAKG
                     KNLETVGFPNARDWSPVDEDWQLPENWKSTVIEGIGERLTKYRSFKIMMDICVRCGAC
                     ADKCHFYIGSGDPKNMPVLRAELLRSVYRRYFTPSGKFLGRLAGARDLTPEVIKEWWY
                     YFYQCTECRRCSVFCPYGIDQAEITIIGRELLNLLGLNIDWIAGPVANCYMKGNHLGL
                     EPHAITGNIEMMCDDIEDITGVRVEPTFNRKGAEILFVTPSGDLMGDPGIYTCMGYLM
                     LFHELGLDYTWSTYASEGGNFGFFTSNEMAKRLNSKIYAEAKRLGVKYIIGGECGHMW
                     RVVNQYMGTWNEPADFLEVPVSPITGTRFDNAASTKMIHITEFTADLIKHGKLKLDPS
                     RNDHLKVTYHDSCNTSRGMGLLEEPRYIINNVCSNFYEMPESTIREKTFCCGSGSGLN
                     ASENMEERMRGGFPRANAVKYVQDKHGVNMLANICAVDRAALPALMDYWAPGVGVIGV
                     HELVANALVMTGEKERTTDLRGEDLPEKGVTADE"
     gene            364856..365299
                     /locus_tag="DSY_RS01765"
                     /old_locus_tag="DSY0314"
     CDS             364856..365299
                     /locus_tag="DSY_RS01765"
                     /old_locus_tag="DSY0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hdr menaquinol oxidoreductase cytochrome C
                     subunit"
                     /protein_id="WP_005810493.1"
                     /db_xref="GI:492325311"
                     /translation="MSKGGKTIGGLLIFVVIAIMPFLYNMGKADAKPEINTDTPVIRE
                     LGATQCIEGTEYMRENHMHLLLEWRDAVVREGKTTYTNSQGEQFEMSLQNTCLNCHND
                     TPETVYYTAETANQGDNQFCYSCHNYAAVEPDCWACHAGPREAEK"
     gene            365296..366090
                     /locus_tag="DSY_RS01770"
                     /old_locus_tag="DSY0315"
     CDS             365296..366090
                     /locus_tag="DSY_RS01770"
                     /old_locus_tag="DSY0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011459005.1"
                     /db_xref="GI:499778271"
                     /translation="MSINRREFLKKAGVIAALGLGGAVTLDAFELLEPLKAADFTSEN
                     KLAAQRWAMVIDMSKLSQADIDEIIKGCHELHNVPDMGNEKDEIKWIWTDTYEHVFPG
                     DENHYLDEKTKTMPFLTLCNHCDHPPCVRVCPTQATFRREDGVVGMDMHRCIGCRFCM
                     AACPYGARSFNYWDPKPHLAKINPEYPHRSKGVVEKCTFCMERLDQGLAPVCVEKSKG
                     AIVYGDLEDPNSAVRKVLSTHYSIRRKPELGSQPSVYYLIGGEERA"
     gene            366083..367234
                     /locus_tag="DSY_RS01775"
                     /old_locus_tag="DSY0316"
     CDS             366083..367234
                     /locus_tag="DSY_RS01775"
                     /old_locus_tag="DSY0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="menaquinol oxidoreductase"
                     /protein_id="WP_041272193.1"
                     /db_xref="GI:752602806"
                     /translation="MLEKSLSGSKKYWLWVGFLLVVILGGFLAYLRQYNEGLGVTGMS
                     RDVSWGLYISQFTFLVGVAASAVMVAIPYYLHNYKKFGKIVILGEFLAVPSVIMCILF
                     IFVDVGRPDRILNVLLHPTPHSVMFWDMCVLCGYLLLNLVIGWTALGSERKGFPPPAW
                     VKPLIYLSIPWAVSIHTVTAFLYSGMPGRHLWLTAIMAARFLASAFAAGPALLILLCM
                     IVRKVSTFDPGKEAIQSLAKIVTYAMIANVFFYILEFFTAFYSNIPGHMHPLQYLFAG
                     LHGHGQLVPFMWVAVVLAFVGIFLLVVPKFRRNEKILPFALLSVFIAAWIDKGLGLVL
                     GGFVPTPLEHVVEYTPTATELAVTLMVYAIGALLITILYKVVIGVREEI"
     gene            367281..367598
                     /locus_tag="DSY_RS01780"
                     /old_locus_tag="DSY0317"
     CDS             367281..367598
                     /locus_tag="DSY_RS01780"
                     /old_locus_tag="DSY0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459007.1"
                     /db_xref="GI:499778273"
                     /translation="MADLVVNGVSYELDEDGFLEDAAEWNEDVAKALAPNEDVEELTE
                     EHWRVINYLRDYYDQYGVAPMVRKLLKDTGYDQKTIYNLFPTGPGKGACKIAGLPKPT
                     GCV"
     gene            367738..369207
                     /locus_tag="DSY_RS01785"
                     /old_locus_tag="DSY0318"
     CDS             367738..369207
                     /locus_tag="DSY_RS01785"
                     /old_locus_tag="DSY0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="WP_041272194.1"
                     /db_xref="GI:752602807"
                     /translation="MTTNHEHQQMSTLSTPRLVIGAPQGRSGKTTFTLGLLRALSRQG
                     LPVQPYKKGPDYIDTSWHTAAAGRVSRNLDSFMMSQEDICRSLAQHSQDCQFSLIEGA
                     MGLFDGLDINGSASTAEIAKITSSPVLLVLDATRITRSLGAIVMGCQHFDPNINIVGV
                     VLNKIARARHEKLARETIEQYCRIPVVGAIPKDSRILIPDRHLGLVTNGEWSETDTFL
                     DNLADVVSENVDIAKIMELARTAAPLSYSTPTKFSVSQGYPLKTKPPAPRIGVIRDAA
                     FSFYYPENLAVLESKGAELVTVSALSHQHLPKDLDALYIGGGFPEVFAEQLANNRTLR
                     QEIRLAGEDGLPIYAECGGLMFLGRSIITGDGSYDMVGLLPLDTRMEKKPQGHGYTVM
                     KVLENNPWFRQPKIRGHEFHNSSVLNLDRTKIEFGFEVERGHGIDGKYEGICYKGVMA
                     AYNHIHALGSPDWAECMVKLATQYKERRSKMVFELFKSS"
     gene            369407..370375
                     /locus_tag="DSY_RS01790"
                     /old_locus_tag="DSY0319"
     CDS             369407..370375
                     /locus_tag="DSY_RS01790"
                     /old_locus_tag="DSY0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_015942645.1"
                     /db_xref="GI:506422926"
                     /translation="MFEQQFVVFKEVADTKNITLAAKRLHMSQPSISLQIQNMENLYG
                     ARFFNRTNKGVTLTKAGEVFYDHVNNILNILTVAQQQISVLTEDQRALIYIGATLTIG
                     EYILPNILAYLYKIRPDVDFKVKIANTETISQEVIEKRIHIGLIEGPAPRNKEIVVEK
                     FWQDELVVVVPSFHPWAARHSITLAELAKERLIMREEGSGTRKVTELALKEMGLDLSQ
                     INVTMELGSTQAIKKVVAAGIGITIISSLTVSRECENGLFKVLKVQDSPVYRPLNMLT
                     LAHTTQTKDERFLISMLHDRDLLEAIINGNCEDDKELYPCGDCLEA"
     gene            370423..371292
                     /locus_tag="DSY_RS01795"
                     /old_locus_tag="DSY0320"
     CDS             370423..371292
                     /locus_tag="DSY_RS01795"
                     /old_locus_tag="DSY0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_005810480.1"
                     /db_xref="GI:492325298"
                     /translation="MLQDIRIGLAQFEAKVGDTERNLQEIIRTAEVASSQGVSLLCYP
                     ECALHGYSPKDASEIADPLDSMAVARLRECARDLGLILLVGMVEKSPEGKKPYISQLI
                     VFPDREPEVYRKVHLGRIEQHYFTAGDSFPIFAAGGVKFSIGICWDWHFPELSAICSL
                     KGAEIQFAPHASPVVSGDRKEIWKRYLGARAYDNSVYLCACNLVGTNNRDKEFSGGIL
                     VFGPKGEVLAENQDTQEQLFVVDLPAKPINTLRSPKRQSMRDTFFLADRRKELYKELL
                     ELEIEKMPQMSHD"
     gene            371769..372233
                     /gene="nrdR"
                     /locus_tag="DSY_RS01800"
                     /old_locus_tag="DSY0321"
     CDS             371769..372233
                     /gene="nrdR"
                     /locus_tag="DSY_RS01800"
                     /old_locus_tag="DSY0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q251D2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor NrdR"
                     /protein_id="WP_011459010.1"
                     /db_xref="GI:499778276"
                     /translation="MHCPFCGNDETKVLESRQVEEGTAVRRRRECERCARRFTTFEKF
                     EDTPLIVVKKDGRREEFSRGKLKAGILRACEKRPVSIEQIETLVYEIEKGLRNGSERE
                     VQSKAIGEAVMNALVHLDEVAYIRFASVYREFKDVQRFLEELHELVEKKSSR"
     gene            372378..375839
                     /locus_tag="DSY_RS01805"
                     /old_locus_tag="DSY0322"
     CDS             372378..375839
                     /locus_tag="DSY_RS01805"
                     /old_locus_tag="DSY0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459011.1"
                     /db_xref="GI:499778277"
                     /translation="MSFQESAPKAWLKANLTPNARVILEKRYLKQENGEVAESPEDML
                     YRVASIIAQVEETFGKTKKEVKELAKSFYEMMAKLEFMPNSPTLMNAGRDLGQLSACF
                     VLPVEDSMEEIFDAIKSAAIIHKSGGGTGFSFSRLRPKNSTVRSTGGVASGPVSFMKV
                     FNAATEAVKQGGTRRGANMGILRVDHPDIREFITCKEDNKEITNFNISVGITEEFMKA
                     VQEKRHYNLIDPHTKEADGQLYAPEVFQLIVDHAWRNGEPGIIFLDRLNRDNPTPQLG
                     EIEATNPCVTGDTWVLTEEGAAQVRDLLGSQVKLALNGEYHETSKEGFFATGVKQVLT
                     LKTQQGYELKVTADHLVRVASDMTRYKVTQEWKPAGELKPGDTIVLSNNRSIQWQGKG
                     TKEEGYLLGLLLGDGTLKEEGAVISVWGEGEEAKSMMEAAEKAAFSLTHRQDFQGFQK
                     EISERHEHRMRFAALRDLAQQYGILPGSKAITQELEKTGQDFYQGLLRGLYDTDGTVT
                     GTQEKGVSVRLWQTDLAGLKVVQRMLQRLGIISTLYEERKPAGQKLMPDGQGGSKEYP
                     VQAGHELVISQDNIEIFAEKVGFSNSKKAQLLAEKLNVYQRSLNRERFVDNIVACVPG
                     DAEEVFDAQVPGINAFDANGIYVHNCGEQPLLPNEACNLGSINLKLMVTEKNGKVVVD
                     WERLGQITRLATRFLDNVIEANTYPLPSIEEMVKGNRKIGLGVMGFADMLILLQTSYA
                     SEDAVEYAEKVMNFIQTEARLESQRLAEERGTFPNYQGSIYDGVRPLRNATLTTIAPT
                     GTISMICGASSGVEPLFAVAYTKTVMDGTPLIEVNPIFQSLAEDYGFNSPELMRKIAE
                     KGTVLGFPEVPNWVQEVFVTAQEIEPEWHIRIQAAFQKYTDNAVSKTINFANEATHED
                     IAKAYELAHELNCKGLTVYRDGSREEQVLSTGITKKAEEKAEEAKTQVSIPKVPFIPE
                     VNTVLPRPRPTTTTGVTEKIRIGCGNLYVSVMADEKGICEIFTNTGRAGGCSSQSEAT
                     ARLISIALRSGISVDAIIEQVKGIRCPACIRREGVNVTSCPDAIARVIKEYVELGKGK
                     VNSVKVTSQPAVEEKPVQSKSASITNPQKTRATVAEGNACPECGMSINHESGCVVCTH
                     CGYSKCG"
     gene            376074..377573
                     /locus_tag="DSY_RS01810"
                     /old_locus_tag="DSY0323"
     CDS             376074..377573
                     /locus_tag="DSY_RS01810"
                     /old_locus_tag="DSY0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459012.1"
                     /db_xref="GI:499778278"
                     /translation="MEIILAAMPFLIILVLLFILRQSAVRAGISAYLLTLLIGLVIPR
                     FQIERQEILHATVKAVLTSAIVAYVLLFGIFLYHIMNETGLIKRIASLISGSTQDPVR
                     QVILLVVAFSPLVESVSGYGIAIIVVAPILVELGFSSFKAVLLSLLGLSAVPWGALAT
                     GTYIGANLAGIPFQRLGTDVAVLSIPTFFYFAVTAVYLAGGWQGVRAKWAELMLVAGS
                     LAFSVWLFNAYVSIELAGVFASLVALGVEFAFIYFTAKSTPEEAAFSLAARNQSKADI
                     LKTMSPYLILTGVLFISRLVPPIKAFAGSHAVFSLPAYSFSLPVLYSPGFSIFLTCLL
                     TILLFKIQKHVIKRAVQLSLKQWLPVTLSTIAFIGTSEIMAAAGMTTTLAQAAAAAFG
                     SAFVLCSPLIGGFGGFLTGSNVASNAMLINLQVEVAKQIGMPAELFASMQNTSSSHMT
                     MASPSRVLLGASVCNIRSEENRLLQKIFPMALGSLVLVLAAVFLLNLRG"
     gene            377800..379251
                     /locus_tag="DSY_RS01815"
                     /old_locus_tag="DSY0324"
     CDS             377800..379251
                     /locus_tag="DSY_RS01815"
                     /old_locus_tag="DSY0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005815706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272195.1"
                     /db_xref="GI:752602808"
                     /translation="MERSMVVDNRHLSTKFTVLVTSVIIVAVVIYLAWSINMQQAATE
                     DKVLAEARTLSIQMSAAWDYINDSQTAINYNSDGSYDFKGVYCSIAGKDIAQRFTRQS
                     EGYIIRYARENPRSGTDEPDVFERKALTLFATGESREQYGIEKYKGEMVFRYTSAIEI
                     RHNCLPCHGEPAGEKDETGFIKEGMKVGDIAGASSIIIPLDLYAKEARTRTLQTIGFF
                     LVLLFVVIAVVRFALRKWVTEPLTQANLELHDENEMKSNFLTIMSHELKTPLSSIIAF
                     TDIWEKSSREKSEDEQRLVQEIKENSRTLLNMVNNTIDVARLEAGRFEITYDEVELVD
                     IVSAVVSVAHPIAVKHNISLEKRISPDTPIIISDWEALRKILMNLVSNALKFTGAGGK
                     VDISVSYLSDRSRVVIQVADTGAGIPEKDHDQIFERFTQSTQPGDERINGSGLGLFLV
                     KTLTEKLGGEIEVDSVVERGSSFSVYVPIDSSK"
     gene            379788..381047
                     /locus_tag="DSY_RS01820"
                     /old_locus_tag="DSY0325"
     CDS             379788..381047
                     /locus_tag="DSY_RS01820"
                     /old_locus_tag="DSY0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015777487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272196.1"
                     /db_xref="GI:752602809"
                     /translation="MNAKKLLLLFMAAALSVVVGCSPQSQSVTTETKPIDWKSMYPAQ
                     YYSSLGSADHLDDVETVPKTGGYGHGSQSKYMPISIEQKNGEINATCISCKSSKFNEL
                     YEKYGNEVFNATPSAKYAEIMTAEDWWSCGTCHSDMTDPAGSVGAQIVTAELFGKELF
                     DKLDPKTAACSQCHNNLSPWSDSRIVNGSDILNSGKSPYRYGWDPDALIKATLEDAVP
                     DASRYPNGKTMELSAAAHAKVDESTGTYLIANGNHADAEMFQGSLHEQLGVSCTDCHM
                     PTLEDRSGEPYTSHDASKSVLNSEASMNYCLSCHSSQGLETVKDMYNYVRNAQAELAE
                     KDAAVADKLDETYGYIEAAVKGGTVSNEVLDKARFNYAVAAYYKEYVYGNRGATPGEK
                     VAHNPKMSHKYLERAIALLDETIEMLR"
     gene            381377..382072
                     /locus_tag="DSY_RS01825"
                     /old_locus_tag="DSY0326"
     CDS             381377..382072
                     /locus_tag="DSY_RS01825"
                     /old_locus_tag="DSY0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011459015.1"
                     /db_xref="GI:499778281"
                     /translation="MKIMLVDDEPSLCSALEIVITRAGYDFYCATDGIAALELFRSKK
                     PDLAILDLMVPWLNGFEICEEIRRTDSHIPILILSAKGDIVDKKMGFRAGADDYLTKP
                     FEEEELLLRIEALLRRRNKESGSLPINGLSQKVEIGELIIDPFRYEVTVRDRLVNLTP
                     KEYQIIALMANHPGKVFTREDLIDCIWGKEFETGSISIPVYIRRIREKIEQDPSEPTL
                     LKTVWRFGYKLGD"
     gene            complement(382173..382529)
                     /locus_tag="DSY_RS01830"
                     /old_locus_tag="DSY0327"
     CDS             complement(382173..382529)
                     /locus_tag="DSY_RS01830"
                     /old_locus_tag="DSY0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459016.1"
                     /db_xref="GI:499778282"
                     /translation="MKRLKFRVWNKVSKKMHNPQAISFDIQNCNPFAVSIPAKSWDPA
                     EKYELLQWTGLRDESGTDVYEADLVLIDYEIYRVHWHESEAAFKLISLKGSLEKEAGL
                     LPTGKIIGNTYETENL"
     gene            complement(382635..383516)
                     /locus_tag="DSY_RS01835"
                     /old_locus_tag="DSY0328"
     CDS             complement(382635..383516)
                     /locus_tag="DSY_RS01835"
                     /old_locus_tag="DSY0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041272197.1"
                     /db_xref="GI:752602810"
                     /translation="MNRSYLKYITSLILFGFNGIVASHISLSSYEIVFTRTLIGSLFL
                     VIVFGFSKQKMRFLSNKSHFLYLSLSGVAMGASWMFLYEAYTQIGVSIATLAYYCGPV
                     IVMILSPLLFKERMTSAKLIGFLAVLTGMLCVSGQAMSEEKTLFGLICGLLSAVMYAV
                     MVIFNKKAVSITGLENSMWQLMASFATVFLFLGLKQDFSINIASGDWLPILILGIVNT
                     GIGCYFYFSSIGLLPVQTVAICGYLEPLSALLFSAALLGERLSLVQILGALLILGGAA
                     FGELYRRKLPANSSLTT"
     gene            complement(383635..384912)
                     /locus_tag="DSY_RS01840"
                     /old_locus_tag="DSY0329"
     CDS             complement(383635..384912)
                     /locus_tag="DSY_RS01840"
                     /old_locus_tag="DSY0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase"
                     /protein_id="WP_041272198.1"
                     /db_xref="GI:752602811"
                     /translation="MLHTNGEQLLKEFADHAYPRQVAEIIPGSVYHVIGYGHSNAGFI
                     IAENSVILIDTLDSDERAQTLKSLIARYTNKPVKTIIYTHGHPDHRGGSGAFMDSNPE
                     IIAFAPCKPVLGRMNALQDVLNQRGIRQFGYQLNNEEALTQGLGIREGKAQGEGQYAI
                     MPPTTVYQEDSVLRSLDGIELELAAAPGEADDQILIWLPAHKVLFCGDNYYGCWPNLY
                     AIRGSQYRDVSAWVDTLNKLIAYRAHYLLPGHTRPIIGETAVQETLTNFRDAIDYVLT
                     ETLKGMNQGLTMDEVAEAVKLPEKWAKLPYLGEFYGTVSWSVRGIYAGYVGWFDGNPT
                     HLNPLPPAVQAQKTVALMGGAETVLSAIRQALSEQDYQWSVVLADLLLAMDRSHKQAK
                     EYKAQGLVELGHRETSANGRHYYLAYAKELLAE"
     gene            385200..386150
                     /locus_tag="DSY_RS01845"
                     /old_locus_tag="DSY0330"
     CDS             385200..386150
                     /locus_tag="DSY_RS01845"
                     /old_locus_tag="DSY0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-phosphate N-acetylgalactosaminyl-1-phosphate
                     transferase"
                     /protein_id="WP_041272199.1"
                     /db_xref="GI:752602812"
                     /translation="MEFIIPFFFVFFIVFMSIPLLEKLAVKWNFVDKPTERKKHKHPI
                     PLLGGVGIFLGFMIGYLVFVRPINYQSLAIIIASVLVLGIGLIDDWYKTLGKEFPALP
                     RLMVHILAAWMVFSAGIVFYGFTNPFTQQYIVLPYIIQLILSIMWIVGVTTVINWSDG
                     IDGLAGILSSIAGATLYVAALAKGQSDSALLSALLVGAALGFLRYNRHPARIFMGDSG
                     ANFLGFILAIVALSGAFKQATLVSLSIPVLALGVPIFDNIIVVLKRFSRGESIYKADA
                     TQIHHRLISSGLNPKQTVAFISLMSVCFSLLSIIILLLNI"
     gene            complement(386265..387170)
                     /locus_tag="DSY_RS01850"
                     /old_locus_tag="DSY0331"
     CDS             complement(386265..387170)
                     /locus_tag="DSY_RS01850"
                     /old_locus_tag="DSY0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_018306043.1"
                     /db_xref="GI:517117225"
                     /translation="MKKMLLATLVGISILLTGCNGSKDVDSPIGATSPTHSSTLSQEE
                     ALRVLYQELLAKTEHTVAFLKEARVGNHTIYAFQHMINGRAPTIDFVHSKTGKVYYDS
                     VELLLDIFINSEDKEPYKAANYINKDIYYLEMKSVNDPEPTTWSTYVFNEDAYTSAEA
                     AKKAVVKVYAENHPTLSLLGKPLAEVEKITKVESIKAPVETKDEETTEVTQIALDNIL
                     ILFDKDSISSEIFLEGQQEILGVKIGEPFNEISDKLGMPDSFGQDPEFENIYTMRYLF
                     DGFQIEFYGENKDANTVSALIKKRI"
     gene            387752..389053
                     /locus_tag="DSY_RS01855"
                     /old_locus_tag="DSY0332"
     CDS             387752..389053
                     /locus_tag="DSY_RS01855"
                     /old_locus_tag="DSY0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810461.1"
                     /note="involved in the transport of nitrate and nitrite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate transporter"
                     /protein_id="WP_011459021.1"
                     /db_xref="GI:499778287"
                     /translation="MQKIERWDPEDQEFWETKGKKVANRNLWISIPALLLAFAVWQLW
                     SVVAVNLNSAGFQFTTDQLFTLAALPGLTGATMRFFYSFTVPVFGGRNWTVVSTASLL
                     IPTIGIGLAVQNPATSFTTMAILAAFCGLGAGNFASSMANISFFFPKKAKGTALGLNA
                     GLGNLGVSAVQFLAPLVITVGIFGSIGGAPQMMVQGGLQQQVFLQNALFIWVIPIVLT
                     VIAAFWGMNNLETAKASVREQMIVLKRKHTWLMSWLYTMCFGSFIGYSAAFPLLIKTQ
                     FPDVNGLQLAFLGPLVGALARPLGGWLGDKFGGARITTLDVLVMIASALGAIFFIGMN
                     SFVGFFTMFMLLFITAGIANGSTFRMIPVIFPPKEASAVLGITSAIAAYAAYFIPKAF
                     SWSLQATASPNGAMLAFVAFYVVSLGINWYYYDRRNAEIKC"
     gene            389089..390309
                     /locus_tag="DSY_RS01860"
                     /old_locus_tag="DSY0333"
     CDS             389089..390309
                     /locus_tag="DSY_RS01860"
                     /old_locus_tag="DSY0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011459022.1"
                     /db_xref="GI:499778288"
                     /translation="MTSGKGFLKSGHLGTLIASFFYFDISFMIWVLLGVTSTFVVGEF
                     QMTDAQKGLMVGLPVLGGAFLRIPMGLLADRFGGKKIGIIGMLVTMVPLLWGYLFGNG
                     IGEIYALGLLLGVSGASFAVALPLASRWYPPEHQGLAMGIAGAGNSGTVLATLFAPRL
                     AEQVGWHGVFGLALIPLTVALAVFIFLAKDNPNAPKPQGVSAYLQIVKHKETWLYSFF
                     YSLTFGGFVGMTSYLSLFFVDQYQLSKVTAGDFVTLIVFAGSFIRPIGGYLGDRLGGM
                     KMLIGLYLVLSMLLLLAGTLPSSAYVALGVLFLTMLFFGIGNGALFQVIPTEFPKEVG
                     IMTGFVGAAGGVGGFILPNILGNVKGLTGSYSYGFWWLAATFLAAALLVFVLRKSRSK
                     LSSLPEPGLAKNSV"
     gene            390328..393999
                     /gene="narZ"
                     /locus_tag="DSY_RS01865"
                     /old_locus_tag="DSY0334"
     CDS             390328..393999
                     /gene="narZ"
                     /locus_tag="DSY_RS01865"
                     /old_locus_tag="DSY0334"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459023.1"
                     /note="with NarYV catalyzes the reduction of nitrate; the
                     beta subunit is an iron sulfur cluster containing electron
                     transfer subunit; one of 3 nitrate reductases in E. coli;
                     expression of nitrate reductase Z is not dependent on
                     nitrate levels; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_011459023.1"
                     /db_xref="GI:499778289"
                     /translation="MKLWKKMRFFQQATEKYADGWSSSAVKDRDWEDLYRQRWQHDKV
                     VRTTHGVNCTGSCSWKVFVKNGLITWEHQQRDYPGTDPDMPEFEPRGCPRGASYSWYV
                     YSPLRVRFPYIRRILLELWREALELHENPLEAWQSIVEDPEKAGQYKKARGKGGFLRC
                     TWSEVYRLIAAQMLYTIKTYGPDRIAGFTPIPAMSMVSYAAGARFISLVGGPMLSFYD
                     WYADLPPASPQIWGEQTDVPESSDWYNSGYLIMWGSNVPLTRTPDAHFMTEVRYKGTK
                     VVAVSPDYAENVKFADSWMAVKPGSDGALAQAMTHVILKEFYVDKSSPYFVEYAKRFT
                     DLPFLVTLNQWGDCYVTGRFLLASDLGWDIVNPEWQTVVCNEVTGEMTVPNGSIGTRW
                     GDHLKWNLKQEDVYGQSLEPLLSLAEQADERVMVAFPYFDNRSKGVKKRELPVRRIRK
                     GDKEFYVTTVYDLMLAHYGVSRKGLTRGYPQDYDDQESYTPAWQEQITGVPREQVIQI
                     AREFAENAEQTQGRSMIIMGAGANHWFNSDTIYRAILNLVLLTGCQGVNGGGWAHYVG
                     QEKCRPIEGWNAIAFARDWSAPPRLQNATSFYYFATDQWRYEELPMSQLTAATVGKPR
                     YEHPADYNVLAAQLGWLPSYPQFNVNNLQIADMARAAGAVSPQEVADYVVSSLQEKTI
                     RFAAENPDDPRNFPRTLWVWRSNLLSSSGKGHEYFMKHLLGASHGLLAEENISFKPEK
                     MVWQEAAEGKLDLLINLEFRMTGTALHSDILLPAATWYEKHDLSSTDMHPFVHPFNPA
                     IDPPWEAKTDWNIFRGMAEVFSDMAAKYFPGVHQDLVAVPLMHDSVDEIAQPFGRVRE
                     WSKGEVAPVPGKTMPKLVPVERDYGLIHEKYSSLGPLLEKNPVGAHGISFSVADQYHQ
                     LKAINGTVEAGLAAGRPKLETARQAAEAMLTLSSATNGKVAMKAWEAEEGKTGLLLKD
                     IAEERAGERLTFDGITAQPRQVIPTPVFTGSNKGNRRYSPFTTNIERLVAFRTLTGRQ
                     QFYLDHEVILEYGEGLPIFKPTLQLLVLADRDQQPSRKEKEIVLRYLTPHGKWNIHST
                     YQDNIHMLTLFRGGPHIWLNHQDAQEADIGDNDWVELYNRNGVVVARAVLTHRLPRGT
                     TFMYHAQDKHINMPGSTITGERGGTHNSPTRIHIKPTQCIGGYAQLSYGFNYYGPIGN
                     QRDVYVSIRKLNEVNWLEN"
     gene            393989..395440
                     /gene="narH"
                     /locus_tag="DSY_RS01870"
                     /old_locus_tag="DSY0335"
     CDS             393989..395440
                     /gene="narH"
                     /locus_tag="DSY_RS01870"
                     /old_locus_tag="DSY0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810456.1"
                     /note="with NarGJI catalyzes the reduction of nitrate; the
                     beta subunit is an iron sulfur cluster containing electron
                     transfer subunit; one of 3 nitrate reductases in E. coli
                     and in E. coli is expressed when nitrate levels are high;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_005810456.1"
                     /db_xref="GI:492325274"
                     /translation="MKIKAQIAMVINLDKCIGCHTCSVTCKNTWTNRSGAEYMWFNNV
                     ETKPGAGYPDQWEDQQRYKGGWHLRKGQLTLRSGFRWQGLSLSRIFYNPNSPTIDDYY
                     EPWTYDYQKLLKSPVRRHMPTARPQSLLTGEYIEKLRKGPNWDDDLAGGPQAGGRDPN
                     LRDLLGEEVRLEFEKAFMLYLPRLCEHCLNPGCVASCPSGAIYKRDEDGIVLVDQEKC
                     RGWRYCTSGCPYKKVYYNWKTYKAEKCTFCYPRVEEGVATVCSETCPGRLRYMGVLLY
                     DADRVPRAAAQPDEQALYQAQLELFLDPHDPAVIAQARRDGIQEDWLAAAQISPVYKL
                     AVQYGLALPLHPEFRTLPMVWYIPPLSPMVSVLESRTSGSVTTGFFPTLEQMRAPVQY
                     LANFLTGGNPQPVERALRRLLGMRHFMRSLETGQENQEQLLETIGLSEQTVRHMYRLL
                     AVAKYEDRIVIPLAHREESRKAHQEQGKVGYAL"
     gene            395454..395987
                     /locus_tag="DSY_RS01875"
                     /old_locus_tag="DSY0336"
     CDS             395454..395987
                     /locus_tag="DSY_RS01875"
                     /old_locus_tag="DSY0336"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_011459024.1"
                     /db_xref="GI:499778290"
                     /translation="MNKKDVFCLLAYLLQYPQADWIDPEELRREAENWEEGDTRSRLN
                     LFVDYLQSAPLNVLQENFVETFDFSKKTTLYLLYPQYGEEPKRVEVLQELIQEYQKAG
                     LLIGQELPDYLPLVLEALSNVAIDRGRIILKPVYAGLQYLHDQLVKMNSPYALLLEVC
                     LSSIHSLFGEIGGVTAT"
     gene            395984..396700
                     /locus_tag="DSY_RS01880"
                     /old_locus_tag="DSY0337"
     CDS             395984..396700
                     /locus_tag="DSY_RS01880"
                     /old_locus_tag="DSY0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit gamma"
                     /protein_id="WP_005810453.1"
                     /db_xref="GI:492325271"
                     /translation="MMNQLLWVIFPYTMLTAFVVGHIYRYRSGQIGWTSRSSQLLEKK
                     ALKWGSTLFHFGVLAALCGHVGMLVPKEVMEAIGINEHMYHMAASWGGSTAGVITLIG
                     TIILLLRRLCVKRIRRNSSMGDLFVIVLIAGIVFTGLWNSLVINSFGAGHDYRETVGP
                     WLRGLITLQPRAELMGGVPLFFKLHILMAFAALGLWPFTRLVHVWSFPLTYLKRSRIL
                     YRKWNKAGGTEQERQNTPAA"
     gene            396797..397255
                     /locus_tag="DSY_RS01885"
                     /old_locus_tag="DSY0338"
     CDS             396797..397255
                     /locus_tag="DSY_RS01885"
                     /old_locus_tag="DSY0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_005810452.1"
                     /db_xref="GI:492325270"
                     /translation="MGKQEQEIKIFLEKVRADIGSDFVGLACHDFDSHHIRWQYVAGN
                     LNNLYRKITLWPGRGIAGKVVASGRPMALEDFALKSGDDAREYPILLAEDLRSVMAAP
                     IIECDHVKGVLLIGFRTPHRFTEETLAQLVFFAGQCRELLAEPELNLPEV"
     gene            397299..398330
                     /locus_tag="DSY_RS01890"
                     /old_locus_tag="DSY0339"
     CDS             397299..398330
                     /locus_tag="DSY_RS01890"
                     /old_locus_tag="DSY0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_018306045.1"
                     /db_xref="GI:517117227"
                     /translation="MYWKCQKEAGSNELLNQITEQIPNPVLVSNEAGWVIGANGAVMR
                     LTGWSFQELTTGRMTVFRHNSPIDDWYNLGGDEGHGLEVCLEKQDGMRLKLPIESVFT
                     YRPPGQAVVAILREFSPQQEEYVQNLLTKYIIRAQEDERKRVSRELHDELGQNIYSVL
                     VGLQVLEKAMPEAVQIQNLQQMVARSLAMLKNIAVELRPSTLDDLGLAAAIRSFLKHF
                     EQTYGIEGQLTVSGEQHRYEPEIETALYRICQEAMLNVAKYAKVTEVQVFLQNYPDQL
                     NLIVEDQGVGFDVGQLEIQGTGLGLYGMKERAQLVGGKVEIVSQVNLGTRVQATIPLT
                     EKGGIWHAH"
     gene            398320..398970
                     /locus_tag="DSY_RS01895"
                     /old_locus_tag="DSY0340"
     CDS             398320..398970
                     /locus_tag="DSY_RS01895"
                     /old_locus_tag="DSY0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_005810448.1"
                     /db_xref="GI:492325266"
                     /translation="MPIRILIGDDHAIVRSGLTMLINSHDDMEVVGTAADGRETFELA
                     MKLKPDVILLDLSMPPGENGLSATLRIKDAAPEIQILILTMHDDEEYIFKILQAGASG
                     YILKSAYDNDLINAIRTIYHGNAYLGPSITKTLIHEFAQRSLHGNESGTDLTVREQNF
                     LSLMAMGYSNKEIAEELSVSVKTVESYRSKIKDKLNLKTRHELVRYALKKGLMDLE"
     gene            399249..399674
                     /locus_tag="DSY_RS01900"
                     /old_locus_tag="DSY0341"
     CDS             399249..399674
                     /locus_tag="DSY_RS01900"
                     /old_locus_tag="DSY0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_005810446.1"
                     /db_xref="GI:492325264"
                     /translation="MRAIILNSDSIKPIYIQIAEWLEAEILKGNLTEDERIYSQYQLA
                     EIFTINPATAAKGLNLLADEEIVYKKRGLGMFVSPHAKSYILQKRKNQILGQMIRDLV
                     DEAVRLGVRKTELLEMIELAHQEADDRDREAGGEEEEKQ"
     gene            399671..400585
                     /locus_tag="DSY_RS01905"
                     /old_locus_tag="DSY0342"
     CDS             399671..400585
                     /locus_tag="DSY_RS01905"
                     /old_locus_tag="DSY0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011459027.1"
                     /db_xref="GI:499778293"
                     /translation="MSVVVGYELYKRYGKVQALGDVSFAIEENTITGLIGRNGTGKTT
                     LLKMMAGHLKPTQGKLRVFAQNPFDNLDVAGKVFLVDDTMAFPDSFTLQDILREVAVF
                     YPNWNSQIAQGLLEYFLLNPQQRHSNLSKGSKSTFNAILGIAARCPLTLLDEPTTGMD
                     SAVRKDFYRVLLKDYLEQPRTIILSSHLLGELEDILEDILLLNQGGLLMHKPILDLKQ
                     YALGFRGSAQALQESLLNRLSEEAVLHREEFVKGSLYLVIKTEELPEDFENIRSSGVE
                     ILPVALDDLCNILTAPRKGGIDDVYKRG"
     gene            400563..401327
                     /locus_tag="DSY_RS01910"
                     /old_locus_tag="DSY0343"
     CDS             400563..401327
                     /locus_tag="DSY_RS01910"
                     /old_locus_tag="DSY0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272200.1"
                     /db_xref="GI:752602813"
                     /translation="MMSINEVKTGTSTLSQMILKQYGYKLKGHSGLIYSLIIVQLLAI
                     LLSLGSSSGMSSNSDLISIAVRTYTGDILLICSLLWLMVVASLLGSQPYRSMEFSVVN
                     NRLVSHASNILLLVTYAVYAGVTSTLAVIIHRLILSATLKEGEFLFGGLQIIPQDLLL
                     GIFVATLYFILVAATVYLIQSFSLHSKGLGIILWICFFAFGFGTVRIFDFNLGKVLEF
                     YAAETSLGVFVLKVFCTAVLFFGSSMLITKGMEAKR"
     gene            401324..402082
                     /locus_tag="DSY_RS01915"
                     /old_locus_tag="DSY0344"
     CDS             401324..402082
                     /locus_tag="DSY_RS01915"
                     /old_locus_tag="DSY0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810440.1"
                     /db_xref="GI:492325258"
                     /translation="MTKLLFTNIIFLFLIIGLIYLLAKFVRPRLRRVYRWKTNLLIAG
                     AYLALLVVSIPLALFLDQGEFFQSRNAQAQGMLAEAPADWSEDGGRRYHIFENEPLER
                     QAGLVENSRQTYAADTPQLRIQTAGSTGYGRIFLERKKNADGLIEVSTYVAPHYARTD
                     TFKPIDFTKLVAPPQITWEAGVLKIGDPVKQSFEFKMYSDSFPVWQFKEEKQSNYIGG
                     GSMTFGEKGILVRIPPDMEVVDGDSGEFTWVSNQ"
     gene            complement(402145..402387)
                     /locus_tag="DSY_RS01920"
                     /old_locus_tag="DSY0345"
     CDS             complement(402145..402387)
                     /locus_tag="DSY_RS01920"
                     /old_locus_tag="DSY0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810437.1"
                     /db_xref="GI:492325255"
                     /translation="MKKDATRIKLSKEQKEEMASAIQRYFLQERDEEIGALASSLMLD
                     FIIKELAPEFYNQGVSDSYQFMNERTEDLFSLQIYR"
     gene            complement(402384..403292)
                     /locus_tag="DSY_RS01925"
                     /old_locus_tag="DSY0346"
     CDS             complement(402384..403292)
                     /locus_tag="DSY_RS01925"
                     /old_locus_tag="DSY0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459029.1"
                     /db_xref="GI:499778295"
                     /translation="MPKSVLLSDGLADKYAGLLKCPICHNSMALINKKSLICRDKHCF
                     DLAKQGYVNLLSHGIKTKYNKQLFEARKLLAQSGFFEPLNQLLCTLIGNLMNNSEGKA
                     QGPSLNIVDAGCGEGSHLATIQQKLLQSRGIQPLGVGMDLAKEGIQMAARDYGSILWC
                     VADLAQCPFGDQQFNVLLNILSPANYSEFARILTDDGLIIKVVPEKDYLKELREILYK
                     ETAKQDYSNAKTRELFENHLQLCKLVPLRYSVTLDQPLIGNLVQMTPLTWGAEETRIA
                     KVLKLESLEITIDLTIMVGQKREERS"
     gene            403428..403721
                     /locus_tag="DSY_RS01930"
                     /old_locus_tag="DSY0347"
     CDS             403428..403721
                     /locus_tag="DSY_RS01930"
                     /old_locus_tag="DSY0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942658.1"
                     /db_xref="GI:506422939"
                     /translation="MRKSMVFSGLALVLMLFILTGCIPGDGSYDFDKPAGFLSGVWHG
                     WIAPLSLIMGIFSETVRVYEVFNTGWWYDFGFYIAVISGFGGLSLSRKKKKDK"
     gene            404366..405457
                     /locus_tag="DSY_RS01935"
                     /old_locus_tag="DSY0349"
     CDS             404366..405457
                     /locus_tag="DSY_RS01935"
                     /old_locus_tag="DSY0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_005810429.1"
                     /db_xref="GI:492325247"
                     /translation="MKSKILLLMAMLIGSVYLTGCGRIAEPEQGTVMEEREQQNPEQR
                     DVLVWEWQYGAPEDHGLNGDTLESLHATYDTTQILASVIFKDGHIVDEYYKDGYDKAS
                     LFLLHSCSKSVTSALIGIAIDKGYIESVDVPIAEYFPQILESDDNRLKQITLGHLLTN
                     TSGFDSSDTEYWREWRNSENWVDFVLNRPLTSTPGTVFSYSTGNTHLLAAILQKATGK
                     TAYEFGKEFLFDLIGMDSVQCNMDSQGISDGGNGFSMTVYDMVKFGLLYYHGGLWGEQ
                     QIISREWVEESTRLQFKRSSGTADYGYQWWVRTFGEEQYDTFFAQGHGGQYIFVIPEL
                     ELIIAFTSNHTGSSDMYWQFVNDIVAASD"
     gene            405677..407308
                     /locus_tag="DSY_RS01940"
                     /old_locus_tag="DSY0350"
     CDS             405677..407308
                     /locus_tag="DSY_RS01940"
                     /old_locus_tag="DSY0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011459032.1"
                     /db_xref="GI:499778298"
                     /translation="MELKGWGCRVTIRSTLRAIVVLLLLFSVTSTVVVFYQLEKMQQD
                     GAVINTAGVVRGATQRLIKLEMAKQPNDELIQKLDGIIEGLIQGDESLGLPKASDEVF
                     IQEMNKVKSEWQSLKGTIESAQRSGDMTALVQESESYFATTNAAVAAAEGFSAAKVKA
                     LKVIQSVLMVFNLILLIAIWFMSSNRISQPIQKLIGIVEHLNVSENIPEHFMNRKDEV
                     GGLSRAFQGVIHNIRDLVAGLALSSEKLADSAAFLGNISQESSTAAMEIAKTIEGIAL
                     GASDQANEIQNGVAQMDVLGHLVAEDQKKVEDLRQATDRVEQLKDEGTMILADLIKIT
                     DQNGKSAQEVQETILETNESAKNIVEASLKIKEIAAQTNLLALNAAIEAARAGEQGRG
                     FAVVAEEIRKLAEESNRFTTEIENITKVLTLKTREAVVKMGEMDSVVKIQSESVSATE
                     TKFAGIAEAIDRIQGYTEIISNSTDGIADKNQSIMNMIQSLSAISEESAASTQEVSAS
                     VQEQTAAMDQIAGASQELAALAEELESSMQQFTQR"
     gene            407438..408439
                     /locus_tag="DSY_RS01945"
                     /old_locus_tag="DSY0351"
     CDS             407438..408439
                     /locus_tag="DSY_RS01945"
                     /old_locus_tag="DSY0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl xylan esterase"
                     /protein_id="WP_011459033.1"
                     /db_xref="GI:499778299"
                     /translation="MTIIQDAIQQLETIPYRGVPPEDFKEFWLESLRRDAQTKARLEL
                     EAIAYPLSKVEVFSATVLSGDRTKLKGYYMRPRAIDLQEALPGLVRFHGYSGNRGQLS
                     ELLLWALQGYAVLALDVRGQCGETPDTRVYPSGAFSGWLTLGLESPHTHYLRQVYLDG
                     VRAVEALANQPEVDEKRIGCMGKSQGGGLAVIAGGVINALGQEVNLKGGVKAVSAAMP
                     FLADFRSSYQLQKGGPLEELAWYFQLHDPEHQREEGIFTTLDYFDGVHFAPWLGKKTA
                     CLVSMGLKDTVCPPATVYWLYKGICGEKKLLIYPEYEHESPDGFVDRQIEFFAKELL"
     gene            408677..408949
                     /locus_tag="DSY_RS01950"
                     /old_locus_tag="DSY0352"
     CDS             408677..408949
                     /locus_tag="DSY_RS01950"
                     /old_locus_tag="DSY0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942661.1"
                     /db_xref="GI:506422942"
                     /translation="MEYQNAKNILPEKLIDEIQKYIQGQTLYIPRKTSHKTGWGEMNG
                     TKAALRERNQSIMRLYRVGSRIEDIAAQYYLSPDSVRKIVSTQNMD"
     gene            409012..410769
                     /locus_tag="DSY_RS01955"
                     /old_locus_tag="DSY0353"
     CDS             409012..410769
                     /locus_tag="DSY_RS01955"
                     /old_locus_tag="DSY0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011459034.1"
                     /db_xref="GI:499778300"
                     /translation="MVSVFFNESFFLLVFYSASFNVKIDRGVLLKVKKLKYQLIIPTV
                     IIVFILMSINIVLVFQIQQKQAVNELKEKGLALTQQLDSTWEFLSINQHRINTSAKGD
                     FDFKGLNCSTAGMSIGVIFAEKNGYKIRYVNTNPRNPLNEPDPFEKRVLEKFANDTAI
                     DSYWELVKEEGQRYFCYVTPMRIDETCLECHGEPAGEMDISGYAKEGMKIGDLAGAIS
                     ITMPTTIQDQALVFNMFWQCMTFTLLIIGCVLAIYYFVTKRVTKPIEHLETAVKQVGE
                     GDLNVDLQNFRAAEEIEGLADHFNNMAKQLKELYSDLEHKVELRTSELGKANEQLQIK
                     QIQLEKVNTLLKEDSQYKADFLAMVSHELRTPLTAIIIFAEILLKKKRFEDSSEEQIL
                     CEIKENSEVLLHMINNILDLARLETGRNSLSIETVDLVDVINNVECVIRPLAQRNDIH
                     LTARVERGVPLIQGDYEKVRRIIENLAGNAIKFTPLGGKVNIQASLAEDPHYVKITVQ
                     DDGIGISKENQAHIFEKFIQVDSSSSRQYNGSGLGLALAKELTELHGGVISVESDLNK
                     GSTFIVLLPIERPQRGDAE"
     gene            410766..411455
                     /locus_tag="DSY_RS01960"
                     /old_locus_tag="DSY0354"
     CDS             410766..411455
                     /locus_tag="DSY_RS01960"
                     /old_locus_tag="DSY0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_005810422.1"
                     /db_xref="GI:492325240"
                     /translation="MKIMLVDDERSIQKAVEYIVRENGYQFCYVDNGLEALEVFAGEA
                     PDLLILDVMLPGLDGFAVCEKIRSFSDVPIIFLSAKGDIVDKGIGFKMGGDDYLVKPF
                     SSMELDFRIKALLRRPHRLEDEPNNSDEVLKIGDLELRLNEYEVYSGGEKVELTAKEF
                     EVLAFLAKNRGQVFTREQLLDRIWGLDFEGDTNTVTVFIRRIREKIEADPAKPQYILT
                     VWGVGYKFKSK"
     gene            complement(411577..412374)
                     /locus_tag="DSY_RS01965"
                     /old_locus_tag="DSY0355"
     CDS             complement(411577..412374)
                     /locus_tag="DSY_RS01965"
                     /old_locus_tag="DSY0355"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit C"
                     /protein_id="WP_011459035.1"
                     /db_xref="GI:499778301"
                     /translation="MHSWPLYLFTLAIQSAVGGCIMLMLYNILLKKVLAKDTLQKANL
                     KSLTALTVLSVLGLGFSFFDIGYPLNAVNAITNLGASWLSREILFTVLFIALVSVALA
                     ANWKTQHLSQALLAAAGIAGLAVIFAMGSLYSHTIFEPWNSFNTLIGFYGSTIILGAV
                     LINLIFFPVFKNTRGSFEAIKLPTLLAVLAAFIIQFAFIAALGSSLAILNPAMSLVRW
                     FCSALAALLLVYLYFKDPKKSELLYISFGLLLVGELIGRYLFYLPLS"
     gene            complement(412400..412969)
                     /locus_tag="DSY_RS01970"
                     /old_locus_tag="DSY0356"
     CDS             complement(412400..412969)
                     /locus_tag="DSY_RS01970"
                     /old_locus_tag="DSY0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_005810417.1"
                     /db_xref="GI:492325235"
                     /translation="MSVQYGFYINQSRCSGCHACQTSCNDKNDLEPGRLFRRIKETDG
                     GEFTPFNQGYAHNAYAFFTSISCNHCEHPKCTEACPSGAMHKDPETGIVSVNQNRCIG
                     CRYCTWACPYGAPQYNKEAGRMSKCDFCADLLSQGETPVCVAACPYEALDYGPIEELR
                     AKYGTLADSPDLPSSDETHPNIVLKPHKR"
     gene            complement(412997..415342)
                     /locus_tag="DSY_RS01975"
                     /old_locus_tag="DSY0357"
     CDS             complement(412997..415342)
                     /locus_tag="DSY_RS01975"
                     /old_locus_tag="DSY0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit A"
                     /protein_id="WP_005810415.1"
                     /db_xref="GI:492325233"
                     /translation="MNLSRRSFLKWSATLGAMGTGLMSLTACSQNASLTGSEAASAGE
                     QIIPTASTQDCGGRCLIKAHVKDGVITRISTRGAYEEDEPGANMKACLRGRSYRKHLY
                     HPDRLKYPMKRVGKRGEGKFEQISWEEAIDTIAKETRRIFDQYGPESRYCNVGTGDTG
                     GVIYRMGLGGRFLSATGGHLPLYNSVSMGNTGTATPYVYGVAATASSLDSLKDTKLVI
                     LWGHNTTETIFGASNYYFRQMKNRGCKFICVDPRNSNTAVAFADEWIPLLPTTDNALM
                     DAMAYVIVSENLHDQAFLDQYVQGFDEEHMPEGVPAHESLVSYLFGKKDGVEKTPEWA
                     EAICKVPAETIRRIAREYATTKPAALIQGWGPQRHSCGERTALGATMLASITGNVGVL
                     GGWAGGYIGLSRKGCVGLPDVPNPYPGAIPTLSWVDAIECPEKVTPAEGLLGVDKLNS
                     PIKMLLNLAGDFIANQNPDINRTIRVLEDESLVEFIVVSDLFMTPSARYADILLPGNT
                     FFERYNIGATWNNGDYFILSQKIVDNYYESRSEYDWLAEVADKLGAKDVFTGGKTEEE
                     WVRWIVDETRAKYPETLSWEELEKVGISKFHYDGPRVAFQDQIEDPVNNPFPTPSGKI
                     ELFSKTLYDMHNPEIPAIPVYVPAWEGPEDELTEKYPLQLIGWKTKARDNSTFYNNPW
                     LQQAMVQEVWINPMDAKPRNIVTGDRVKVFNDRGTTMLQARVTSRVIPGVIAAPTGSW
                     FTPDGKGGCTNGNLNVLTTLRKTALSHGNTQHTSLVEISKL"
     gene            complement(415345..415980)
                     /locus_tag="DSY_RS01980"
                     /old_locus_tag="DSY0358"
     CDS             complement(415345..415980)
                     /locus_tag="DSY_RS01980"
                     /old_locus_tag="DSY0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_011459038.1"
                     /db_xref="GI:499778304"
                     /translation="MGVHEGRLYVYQLLKHLFEQPLNREGLIELQEQPGLKELAQISS
                     GAQSINDFLVTNKDEYPETLCQALQAEYQRLFVGPGQVLVPIWESVYFDPEHLMFGER
                     TLAVREFYRKYHLESIHKNRQPEDHLAVELEFMTYLIGQYLASEDDVQQTKLLRDQKE
                     FIQKHLATWKDEFLQFLEKSTGCLLYRGGGQLLKEFLDMECETFEHLEEVS"
     gene            416681..419035
                     /locus_tag="DSY_RS01985"
                     /old_locus_tag="DSY0359"
     CDS             416681..419035
                     /locus_tag="DSY_RS01985"
                     /old_locus_tag="DSY0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoB"
                     /protein_id="WP_005810412.1"
                     /db_xref="GI:492325230"
                     /translation="MKLNELEISRSASIVSVGGKGALRQHFLDMGVIPSAIVTMVKLA
                     PLGDPMEVRIHGYELTLRLADAEKIEILPVDDVEQLAEKSKKREFVKHPGLGETGIFH
                     TKADGDPLPDSQLLTFALAGNQNCGKTTLFNQLTGSNQRVGNFPGVTVDRKDGVIKGH
                     ANTLVTDLPGIYSMSPYSNEELVTRQFLLQDKPKGIINIVDATNIERNLYLTIQLMEL
                     NIPMVLALNMMDEVRENGGSIHINEMENRLGIPVVPIAASKNEGIQELVDHAIHVAKN
                     QERPGRMDFCDPDHDNGAVHRCLHAIIHLIEDHAKRAQIPLRFAASKVAEGDEEILKA
                     LNLNQNELELLGHIIQQMEDERGLDHGAAIADMRFKFIKEICDATVVKPKESKEYARS
                     VAIDNVLTGKYTAIPAFVGIMSLVFWLTFGVIGTWLADGLDLGITWLSELVDLGLTAY
                     GINPVVHSLIIDGIFAGVGSVLSFLPIIVTLFFFLSILEDSGYMARVAFVMDKLLRKI
                     GLSGRSIVPMLIGFGCSVPGVMASRTLPSERDRKMTILLTPFMSCSAKLPIYALFTAA
                     FFPRYGALVMIGLYFTGIVTGVVFALLLKGTMFKGEPVPFVMELPNYRMPGFKNVWQL
                     LWDKAKDFITRAFTVIFVATIIIWFLQYFDPRLNAVSDSQDSLLALVSGIIAPIFVPL
                     GFGDWRISTALITGFMAKESVVSTLTVLLGGSTASLSTMFTPFSAIVFLVFTLLYTPC
                     VAAIASVRRELGGKWAVGVAVMQCVIAWVVALFVNLLGIMMGWV"
     gene            complement(419261..419722)
                     /locus_tag="DSY_RS01990"
                     /old_locus_tag="DSY0360"
     CDS             complement(419261..419722)
                     /locus_tag="DSY_RS01990"
                     /old_locus_tag="DSY0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810409.1"
                     /db_xref="GI:492325227"
                     /translation="MNKKKGLLWVALLLILLAFTGCTGSDDQYAPDKAAIETLVNDYF
                     TAAFNIDYTTWTGENELPFLTPDQAKIMQGRFADFKQSFVDNQLTQAVDSVEIIRVNI
                     ETETSGNVYCIIKVSGYDNGSAYRETIEYSMPVKKIEGQWLIDDFKIQSIE"
     gene            419928..420851
                     /locus_tag="DSY_RS01995"
                     /old_locus_tag="DSY0361"
     CDS             419928..420851
                     /locus_tag="DSY_RS01995"
                     /old_locus_tag="DSY0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_005810408.1"
                     /db_xref="GI:492325226"
                     /translation="MNITIVGAGATGGYFGARLAASGLNVTFLVREKRAAQLREKGLV
                     IKSVVEDLTLATPQIAINAEDIPACDLVLLGLKNYQLAASLPQLKVLVNRGAKILPFL
                     NGVEHFEILAKELGQENVLGGVCKIISTLDSEGTIHHTSKVHQIIFGELEPSGKEFCL
                     GLEQAMAKANFKVKYTENILNEIWSKYAFIAVFSGVTSAGDLTTDQICAHEATVKVYR
                     RSLEEMKSLADAYGVALSEDFVEQNVEGLPKYAKGSTSSMHQDMRKGLLLEVESLQGA
                     AIRLAGRKNMELPTIETLYGLIKPYEMGSVE"
     misc_binding    420973..421107
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            421247..422083
                     /locus_tag="DSY_RS02000"
                     /old_locus_tag="DSY0362"
     CDS             421247..422083
                     /locus_tag="DSY_RS02000"
                     /old_locus_tag="DSY0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase subunit nifH"
                     /protein_id="WP_011459041.1"
                     /db_xref="GI:499778307"
                     /translation="MCRRIALYGKGGIGKSTIASNLAAALAGSGLNVLLIGCDPKADS
                     TRNLTREGIPSVLETLARSEEVSIQNLLHTGDFGVSCVESGGPEAGIGCAGLGISTTL
                     EELTRLGVYDMDWDIILYDVLGDVVCGGFSVPMRKKHVDTVYIVTSADFMSLYAANNI
                     LKSVKRYSYTEKPLLGGILHNRADSAKERAVVQEFCRKTNSAYIAAMGQSTEIRLAEL
                     QRQTVLKAYSDGAAAQAFLELGRRMAGPGQASVPTPLCPQDMDAVGAAILRLLQDEEA
                     GE"
     gene            422080..423744
                     /locus_tag="DSY_RS02005"
                     /old_locus_tag="DSY0363"
     CDS             422080..423744
                     /locus_tag="DSY_RS02005"
                     /old_locus_tag="DSY0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810405.1"
                     /db_xref="GI:492325223"
                     /translation="MKTPLALCACTQETEEDTASSALFKRSDIAVVAVGPASCLRHLY
                     FLATRLQALQQLHLCCLTTREYALGNFRTKVRESLGRVLGKQAVRGVLVYGTCADILM
                     QVDFEELLAGIENPGDIPIKIFCRGPLAKRKMPAGKRLQMLYGELEEELSMASGQIYR
                     HGEKEFFLPPLAGDFAGVVSMLHAWQWELILYTPGGCRTGLQMDEPMGGPPCFYYTSY
                     NDIHAVLGSERKLVELMRESPRDQERIGRALIGTPVPHITGCDFEWVEQELANPEYPL
                     VCFPCNGFDTYAAGMSRALLTLGQTLFDSRKRESRQILLVGCSAMEPVSRGSLQRAVD
                     KVGEWGFSVSFLGDGDLESIRQAAAGSLCWCVSPAGEALAGWLEETFGTPWFTHLPIG
                     RSGMHRLWQLISERGEAPDGIMKGERAAAGGAAGAVVDVGDVPRILIISEPLTGLGIQ
                     QCLAEDFSYTGSTVAVHGLGGQSIVHFQNPEELQGLVCSADILIADPLYERLARSWGA
                     QPLFIAVPYPALSGNLYARSPIDLIGEAGYQYFASKLGKVRREKKQ"
     gene            423741..424847
                     /locus_tag="DSY_RS02010"
                     /old_locus_tag="DSY0364"
     CDS             423741..424847
                     /locus_tag="DSY_RS02010"
                     /old_locus_tag="DSY0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005810403.1"
                     /db_xref="GI:492325221"
                     /translation="MKRFCNGLLASALVLSLLLTGCGAAGGQQPAQASGPEQPAVRTV
                     TDAEGNVVEVPQDISRIAVTPLPWSSVVSAIDGGSQRLASINPGALKAYSGSFFAKLD
                     KNYATLDDTSIGSDFSINVEELLNRQVQVVIIWEYQTAEAAKLKDVGIVPVMVKNGNV
                     QELQDSFKAVGQLLGKEERAKWVNDEYAKAYEKMKSYGEQVKKADKPRVLYLKRSDLT
                     LQGNDNFIKESMELAGADNIAAEAKSITMEEILKLDPEIILLSDFDKFLPQDLYENRI
                     EGQDWSSVSAVVNKRVYKTPVGIYRWDAPGVETPLMMFWLGKMLQPEIFSEVDLKAEM
                     KAFYQDVFDYSLTDEDFGQIFNDKANAASERRIS"
     gene            424859..425893
                     /locus_tag="DSY_RS02015"
                     /old_locus_tag="DSY0365"
     CDS             424859..425893
                     /locus_tag="DSY_RS02015"
                     /old_locus_tag="DSY0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_005810402.1"
                     /db_xref="GI:492325220"
                     /translation="MHTNRKEGRAGAFPGLLILLFALLVILLLIAVGIGRYPLHPFTV
                     LQVLLAKWVAMEPTWPQQAEGVVFTLRLPRALAAILVGSALSLSGACYQGVFKNPLVA
                     PDVLGVSSGACIGASLGILLGWNASGIQLLAFTGGITAVALTTSIPKITRNQSMMMLV
                     LSGIIVGGLMSSIMGFIKYIADPETQLASITYWQMGSLAKVVSPDLVTVALPILTATG
                     ILLLLRWRINVLSLGDREAQSLGIPVIRSRRIVILCATVLTASAVCISGTIGWVGLVI
                     PHFGRMLVGPDNRKLLPVSCLLGGIFLLVIDTCARMMTSAELPLTILTGIVGAPFYFY
                     LLIKQRMKLS"
     gene            425890..426663
                     /locus_tag="DSY_RS02020"
                     /old_locus_tag="DSY0366"
     CDS             425890..426663
                     /locus_tag="DSY_RS02020"
                     /old_locus_tag="DSY0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_005810400.1"
                     /db_xref="GI:492325218"
                     /translation="MILEVRDLCFAYGKGSRLLKNVCFTLKKGEIFSILGPNGAGKST
                     LLNCMMNLLTPESGSIQVHGQPLAAMDVREIAKTIGYVPQTHSLVYDYSVRDFVVMGR
                     TPYLAAFQQPGAQDYAMVDAALAQLGIARLSERPYTALSGGERQQVTIARTLVQRPQI
                     IILDEPTSYLDYGNQIRVLQLIKSLAADGYSIIMTTHMPDHALRLGGKVGILDRGGQF
                     SVGKTEEMLTTERLSDLYASDIRIVYVEELGRSICAAAQ"
     gene            complement(426673..427626)
                     /locus_tag="DSY_RS02025"
                     /old_locus_tag="DSY0367"
     CDS             complement(426673..427626)
                     /locus_tag="DSY_RS02025"
                     /old_locus_tag="DSY0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011459042.1"
                     /db_xref="GI:499778308"
                     /translation="MTLQVLRYVIEVAACASISEAAKALFISQSTLSTAIKQLEEELG
                     IILFRRNNRGIALSPEGEDFLQFARQIVEQANYLENRYQQKKSSDMLFSVSTQRLPFS
                     VRAFVKLMETIGLEPFDIAIRECPTYEVIHDVEAGRSEIGVLAVQHRYLEIFRKLLHS
                     GGISQHKIHTLSPYVFVRKSHPLAQKNSLSIEELKEYPFITFDQGKNSGSHFTEEIVF
                     YSQLDKIVHVSDRCTKIALVRATDAFSIGPDLVNSNGDKMHAGQQEVCAIPLASQSEQ
                     LDILWIEKTSRPLTTTAELYVRLLADQVQHYFAAMPDKPDR"
     gene            427875..429146
                     /locus_tag="DSY_RS02030"
                     /old_locus_tag="DSY0368"
     CDS             427875..429146
                     /locus_tag="DSY_RS02030"
                     /old_locus_tag="DSY0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine proteinase inhibitor"
                     /protein_id="WP_005810397.1"
                     /db_xref="GI:492325215"
                     /translation="MKQKYRLMITWALVAVMLGMTLTGCSGNAKVAAGDLMKGITKNP
                     VQLPQEMGGELNQALLDFTWKLFRESGADNGNVMISAPSVYLALGMALNGADGETREA
                     MLKALSAQNIKLEDFNAGLSAWSNSLMDEKNKTDVRIANSIWIRNGFEAAPAFLQTNG
                     DYYQAGIRSLDFADPSAPKIINQWVEEKTEGTIDKIIETMDDNLMMYLINAIYFKGDW
                     QEPFKAGRTYAGTFSAPAGSVETPFMRRSGNMDYIQGQGATGVILPYTDERFAFVGIL
                     PEEGKSPRDFINTTTATDMLKLISSKKIKNVDLSLPKFESSYENELQDELNALGMAIA
                     FDPSRADFSLMNKAHNKDLFIGGVKHKTYIKVDEKGTEAAAVTGVEVNTTSMPIDLTQ
                     VVFDRPFVYAIIDWQTNSPLFVGIMEDPTLR"
     gene            429353..430015
                     /locus_tag="DSY_RS02035"
                     /old_locus_tag="DSY0369"
     CDS             429353..430015
                     /locus_tag="DSY_RS02035"
                     /old_locus_tag="DSY0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_005810396.1"
                     /db_xref="GI:492325214"
                     /translation="MSAITKSLPFHLQIYEILKGKILNGEISRGERLYENKISQELGV
                     SRSPVREALRMLEQDELVVVTSTGLIVNPMEFSDMEEIYQCRMALEPFAAKISADKLT
                     NEDLAALRNLVIQARVYHNQKAYEKVVESNTQFHDIIIQSSGNSRLIGIIEKIRSLII
                     LSRKTEFECYQREEGYLDEHEGVLEALTQRNGDEAERLLRIHIMNDFEFYSLAYEKVL
                     KK"
     gene            430077..430298
                     /locus_tag="DSY_RS02040"
                     /old_locus_tag="DSY0370"
     CDS             430077..430298
                     /locus_tag="DSY_RS02040"
                     /old_locus_tag="DSY0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810395.1"
                     /db_xref="GI:492325213"
                     /translation="MKTLIKNGTIITASEEQQQASDYTPYEGLRMKGGVAKVLLRGEV
                     IVDAGKYVGKPGDGKFIARQTLRSQNGKV"
     gene            430638..431966
                     /locus_tag="DSY_RS02045"
                     /old_locus_tag="DSY0371"
     CDS             430638..431966
                     /locus_tag="DSY_RS02045"
                     /old_locus_tag="DSY0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_005810393.1"
                     /db_xref="GI:492325211"
                     /translation="MSNASKQDHGPQNTLVGNVKRTNVRWYVFIAMLVLVTINYVDRA
                     VLSIAMPAIQKDLNLDPAIVGIILSSFFWGYALMQIPSGFLLDRVNPSKVVLGSAVGW
                     GIAQTLTGFVNSAGSLMFFRVLLGVTEAPIMPAGAKLQGIWLPSKERARGATIIDSGA
                     PLGTAVGGPIIIAFMAWFGGWRGALIGAGLMTIILGVICYYILKGNPATHKGVNQAER
                     EYIQTHLAQEQEEAQKETKTELKTSTYLSNKSFWGMCLGWFSFNTVFYGLLTWGPSFL
                     AQTQGIDIKAIGFSTLLIFGCGFVGELVGGQLVDKWRQVGGKYNTVMKTCIGIAGLAT
                     SASIFLLTRASSLTMAIALLSTALFFLRWAGIFWSVPAAIAQRHHVGVLGGCMNFAGN
                     IAGVITPIYIGLIVKFTGSFHAGLLIFVAAGVLLAVAGALINYEKKIGVV"
     gene            432026..432772
                     /locus_tag="DSY_RS02050"
                     /old_locus_tag="DSY0372"
     CDS             432026..432772
                     /locus_tag="DSY_RS02050"
                     /old_locus_tag="DSY0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="WP_005810391.1"
                     /db_xref="GI:492325209"
                     /translation="MRILVINPNISEIVTNLIAQESRRVASPGTELLFATAPFGVEYI
                     ETRMEALIGGYAAACVAAERQGEYDGVIIDAFGDPGLLGIKEMLNVPVVGMTEAALAS
                     ACLLGQRFSIIAISSRIKAWYLETVERSHLTTRLASIRSLNDTLRSIGTVQEDHAKRL
                     KELAMEAVEKDGADVIILAGAPLAGLARSLEGQLPVPVVDGVSSAVRHCESLIALNPG
                     CAVKGSFAQPPLKPNKGLPAALAALLDRTR"
     gene            433011..433808
                     /locus_tag="DSY_RS02055"
                     /old_locus_tag="DSY0373"
     CDS             433011..433808
                     /locus_tag="DSY_RS02055"
                     /old_locus_tag="DSY0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810389.1"
                     /db_xref="GI:492325207"
                     /translation="MERYVRFNNGNKICFGLVKGDRVAELSGEEPADFKESGIEHELS
                     ALKLLAPCHPTKAVCVGLNYKDTVLEPGAQWPKEPLLFIKPSTSVANPGDDIIKWAMA
                     EELAFEAELAVVIGKKAHLVSEAEARDYIWGYTIANDVTAKDLQKADILWTRAKSFDT
                     FLPLGPWIVSGINADNLMITSSVNGQEKQKGTTADLIFGIEYLVSFISHITTLLPGDI
                     ILTGTPGGYGSSLDVNDKVEIEISEIGKLVNTCKVSSESWSLAPRHK"
     gene            complement(433923..434675)
                     /locus_tag="DSY_RS02060"
                     /old_locus_tag="DSY0374"
     CDS             complement(433923..434675)
                     /locus_tag="DSY_RS02060"
                     /old_locus_tag="DSY0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_035213758.1"
                     /db_xref="GI:737229425"
                     /translation="MQKTMFDPAEQKKIGMLTPSSNTALEPVCSRMVSGLENLVAMHY
                     SRLEVTKISLEKDALSQFDLDPFLRASEFLAHADVDAIAWNGTSGGWTGFDFDRMVCE
                     KITEATGIPATTSMLAMLEAFEENKVKTLHMVTPYIPAIDELIAKQFEEKCGYQVINS
                     RGLNQTVNRSFSLVTPEQIDGMCKEVSVDPADGISIICTNLRSTWQIEQLERDYGITV
                     YDSTAVTVWKTLKMVGVDPGVVKGWGRLFTGK"
     gene            complement(434842..435522)
                     /locus_tag="DSY_RS02065"
                     /old_locus_tag="DSY0375"
     CDS             complement(434842..435522)
                     /locus_tag="DSY_RS02065"
                     /old_locus_tag="DSY0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="WP_011459043.1"
                     /db_xref="GI:499778309"
                     /translation="MSCIIPNIYSQPTDTNLWNILLSSGIPRHYQKGEFVFEKDQPSN
                     GLICLKKGKVKVSSFFSEGSEKIFGILVAPALFGETETLDQGPRMVSATALTHVEIVA
                     ISGNKTKELIYTYPDIALSIIQSIGVKLRWTTLQAEDLSTQKIEYRLARLLLDFKHYG
                     IFTSKNNDNCLMITHEELAHFIGTARSKVTTYLNEFAHKGLIRLRRGEIRILDTAGLN
                     KYTHKSQA"
     gene            complement(435679..436749)
                     /locus_tag="DSY_RS02070"
                     /old_locus_tag="DSY0376"
     CDS             complement(435679..436749)
                     /locus_tag="DSY_RS02070"
                     /old_locus_tag="DSY0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_005810382.1"
                     /db_xref="GI:492325200"
                     /translation="MIEQYMALAIQPTMRGAEKREDIKRNIAHISDVIDAAVWLSGIE
                     MPVRLITIPEGALQGFTDELFDWDHQYYVDHMAIDIPGEETELLGKKAKEYNAYLIAQ
                     AKVKHPEFPGRFFNSAFLIDPKGEVILQSYKMQVFCQEHSTVPHDVWDKWIELYGYKL
                     DSFYSVADTEIGRIGLLVCQEGDYPEPARGLAMNGAEIIYRSSAPEPAVANGWWELQN
                     RARALDNTCYVVAPNVATYYPSQAAELSVDTFGGQSMIVNHHGEVISNHKYGSGSSYA
                     GAIIDVESLREYRERSLFGNWMKDLRTEQFKLIYEEPLFAKNLCLDRTPLKHKDTHEI
                     YRQHVRQLIERGIWVESTRSKK"
     gene            437258..437783
                     /locus_tag="DSY_RS02075"
                     /note="GCN5 family acetyltransferase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            437813..439369
                     /locus_tag="DSY_RS02080"
                     /old_locus_tag="DSY0378"
     CDS             437813..439369
                     /locus_tag="DSY_RS02080"
                     /old_locus_tag="DSY0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CdaR family transcriptional regulator"
                     /protein_id="WP_005810376.1"
                     /db_xref="GI:492325194"
                     /translation="MKLNLAVFAYHLADYAPRLYDSEIHGLGVADVRFLDRQETFLSE
                     SVYIGMWDKLQALIKPPFYVVCIGRDETTDRWLEEHGVKALILDSEVELNEVFERLQD
                     IFQHYNRLESELLEAVLCKEPLNVLLNICAKFFANPTFITDAALCLVATCDNFAHPET
                     DRAWQETIESGRSSSELLLLMKRKKLTNLLNTSRKAEFVNVGENYSKIICANYFDQEV
                     RIATFTVSEAYTPLSPLQAGLVDHVAKLLTAEVRKQHKASSRYLFAIRSNISNLLHGQ
                     KIDEAILKTNFAHIGWTDQEDYRLLKIPLTTAELADGTAGHNRKIYESIFPHYVSLDL
                     NEVLILVIRCARDTEADKRRFAELKKHLKNENAACGVSKTFHDFDMLGEEYKLANAAL
                     EIGSWKYPKEALYFYEDMMLEHLFSEGSRIFNLRSLCHDSVLRIAEHDQQNNSSLLQT
                     LKVYLLQEKSLLAASQELHIHRNTLVYRLGKIEQISGLDLNSPLIRLQGILSCLILEY
                     LNGLEEKAPD"
     gene            439512..440921
                     /locus_tag="DSY_RS02085"
                     /old_locus_tag="DSY0379"
     CDS             439512..440921
                     /locus_tag="DSY_RS02085"
                     /old_locus_tag="DSY0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459044.1"
                     /db_xref="GI:499778310"
                     /translation="MSSDNQRAQFQVVTGNESPAIYHQFSPALETATLLFQMAPGLLV
                     PYEFGGVEYEIDGYRKSAWIGTTLMISPIYDVVGPDAVKFLNSICVNDFTNLTTKGLR
                     HAVICNDQGQVLTDGVVIRIGEDRYRTYWLNPPIDYFLKTSGMNVAGEDLSGTEYFIQ
                     IAGERSLEILEDAFASDLHDIKFATHRKASMDGKEVEIIRLGMSGNLAYEIHGPMAEF
                     DEVYRKIWNSGQKFGARKLGMHAYNLFNHTEAGFPNIHLHYPLPWFESGEDMAKYMLA
                     NPQYSMYNLNRKLVGSVGEELQARFVTPYDVGWGFLVKFNHEFRGRKALEEIANDPPR
                     TAVTLEWNGDDVGAVFATQFKPGEEACESIGAESEGMFTSNTFRGEMAYRSNRVLYNG
                     KDIGISSGRIVSYHYNSMISLGFIDPAYAKEGNELTLIWGTPGTRQMNIRVKVARYPY
                     NGDFVRNENKDVEEIPRHK"
     gene            441148..441687
                     /locus_tag="DSY_RS02090"
                     /old_locus_tag="DSY0380"
     CDS             441148..441687
                     /locus_tag="DSY_RS02090"
                     /old_locus_tag="DSY0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formiminotransferase-cyclodeaminase"
                     /protein_id="WP_005810373.1"
                     /db_xref="GI:492325191"
                     /translation="MEKVASLPSTPAGGSVAALNAASAAALAEMASRLTADKMEDGAL
                     AKELKGMAEVFHSYRVKFTDAIDEDAKVFSEVLSAYKLAADSAENRKIRDEKIQESYK
                     KAVIVPIKLAEDIWAMMQLIKMQHHHIGDSYITDSAQAYMLAEAALKSLLYHIKSNLM
                     YIRDKEFTEKIEEVLEQFG"
     gene            441846..442157
                     /locus_tag="DSY_RS02095"
                     /old_locus_tag="DSY0381"
     CDS             441846..442157
                     /locus_tag="DSY_RS02095"
                     /old_locus_tag="DSY0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB family transcriptional regulator"
                     /protein_id="WP_015942689.1"
                     /db_xref="GI:506422970"
                     /translation="MRTLAKRHSYGVVQMKKKAILTIPKEVRLALHLADEGELFEIIV
                     DNGKIILEPKTLIPKEQEWFWTERWQAGEREAEEDIKAGRVSPAFDNVKDLLEALNNE
                     D"
     gene            442147..442431
                     /locus_tag="DSY_RS02100"
     CDS             442147..442431
                     /locus_tag="DSY_RS02100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytotoxin"
                     /protein_id="WP_005810370.1"
                     /db_xref="GI:492325188"
                     /translation="MKIKFTSRFKRSYSKLPKDIQLLFEDKIHQFKENWRHPSFRTHM
                     LKGTNGIWSASLNMEYRFTFSFTFEVDAEGNTVCLLRDIGDHDHIYREPY"
     gene            442560..443171
                     /locus_tag="DSY_RS02105"
                     /old_locus_tag="DSY0382"
     CDS             442560..443171
                     /locus_tag="DSY_RS02105"
                     /old_locus_tag="DSY0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_005810368.1"
                     /db_xref="GI:492325186"
                     /translation="MGETKKEILGRFMRLQGLLHRYQAQNFMNFGPWGNPQRGQGRVL
                     ALLKMKPEISQKELTYLLDMSKQGLAELLNKLEKNEFITRETSEEDRRSVNIKLTEKG
                     AAVAGEMGDMPPELEKLFDVLNDEELANLSDYLKRITERLEEQFTDGDGDLRKQMMER
                     LRQCHHHHGRNFGGHRGDFHGFYGGVFPHRRGGRRDDDGEREE"
     gene            443332..443652
                     /locus_tag="DSY_RS02110"
                     /old_locus_tag="DSY0383"
     CDS             443332..443652
                     /locus_tag="DSY_RS02110"
                     /old_locus_tag="DSY0383"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459047.1"
                     /db_xref="GI:499778313"
                     /translation="MADPKFTQRNLRFRSPFFRSWSLIWVWFSKECEMFRASISFLSL
                     FSNPSLLDKRVFIYVGRDFFVHSLLGAGYEQGMAIVKICGFKCLEGAGWKFRHSPQSG
                     LGGY"
     gene            complement(443649..443882)
                     /locus_tag="DSY_RS02115"
     CDS             complement(443649..443882)
                     /locus_tag="DSY_RS02115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810364.1"
                     /db_xref="GI:492325182"
                     /translation="MAIVDKPLTSTLVLKYQDGLTPAGDPQIKQKSLNYVRPGVDHAV
                     LHEIAVALFSLTEHPLIAVILRDSTELVEEPED"
     gene            444100..444939
                     /locus_tag="DSY_RS02120"
     CDS             444100..444939
                     /locus_tag="DSY_RS02120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810360.1"
                     /db_xref="GI:492325178"
                     /translation="MRMENSNRTPGQIASEINVIKEQSGKMLLSNAVEIGRRLTEAKE
                     LVPHGEWLKWLTESVSYSRSTASRLMKIFREYGPILSSTDGEEGSNGAPVQHLNYTQG
                     IALFGISVEDRDQFIADNDVGKMSKRELQQTVKVRERTAEEEERREPENQGVQNQEKT
                     EEAADKAMDKPLELIPVERKIIKPKTVPTAQTELPQEDANPESMKYNAQYATHRDTML
                     SAYGELLKTLVALNRVDPVKKEANRKEALKITTNMAETLKQYPPAIKTNLKIKRTEPG
                     APN"
     gene            complement(445132..445746)
                     /locus_tag="DSY_RS02125"
                     /old_locus_tag="DSY0385"
     CDS             complement(445132..445746)
                     /locus_tag="DSY_RS02125"
                     /old_locus_tag="DSY0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter ATP-binding protein"
                     /protein_id="WP_005810358.1"
                     /db_xref="GI:492325176"
                     /translation="MELEAKGICFRYMSKTAPILNNVDFTLKEGDKLALVGPSGCGKS
                     TLAKILAGYIRPSGGTVLLDGKPLPDQGYSPVQMIYQHPELAVNPRWKMSKIAHECWT
                     PNDELLKDMGIEKEWMSRWPTELSGGELQRFCVVRALGPETRFLICDEITTMLDVITQ
                     AQLWQTILDIAEKNKLGMIVVTHNNYLADKVCDRVIKLTDINHI"
     gene            complement(445772..446635)
                     /locus_tag="DSY_RS02130"
                     /old_locus_tag="DSY0386"
     CDS             complement(445772..446635)
                     /locus_tag="DSY_RS02130"
                     /old_locus_tag="DSY0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_011459049.1"
                     /db_xref="GI:499778315"
                     /translation="MYDNKLTPVGKLRLPGINIRTRMLILIFISAIYLFGILIWGFYM
                     EESLYEVSYTHKFIPPGLEHPFGTDFMGRDMFYRSIKGLSTSLVIGVLASAVSSILAL
                     LLGIAAATIGGKFDQFVNWCVDCCMGLPHLVLLVLISFMLDRGVKGVAIAVALTHWPE
                     LTRIVRAEVLQIRSSQYVQLSYKAGKSKFWVAKEHMVPHVLPTYLIGLVLLFPHAIMH
                     EAALTFLGFGLPAESPAIGAILSEAMVHIATGKWWLALFPGLLLLIAVILFDVIGENL
                     KNLLNPNSGNE"
     gene            complement(446628..447611)
                     /locus_tag="DSY_RS02135"
                     /old_locus_tag="DSY0387"
     CDS             complement(446628..447611)
                     /locus_tag="DSY_RS02135"
                     /old_locus_tag="DSY0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_005810353.1"
                     /db_xref="GI:492325171"
                     /translation="MTSAKHIVSILVRMVLLLMAVCVIAFVLITSSPIDPLVSYIGTN
                     STLSEEAKQEISDYWGLNDPLPERFSAWTANVLQGDFGDSITYKKPVRDVIWERFSYS
                     AVLMLVAWAASGVLGFLIGIAAGMRKGSVFDRSVKMFCLGLQSAPTFWLGLLILSLFA
                     VTLGWFPIGMAAPMGKLASEVTLGDRAYHLVLPALTLTVVSISKITLYTRQKLIETMG
                     NDYILFAKARGENERQLVTRHVLRNIALPAITIQFASFSELFGGMALAETVFAYPGIG
                     TATTAAALNGDVPLLLGIAIFSALFVFSGNLIANILYGVLDPRVKEGGDYV"
     gene            complement(447725..449359)
                     /locus_tag="DSY_RS02140"
                     /old_locus_tag="DSY0388"
     CDS             complement(447725..449359)
                     /locus_tag="DSY_RS02140"
                     /old_locus_tag="DSY0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_041272201.1"
                     /db_xref="GI:752602814"
                     /translation="MKKKLALVLSILLMLLVTACSSGTGAGKPAETTPSQEGAVPPPA
                     DGIVAYVGGTIFDSSLDPIKGAMSYGYSFTNCALLRMNPDSEYEGDMATKWSISEDSL
                     VYTYKLRENVKFSDGSDFTADDVVFTYTTVKENQAHNENVDLTKLASVKALNDYTVEF
                     TLSEPYSPFLDATACLGIVPSDSYDSKKFDQYPIGTGAWIVTQYDANQQIIVKANENY
                     YEGAPAIKKVTFVSMNSEAAFSNAKSGQLDIVMIGPNYTSEKVAHMMTERFATMDIRM
                     INLPVLKEQTMKNPDGKDIKVGNNVTSDINVRKALAIGIDRQTIINHAFNGVGKPAVS
                     FTANLQWASTDTYADNRKVEASALLQDAGWVDTDGDGIREKNGLKCEFDVYAPGSDND
                     RFLLANAVAEDALKLGVKINVKTASWDEVANLQSTSGIVWGWGQYSPTVLNSLFNSQL
                     FLKGAYDNVSGYANPQVDADIQKAFTSTTHDGAVAAWKAVQATANQDYPYLYIVNIEH
                     CYLVKDSLDLSLDTQIAHPHGHGSPIICNMKDWNYK"
     gene            449616..449924
                     /locus_tag="DSY_RS02145"
                     /old_locus_tag="DSY0389"
     CDS             449616..449924
                     /locus_tag="DSY_RS02145"
                     /old_locus_tag="DSY0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CsoR family transcriptional regulator"
                     /protein_id="WP_041272202.1"
                     /db_xref="GI:752602815"
                     /translation="MIIMSEKGHSHTQHHHHHHHTKAVLNRLSRAIGHLESVKRMVEE
                     EKDCSEVLIQLSAVIAALNNTGKVILKDHIEHCIVDAWEHSDEEAMENLNKAIDRFIK
                     "
     gene            450038..450235
                     /locus_tag="DSY_RS02150"
     CDS             450038..450235
                     /locus_tag="DSY_RS02150"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035213757.1"
                     /db_xref="GI:737229424"
                     /translation="MDWPLQHSITKTMEVCLPNYRADTPWSFAFLERLDPQIVDIGFP
                     WQDSIYLLFCSFFGLIWTWDQ"
     gene            450702..451823
                     /locus_tag="DSY_RS02155"
                     /old_locus_tag="DSY0390"
     CDS             450702..451823
                     /locus_tag="DSY_RS02155"
                     /old_locus_tag="DSY0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005810346.1"
                     /db_xref="GI:492325164"
                     /translation="MRKWLLFLMIPMLILMGCTSQVSQSSGQTDGGKENSAEKSTQVI
                     TDMMGRDVEVPTKINSIICTGAGALRLIAYAQATDLVIGIEDTDKSGVIGRPYNYVYH
                     DQFKDLPSIGKGGGRGYTAYEEQIIALQPDVIFCSYTSDALDQLAVKTGIPVVSTAIQ
                     GNLFEENTVQSLKLIGEILGREERCAEVIAYLDQYEADLNNRTKDIPEADKPTVYAGA
                     ISNQGGRGFAGTYGGLGPLKAIHISGVADEVGKKEGFEVDWEQIQVWDPDIIFLDPGN
                     LSLVNEEYVKKPDYFNSLRGVKEGNVYSIISFNNYTTNIEMAIADAYYAGKVLFPEKF
                     ADIDIEAKTDEIFEKFLGKGIYTEMKEAGLAFGKITLGQ"
     gene            451798..452889
                     /locus_tag="DSY_RS02160"
                     /old_locus_tag="DSY0391"
     CDS             451798..452889
                     /locus_tag="DSY_RS02160"
                     /old_locus_tag="DSY0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_035213756.1"
                     /db_xref="GI:737229423"
                     /translation="MERLRLVNKRSRLHYREAYGNYMAGKRLVLLALIALLIGVALFS
                     ITAGSAGLTLGEVFRTFMGTGTTQAQAIVWNVRLPRIFTAIVVGGALALAGCVMQSVL
                     RNPLASSSTLGISHGAAFGAAIAIVYFSAGSQHNAAGSGAISITNPYLVTACAFMGGM
                     ISVFVILVLSRIKTVTPAAMVLAGVALSSLFRGGVALVQYFADDVALASVVYWTFGDL
                     GRTSWHEIGLILIILGPTFVYFMFNSWSYNGIQSGSQTARSLGIHVDQLIIVSMVLAA
                     LLAASAVSFVGIIDFVGLVAPHMVRKFVGSDYRFLLPASMLAGACILLLSDLCSRTII
                     APIVLPIGAITSFLGAPLFIYLIYKGAKK"
     gene            452892..453671
                     /locus_tag="DSY_RS02165"
                     /old_locus_tag="DSY0392"
     CDS             452892..453671
                     /locus_tag="DSY_RS02165"
                     /old_locus_tag="DSY0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_005810342.1"
                     /db_xref="GI:492325160"
                     /translation="MLKVQELSFQYGSHPVLEDVHFEAPYGQCVAILGNNGAGKSTLI
                     KCLNRILPPRSGQVLLDEQDLCSMSRTNVAKEMAYVAQHSETARFTVYDAVMLGRKPY
                     IRFSPTEADYEIVHGMIEKLELSQMSLAYIDELSGGELQKVMLARALTQQPKVLLLDE
                     PTSNLDLKNQHDMLGLVGKIAKEENICVLMVIHDLNLALRYCDRFLFIKDGGIYAYGD
                     EEIMNAKVIGEVYGIPVAIEYAHGAKIVVPFPEQGVKANKA"
     gene            453729..454253
                     /locus_tag="DSY_RS02170"
                     /old_locus_tag="DSY0393"
     CDS             453729..454253
                     /locus_tag="DSY_RS02170"
                     /old_locus_tag="DSY0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formylmethanofuran dehydrogenase subunit E"
                     /protein_id="WP_005810340.1"
                     /db_xref="GI:492325158"
                     /translation="MDKQLWEKAVAFHGHECPGLAIGFRACEAVQEKMGLKFSQDEEV
                     VCVTENDACGADAVQVITGCSFGKGNLIYRGTGKMAFSFFSRNTGESMRIVLKPSSSE
                     MDRQERQNYILTAPMDDVFEFKKPGFTLPKQARLFKTVICEVCGEGAPEHKMRLQEGK
                     KVCLDCFEDYSRGY"
     gene            454526..454834
                     /locus_tag="DSY_RS02175"
     CDS             454526..454834
                     /locus_tag="DSY_RS02175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_005810336.1"
                     /db_xref="GI:492325154"
                     /translation="MVNVNLDKRLVESIQNIGQKYAVERIILFGSRARGDNKGLSDID
                     LVIFPLPEFDKRGSLLSEFDDLRTLLKLDILFHDKHMDSRLLENIKKEGVTLYERTLH
                     "
     gene            454815..455213
                     /locus_tag="DSY_RS02180"
     CDS             454815..455213
                     /locus_tag="DSY_RS02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_005810333.1"
                     /db_xref="GI:492325151"
                     /translation="MSEPYTKLDNFEKAYARLKEGSNRYDGNDDLMRDGLIQRFEFTF
                     ELAWKTLQAVFEDEGLIGLNSPKRILREAFATEVIGNEELWLSMLDDRNATVHIYNEM
                     TAVRICQDIKGKYVPAFGELVERIRERLSE"
     gene            complement(455341..455538)
                     /locus_tag="DSY_RS02185"
     CDS             complement(455341..455538)
                     /locus_tag="DSY_RS02185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942711.1"
                     /db_xref="GI:506422992"
                     /translation="MDIAALSVVSNQVQLKQQASLSVMKMVMNASQEQTNSLLAMTAG
                     MSGEMESSVNPHLGSKLDVLV"
     gene            complement(455652..456164)
                     /locus_tag="DSY_RS02190"
                     /old_locus_tag="DSY0396"
     CDS             complement(455652..456164)
                     /locus_tag="DSY_RS02190"
                     /old_locus_tag="DSY0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-triphosphate reductase activating
                     protein"
                     /protein_id="WP_005810328.1"
                     /db_xref="GI:492325146"
                     /translation="MMDSCIRIAGIIGESIVDGPGIRLVVFAQGCPHHCPGCHNPETH
                     AYEGGKSVAIAEILQRLAMNPLLDGITLSGGEPFAQAAGFALLAQSARQRGFHVMTYS
                     GYTYEELTASSEQNPAWALLLEQTDLLVDGPFQLAERNLLLPFRGSENQRVIDVQESL
                     RQGKVVLASV"
     gene            complement(456164..458533)
                     /locus_tag="DSY_RS02195"
                     /old_locus_tag="DSY0397"
     CDS             complement(456164..458533)
                     /locus_tag="DSY_RS02195"
                     /old_locus_tag="DSY0397"
                     /EC_number="1.17.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside triphosphate reductase"
                     /protein_id="WP_011459055.1"
                     /db_xref="GI:499778321"
                     /translation="MITKIRKRDGREAPFNIEKIANAIFKAASATGGKDYQSSLLLAE
                     EVVNYLEVNLHKKVPSVEEIQDAVEKILIERGHARTAQEFILYRAERTRVREMDTRLM
                     KVYEELTFKEAKDNDMKRENANIDGDTAMGTMLRYGSEGAKQFNEMFVLKPEHSKAHK
                     EGDIHIHDMDFLTLTTTCCQIDIIKLFKEGFGTGHGFLREPNDIQSYSALACIAIQSN
                     QNDQHGGQSIPNFDYGMAPGVAKTYIKLYRQNLLKACELLIHQDVDQEELEAHLKDVF
                     SALPNQGHTPTLSSDPDYFEQEAALLQTLPNLKLDMPTIRKAQEFAVKKALAETDKKT
                     YQAMEALVHNLNTMHSRAGAQIPFSSLNYGTDTTPEGRMVVKNLLLATEAGLGNGETP
                     IFPIHIFKVKEGVNYNPSDPNYDLFQLACRVSAKRLFPNFSFIDAPFNLQYYVPGRPE
                     TEIAYMGCRTRVIGNIYDPSRETIFGRGNLSFTTINLPRLAIKSHQSRTEFFAMLDEK
                     IDLVINQLLERFEIQARKKVKNFPFLMGQGIWLDSDQLGWDDEIREVLKHGTLSMGFI
                     GLAECLMVLTGQHHGESEEARELGLEIVQQLRRRMDEAGREYGLNFSLLATPAEGLSG
                     RFIKMDRELFGSIPGITDKEYYTNSFHIPVSFPISAFRKITIEAPYHELTNAGHITYV
                     EVDGDPTQNLEAFEKIVRCMKESGIGFGAVNHPVDRDPVCGYTGIIGNECPRCGREES
                     TAPFERIRRITGYLVGTLDRFNDAKKAEVRDRIKHLNCLDSSFGEKGTL"
     misc_binding    complement(458681..458865)
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            complement(459079..462306)
                     /gene="carB"
                     /locus_tag="DSY_RS02200"
                     /old_locus_tag="DSY0398"
     CDS             complement(459079..462306)
                     /gene="carB"
                     /locus_tag="DSY_RS02200"
                     /old_locus_tag="DSY0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O28994.1"
                     /note="four CarB-CarA dimers form the carbamoyl phosphate
                     synthetase holoenzyme that catalyzes the production of
                     carbamoyl phosphate; CarB is responsible for the
                     amidotransferase activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl phosphate synthase large subunit"
                     /protein_id="WP_005810321.1"
                     /db_xref="GI:492325139"
                     /translation="MPKREDIKKIMIIGSGPIVIGQAAEFDYSGTQACKALKNLGYEV
                     VLVNSNPATIMTDAGTADATYIEPLNVQRITEIIEKERPDALLPNLGGQSGLNLSSEL
                     AKAGVLDHYGVKVIGVQLDAIERGEDRIAFKETMERLGIDMPKSSPAYTVEEAEKIAQ
                     ELGYPVVIRPAYTLGGTGGGLVYNVEELKTIVNRGISASMIGQVLVEESVLGWEELEL
                     EVVRDSKNQMITVCFIENIDAIGVHTGDSFCSAPMLTISQELQERLQKYAYSIVEAIE
                     VIGGTNVQFAHDPKTDRVVIIEINPRTSRSSALASKATGFPIALISSLLAAGLTLDEI
                     PYWREGTLDKYTPWGDYVVIKFARWAFEKFKGVEDKLGTQMRAVGEVMSIGKNYKEAF
                     QKAIRSLEIGRYGLGFAKDFNTKTLPELLELLKTPTSERHFMMYEALRQGADPAELAA
                     ITYVKTWFIEQMKELVDLEEKILEYQGRELPAELLIQAKKDGFADRYLAQLLGISETQ
                     VRRQRLGLGLTQAWDAVPVSGVNNASYYYSTYNAPDKVTTSQREKVLILGGGPNRIGQ
                     GIEFDYCCVHAAFALKNLGYETIMINCNPETVSTDYDTSDKLYFEPLTVEDVLSIYEK
                     ERPIGAIVQFGGQTPLNIAAQLQEAGVRILGTVPEVIDQAEDRDQFRKMMEKLAIPMP
                     QAGMASTLEEALAAAEMIGYPVMVRPSYVLGGRGMEIVFDEEQLREYVAAAVDITPER
                     PILIDKFLENAIEAEADAVSDGTHAFVPAVMEHIELAGIHSGDSACVIPPLTIADRHL
                     RTIIDYTQRIAQELHVVGLMNIQYAIAEDKVYVLEANPRASRTVPLVSKICNTPMARL
                     ATELILADYTGQKNDIATNFKPAQISHYGVKEAVFPFDKFPEVDPVLGPEMRSTGEVL
                     GMANSFGLAYFKAQEATHSSLPFSGTVLMSIAEQDRSSGVIEIAQEFLKLGFKIKATQ
                     GTRKFLQDHSIDAEFIHKIEEGRPNITDGIMNGEIQLVINTPIGKRSLKDDSYIRKTA
                     IKYKIPYITTTPAALASAKGIAASQEAAANKTVVKSLQEYHGEIM"
     gene            complement(462549..463466)
                     /locus_tag="DSY_RS02205"
                     /old_locus_tag="DSY0399"
     CDS             complement(462549..463466)
                     /locus_tag="DSY_RS02205"
                     /old_locus_tag="DSY0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011459056.1"
                     /db_xref="GI:499778322"
                     /translation="MMNLEQSTYLVEVDKYKSITKAANNLFVSQSTISMSIAHLEKEL
                     NIIIFKRSKTGVTATANGKKIITYAQNILNELKNMNEYAINCSNNLASTIKITSAPTF
                     CNSILIDIVTELLTTTPEIHIDLKENNNEHIIQNIYNGEIDIGIIGHLCDSKDRILNN
                     LDKKSISYEEFYCGNVNLYLNKNHPLLYKNSITLQDLSNYPLVSHQYLLKHWTNPLQL
                     KNLASEFYNYESIKIIIQNSNLIAIMPDIIEINDYSINAGLIVRLSEVELNTKVCYGC
                     IRSLKNDILPAEKKIIDLLKSKCDQIYIP"
     gene            463822..465330
                     /locus_tag="DSY_RS02210"
                     /old_locus_tag="DSY0400"
     CDS             463822..465330
                     /locus_tag="DSY_RS02210"
                     /old_locus_tag="DSY0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_005810317.1"
                     /db_xref="GI:492325135"
                     /translation="MPYPTIYPTGTTIYKPEKCFNGFTIYPANGQGAMLIDMNGREVN
                     LWKDLEGMPNKILPGGFVMGSRGIRSPRHMTKEYIDVVQVDWDGNIVWKFDKHEYIED
                     PGEQPRWMARQKADYQRQGNPVGYYVPGMDPLTDQGNTLILCHKNVMKRKISYIPLID
                     DAIIEVDWQGNIIWEWVCSDHFDEYGFSEAAKNVLARDPNLRTSGINGMGDWMHINSM
                     SVLGPNQWYDAGDERFHPDNIIWDARQSNITAIIDKKTGKVVWRLGPDYDTPEMKKLG
                     WIIGQHHAHMIPKGLPGEGNIMIFDNGGLAGYGLPNPSAPTGFNNCRRDYSRVIEFNP
                     VTLEIEWQYGPHEAGFIVPLNSSRFYSPFISSAQRLPNGNTLITEGGGGRLFEVTHDH
                     EIVWEYISPYYGNGVYRGMSKYNGYKFNAVYRAYRVPYTYCPQAGVPEEVKIDPIDNE
                     DFRVPGAAPRGAVKVTVIEGTVDMSTTESDNFCLATDEQKEEVVKLVKREEK"
     gene            465542..467032
                     /locus_tag="DSY_RS02215"
                     /old_locus_tag="DSY0401"
     CDS             465542..467032
                     /locus_tag="DSY_RS02215"
                     /old_locus_tag="DSY0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459057.1"
                     /db_xref="GI:499778323"
                     /translation="MAAELQIKRKPIFSQSTKYYFHSAIAILLMFTFRFIPPFNPMIT
                     ETGMNALGIFLGVLYGWSFVGMIWPSLLGMIACGFTGIMTLQESFAMGFGSDLAVITI
                     FVFMFAAFMEESGLNSYIANWFISRKIVVGKPYAFLAAMMLSGFVLSCFTQIFAAIVI
                     VWSIFYNVAKEMGLQRREGFVNCTMFGILYSASLGAIVFPFSSFAIIALGLMKKATGL
                     TVNFLTFSLFNLLACSIIMLLYWLACKYLFRPDTQKLLSTEDRFAYMRGVKMNKKQKS
                     AAVGLGIFLTMLFLPGIFPNSSFIINQLKSLGVVGSVLLVMIAFMILRKDGSEGTEGI
                     LNFGDIARKGINWQVLVLLASTFPISSALESEQSGVLKAAEAFISSSISDLNPFLAMA
                     FLAILVACLTQFTHNAVLLIIFIPMLCPIVISHGINPIVLVVTLLYASKSALITPAAS
                     TQAAMIFANTEWVEIKELFKLAVVGATIMAVVAVAIIPLANISSVA"
     gene            467195..468439
                     /locus_tag="DSY_RS02220"
                     /old_locus_tag="DSY0402"
     CDS             467195..468439
                     /locus_tag="DSY_RS02220"
                     /old_locus_tag="DSY0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011458871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011458871.1"
                     /db_xref="GI:499778137"
                     /translation="MQDKDTTQSTFMQAFQPFFSKDLWETIHREVPGLDLRSQKLTTN
                     QLTLLISHAQLQEYRALRKISTSVHHDSLGQAIGLESISHSQISRRLKTLPTQVPEML
                     FKGTLHNVAQKQGYGKIRQQLGKLYMIDASTMSLCLSRYPWAVFRKSKAGVKMHLRLS
                     FDAMAVPDEVLVTPAKTADRKKLDELIVQDQEALNIFDRGYVDYKLFDDYCEKGIRFV
                     TRLKNNAVIEFTGVERPVKEDGLIEEDVDVILGAGSRKMKHTLREVTIDDNVHEPFTI
                     LTNDFNLSAEELGEIYRYRWQIELFFKWLKQHAQIKHFYGTSETAVINQILLALMMYC
                     LLVLLKLEAGYPRDLLTLQRLLIACLFERYEEFLEKLRRRRRKGSKRIRYEEIYRMTE
                     HSILKEEETQWLDDLTYDPVIL"
     gene            468669..468995
                     /locus_tag="DSY_RS02225"
                     /old_locus_tag="DSY0403"
     CDS             468669..468995
                     /locus_tag="DSY_RS02225"
                     /old_locus_tag="DSY0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_005810313.1"
                     /db_xref="GI:492325131"
                     /translation="MLLQKLNASQFEEIIYTDGNPSLVIFSRKSCHVCKEVMPVLEDL
                     QSKYEGKFGFYYVDVEENKAVFQRFSLKGVPQILFFNFGEYQGKLSGKVEDEQIEEKI
                     SQVLKA"
     gene            complement(469062..469781)
                     /locus_tag="DSY_RS02230"
                     /old_locus_tag="DSY0404"
     CDS             complement(469062..469781)
                     /locus_tag="DSY_RS02230"
                     /old_locus_tag="DSY0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_005810311.1"
                     /db_xref="GI:492325129"
                     /translation="MNTYALILIVLIASTMQAATGFGFAIMSIPFLLLLLDPRDAIQL
                     NILLAFIISLMMIYKIRHTVKAATLKRLIMGSLLGTLPGILIFIFLDVRPLKLLISVL
                     LLISTCLLAAKIRFKESNTKEFLMGVCSGFLTTSIGMPGPPLMIYYAGTDLDKATIRS
                     TTVAYFVFINLLSILMQTFLYGSSAIVWKSTLISLPFLVLGIVLGQFVFVRLNQQRMQ
                     QLIYLLLFFTSIYLFVTTIAQ"
     gene            complement(469979..470635)
                     /locus_tag="DSY_RS02235"
                     /old_locus_tag="DSY0405"
     CDS             complement(469979..470635)
                     /locus_tag="DSY_RS02235"
                     /old_locus_tag="DSY0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propanediol utilization phosphotransacylase"
                     /protein_id="WP_005810308.1"
                     /db_xref="GI:492325126"
                     /translation="MEHNQLIAMITEAVMEQIRPLPKINQIPVAISNRHVHLSQEDAQ
                     TLFGPNYSFKIKKDLSQPGQYACEERVTLVGPKGVIENVRILGPVRPQTQVELSVSDG
                     IKLGITPPVRDSGDLANSAGITLVGPSGSLTLPEGVIAAARHIHMHSTDAERLGVKDR
                     DRVSVTAPGPRGLVFRETLIRVSHNFTLEMHIDIDEANAASLRNQDYVELLLVNHLPP
                     "
     gene            complement(470665..472152)
                     /locus_tag="DSY_RS02240"
                     /old_locus_tag="DSY0406"
     CDS             complement(470665..472152)
                     /locus_tag="DSY_RS02240"
                     /old_locus_tag="DSY0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010765377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetaldehyde dehydrogenase"
                     /protein_id="WP_005810305.1"
                     /db_xref="GI:492325123"
                     /translation="MVFDTDLASIQESRNLVQKAKEAQLHLAHFNEQQIDKILASIVA
                     AVEENAEGLARMACQETEYGIVEHKIAKNLFAARDVYESTKHIKTIGTISEDPDRKVI
                     RYAVPMGVLVGITPRTNPTSTIIHNALCAIKGANAIVFSPHPFAVQCGCATASLINEA
                     AVKAGAPDGVCSCLSMTSLQASHELMHHPDVAAIIATGGPGLVKSAYSAGKPAFGVGS
                     GNVPVFIERSADIKQAVNDIMVSKTFDNGMICASEQSILADQPIKDEVIKELQNQGAY
                     FLSPEEVQKVGRVVIHANGSMNNALVGQSPAVIAQRAGISIPADTALLIAPMDGYGKD
                     YPLSHEKLTTVLSFYVVQDWKEACHLSIELLKLGGIGHSCAIHSQNEQVIREFLAKPV
                     FRIIVNTPSALGGIGQTTGIMPSLTLGCGTWGGSSISENLGPQHLINIKHLTYGLKKV
                     AFHKVPAAQGNVSPLLPPTKATSWDIKSDDIADVVKQVLQQLKIG"
     gene            complement(472172..472462)
                     /locus_tag="DSY_RS02245"
                     /old_locus_tag="DSY0407"
     CDS             complement(472172..472462)
                     /locus_tag="DSY_RS02245"
                     /old_locus_tag="DSY0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810303.1"
                     /note="ethanolamine utilization protein; involved in the
                     degredation of ethanolamine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxysome shell protein"
                     /protein_id="WP_005810303.1"
                     /db_xref="GI:492325121"
                     /translation="MQQDALGMVETKGLVGAIEAADAMVKAANVHLIGKVLVGGGLVT
                     VMVRGDVGAVKAATDAGAAAAQRVGELKSVHVIPRPHTEVEMILPHDDSGKA"
     gene            complement(472491..472769)
                     /locus_tag="DSY_RS02250"
                     /old_locus_tag="DSY0408"
     CDS             complement(472491..472769)
                     /locus_tag="DSY_RS02250"
                     /old_locus_tag="DSY0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810301.1"
                     /note="ethanolamine utilization protein; involved in the
                     degredation of ethanolamine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxysome shell protein"
                     /protein_id="WP_005810301.1"
                     /db_xref="GI:492325119"
                     /translation="MQQEALGMIETKGLIGAIEAADAMVKAANVHLIGNVLVGGGLVA
                     VMVRGDVGAVKAATDAGAAAAQRVGELISVHVIPRPHGEVEMILPKAK"
     gene            complement(472826..473476)
                     /locus_tag="DSY_RS02255"
                     /old_locus_tag="DSY0409"
     CDS             complement(472826..473476)
                     /locus_tag="DSY_RS02255"
                     /old_locus_tag="DSY0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine utilization protein EutQ"
                     /protein_id="WP_005810297.1"
                     /db_xref="GI:492325115"
                     /translation="MKALITAADVKTAAETPEKILTISEADLITPAARDAAKELGVQI
                     TAHPVSLPPTVAPPAAAPPSTISPSPAFSPTSPLDPALVSRIIEEVMVCLNRSGSPAH
                     PQKEADPGGLRIVKGNSLILEDFSTGNPRDRIKIKELFNKKECPLYSAGIMALDKTSY
                     SLTPARDELNYIIEGTLECCIDNRCYTAQAGDTLYIPAQAKITLTAPDKVKLFYVC"
     gene            complement(473525..474070)
                     /locus_tag="DSY_RS02260"
                     /old_locus_tag="DSY0410"
     CDS             complement(473525..474070)
                     /locus_tag="DSY_RS02260"
                     /old_locus_tag="DSY0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propanediol utilization: polyhedral bodies pduT"
                     /protein_id="WP_005810294.1"
                     /db_xref="GI:492325112"
                     /translation="MESIGLVEVNSIARGIEAADAMLKAAQVDLLEAKPVCPGKYIVL
                     ICGDVAAVQSSVAAGKTMAAHSVLDDFILPNVHPQVLTAISAATPLTLIKALGIIETF
                     SIASLMVAADTAAKTGQVDLVEIRIGMGIGGKSFVTLTGDVASVESSVAAGVMLASER
                     GMLVDKVVIPSPHDHLKRCLR"
     gene            complement(474052..475407)
                     /locus_tag="DSY_RS02265"
                     /old_locus_tag="DSY0411"
     CDS             complement(474052..475407)
                     /locus_tag="DSY_RS02265"
                     /old_locus_tag="DSY0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Respiratory-chain NADH dehydrogenase subunit"
                     /protein_id="WP_005810293.1"
                     /db_xref="GI:492325111"
                     /translation="MREELIQKIKKAGVVGAGGAGFPTHVKVNSKARTVLVNGAECEP
                     LLRVDQQLMAGQAPKVVMGLELVMSVTGAKEGIISLKHKYHDAISALEKEISGKPIRI
                     HILDDFYPAGDEHVTVYESTGRLVPQGSIPLKVDCVVHNVETLLNIVDAVADQPVTDT
                     YLTITGEVNQPLTLRLPIGTSISEALAIAGYHDSEGMQVIEGGPMMGKIVADLHQPIT
                     KTTKGLIVLPREHPLLRLKTLPADKVLRQSRASCVQCRFCTDLCPRYLLGHRLEPHKI
                     MRMVNYGQGQEETMKMAFACSECGVCEQYACIMGLSPRAVNALLKKELTRLGIKPSPS
                     PADQAVDPLQPHRKIPVKRLISRLALQDYDRNAPLQEKDYPIDRVAIKLCQHVGAPSV
                     PIVKAGQRVKKGDPIASPPAKGLGSYLHASIDGVVQEITDSILISAREGSETQPWNPS
                     V"
     gene            complement(475400..475690)
                     /locus_tag="DSY_RS02270"
                     /old_locus_tag="DSY0412"
     CDS             complement(475400..475690)
                     /locus_tag="DSY_RS02270"
                     /old_locus_tag="DSY0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine utilization protein EutN"
                     /protein_id="WP_005810291.1"
                     /db_xref="GI:492325109"
                     /translation="MRIGRVINSIWATRKADSLIGTKLMIVQLLDRPHGELGPIIVAA
                     DIIGAGIGEKVLVTEGSSARNMDNFNDSPIDSTIVGIIDEEKDKLAEVSKHA"
     gene            complement(475741..476580)
                     /locus_tag="DSY_RS02275"
                     /old_locus_tag="DSY0413"
     CDS             complement(475741..476580)
                     /locus_tag="DSY_RS02275"
                     /old_locus_tag="DSY0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine utilization protein EutJ"
                     /protein_id="WP_041272810.1"
                     /db_xref="GI:752603423"
                     /translation="MNAMEKANQRIAAFQETMDHPRPYQGQKRLYTGVDLGTAYTVLA
                     VVDEEGTPVAGAMGFAQVVRDGLVVDYIGAVDILRELKATLEESLGVELLKAGVAYPP
                     GTSPGDQKALHYIAEAVGFDVIAALDEPTAANNVLNIEDGAVIDIGGGTTGTAVIGQG
                     QVVCVADEPTGGTHVSLVIAGAYRLPFAEAEKLKMDSRKHQELLPVIKPVIEKIAGII
                     RGHIQDHPVDRVYLVGGTSCFTGFETIVAAELQRPVIKPANPFLVTPLGIALAAAKTC
                     SNP"
     gene            complement(476637..477575)
                     /locus_tag="DSY_RS02280"
                     /old_locus_tag="DSY0414"
     CDS             complement(476637..477575)
                     /locus_tag="DSY_RS02280"
                     /old_locus_tag="DSY0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_005810287.1"
                     /db_xref="GI:492325105"
                     /translation="MNIIDFRFRPNTEAILKGISSNPAFKGMCQSIDFNKMLPQTLEE
                     VVEELDRHHVVKAVISGRDCETTYGAQSNNPSVIEFCHKFPDKFIGFAGLDPHKGMAA
                     LAEITHAVHEEGIKGAAIDPYLARIYVNDAKYYPIYAKCCELGIPLIIATGPGTLVPN
                     AVIDHVAPRYIDFVARDFPELKIIASHGGYPWVNEMITVAQRNANVYLELSEYEFFPQ
                     SSAYIEAANSILSDKIMYASAHPFVDFKLALKNYEQLPLKPEVREKVMYKNAAKVLGL
                     SDGTFSASKAMDAQEVQMIIENVIAQLSQRGLLADR"
     gene            477879..479273
                     /locus_tag="DSY_RS02285"
                     /old_locus_tag="DSY0415"
     CDS             477879..479273
                     /locus_tag="DSY_RS02285"
                     /old_locus_tag="DSY0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_005810284.1"
                     /db_xref="GI:492325102"
                     /translation="MTQDHWNKFATSQVYQQVIELLPEGVYISDAEGTTIAVNSMYEQ
                     LTGLKGQEVMGENVKVLVEKGVYNLALNPEIVVTGEHKMSVQITKTGRKVLLNGYPIF
                     DDSGKVSFVLTFVRDISLLSQLKEQIADQQEIIDKYREANEQCKKALTSNVEIFESKK
                     MIALMEKLKKIAKTDTTVLLLGETGVGKDVLARKIHQYSPRRKEPFLKIDCSTIPENL
                     IESELFGYEQGAFSGANTKGKVGLFEMADKGTLFLDEIGEIPLQLQVKLLRVLQDQEI
                     IHIGSTKVKKVNVRFIAATNRDLEEEVRKGTFRSDLYYRLRVADLEIPPLRERQEDIR
                     VMMQAFLDKYNAKFRKEISFTKELAEVLLAYKWPGNVRQMDNLIQSLVVTHETESVDV
                     TDLPHYMLLDLSKPEEAGNPSQGKSLDELVADYERNLLKKALDRYKSSSKVAEFFQVD
                     RSTIFRKAKKYKLL"
     gene            complement(479401..479601)
                     /locus_tag="DSY_RS02290"
     CDS             complement(479401..479601)
                     /locus_tag="DSY_RS02290"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272203.1"
                     /db_xref="GI:752602816"
                     /translation="MLIMILLSKNKFIPGDTFRWPGWQVCKPVLLYHQNNQLRSMLFL
                     IAKVMPTANPLNNLPIFQVGAS"
     gene            479594..482071
                     /locus_tag="DSY_RS02295"
                     /old_locus_tag="DSY0416"
     CDS             479594..482071
                     /locus_tag="DSY_RS02295"
                     /old_locus_tag="DSY0416"
                     /EC_number="2.3.1.54"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate acetyltransferase"
                     /protein_id="WP_011459062.1"
                     /db_xref="GI:499778328"
                     /translation="MSTCCLSPHEERIIDPQKGKVNYEGRERVFKILESFQDLRPKID
                     VERAKYFTESFKATEGQPLQPRWAKALMHIAQNITVYIDDQQLIVGRAGAQGRYGIVF
                     PELDGDFLGLAIEQLPQRVESPFNIDPDDAQIIINDVAPYWKGKTFHEELAKALPEDT
                     LKVTYDPADPLASRFIVNETASFRSSIQWVHDYEKVLKRGFKGIKEEAQAKLDQLDPL
                     SPADNMEKRPFLEAVIITCDAIVVWANRHAHLAAQMAKLEKDPQRKQELSDIAERCAW
                     VPEHPARNFREAVQSQWFVQMFSRIEQKTGTIISNGRMDQYFYPYYQKDVAEGILTPQ
                     QAIELLECMWVGMAQFIDLYLSPTGGAFNEGYAHWEAVTVGGQTPDGVDATNELTYLF
                     LESKQKFPLNYPDLAARIHSRSPERYLYEVAETVKEGTGFPKLINDEEVVPLLLSKGA
                     KFAEALDYAVSGCAECRMPNRDTYTSGNPYINFAAAIEMTLYNGRMLKYGDEQLGLET
                     GDPTQFETWDEFWKAYLAQQTNFLKHAFIQQHIIIRLRAQHFASPLGSLMHDLCMENC
                     LDLHQPVIKGGIDLGYFELIGYGTVVDSLAAIKKLVYEEKKLTMAELLEAVRNNFEGH
                     EVIREMVMHTPKYGNNDPYSDVIAKEVDRTAVEFTKKYSRELGVHLDLRLVPFTSHVP
                     FGKVVSATPNGRKAWMPLADGSSASHGADVNGPTAVLLSNFFSKNYGYRNRAARLLNI
                     KLSPSCVAGEEGSEKLVSFIRTWCDLKLWHIQFNIVNRETLLAAKQDPDKYRGLIVRV
                     AGYSAYFVDLSSDLQDDIIARTEHEML"
     gene            482133..483065
                     /locus_tag="DSY_RS02300"
                     /old_locus_tag="DSY0417"
     CDS             482133..483065
                     /locus_tag="DSY_RS02300"
                     /old_locus_tag="DSY0417"
                     /EC_number="1.97.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate formate lyase-activating protein"
                     /protein_id="WP_011459063.1"
                     /db_xref="GI:499778329"
                     /translation="MGESKVSERKTGIVFNIQHYSVHDGPGIRTIVFTKGCPLRCPWC
                     SNPESQRLQLQLGFNPNKCLGIKACFRCAEVCAYGAVKLNVEESDRILIDRKLCTDCL
                     QCVDVCPSQALQAFGKPITVEDVLKEVEKDSVFYARSGGGLTFSGGEPLMQGNFVAET
                     LKEARRRRLKTTIETCGYADWSTMERVCQHLTSLIMDIKCMDPEKHQEYTGASNELIL
                     DNFNKLCEHFPKLPKLIRTPVVPGFNDREEDIREIAEFVKDKPNVTYELLKYHRLGQQ
                     KYHFLGREYPWPDTQLEDVKFEKLKEVAKSIVNQ"
     gene            483087..484109
                     /locus_tag="DSY_RS02305"
                     /old_locus_tag="DSY0418"
     CDS             483087..484109
                     /locus_tag="DSY_RS02305"
                     /old_locus_tag="DSY0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_011459064.1"
                     /db_xref="GI:499778330"
                     /translation="MKKGLLKVSVLILTCLLVFSLSGCSKTEKASADGKIVIRLGHPM
                     APGNNVTVGYEKFKEIVEQKSEGKIEIQIFGNTTLGSDRVTMESTQKGTLEMASCSSP
                     NMASFAREFMVFDLPYITAPEHQQKLYAALNEGELEQYLDNVCGKIGLKPIMYSEFGY
                     RNFVSTKKPITKAADLKGLKVRTTDSPVEVAVAEALGMSATPVAWGETYTALQQGTVD
                     AEGNTWGLLSDAKHGEILEYGIDSGHNYSMHLLMINKKYFEALPEDLQTILVESGKEA
                     LEWQRAVSNDMETEAKQKLIDSGVTLYDLTPAEKEELKTITRPVWDKFPEIPQELIDL
                     VTATQK"
     gene            484268..486142
                     /locus_tag="DSY_RS02310"
                     /old_locus_tag="DSY0419"
     CDS             484268..486142
                     /locus_tag="DSY_RS02310"
                     /old_locus_tag="DSY0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_011459065.1"
                     /db_xref="GI:499778331"
                     /translation="MLDIAKKPENSWKKWLRWIDGNFEKPFLVIGMLAIIMLITYQTL
                     YRYIVSNITGGTAIVGLEELARFIFIWITYLAIPLAIKGRNNIRVDILYDRISDRWQK
                     ISWIMVDSCILVLTGVIFFMGIDHLQMMLNYPQTSPALNIPFFFPYLILPIGFGLMSI
                     RCIQDLVKQALEIGLKDTLIGVLVTAAIFSPLFLKPDVPAMAWLFGYFVLFIFIGVPI
                     AMALGLSALGTILCANTMPIEYISQISFTSIDSFPIMAIPFFVAAGVFMGEGGLSKRL
                     LGLADELLGSFTGGLALATVVTCMFFAAISGSGPATVAAIGSLTIPAMVERGYSRAFA
                     AALVAAAGSIGVMIPPSNPFVVYGVSAQVSIGKLFMGGIVPGLIIGLVLMGISYYYSK
                     KNGWKGEARKRTFRTVGKAFWEAKWALMVPVIILGGIYSGYMTPTESAAVAAFYGLIV
                     GVFIHRGINLKNIVYCFTESCSTSAVIIALMAMATIFGNILTIEQIPTKIATWMLAIT
                     DSKYVILLIITLLLLFVGTFMEALAAIVILTPILLPIVLQVGIDPIHFGIIMVVNLAI
                     GFITPPVGVNLFVASGLAKLKIEEISKAVVPFLLGMIAVLLLISYVPSISMFLTQFVK
                     "
     gene            486352..487608
                     /locus_tag="DSY_RS02315"
                     /old_locus_tag="DSY0420"
     CDS             486352..487608
                     /locus_tag="DSY_RS02315"
                     /old_locus_tag="DSY0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459066.1"
                     /db_xref="GI:499778332"
                     /translation="MPEHKAKDCDIVLFDANSYYASCHQAVNPELQGKPLLVAGDPRN
                     RTGIILTASYEARFYGVKTAMPLFQALKLCPEAVVLSPDFRLYLDLSRKMWEIVERYT
                     DEDHIEVVSVDECFADFRGSHLLFGSTEEIARRVQKEILEELGLGVSVGVSYCKIFAK
                     LASDYQRDPKTRVKLPRSFTVIAPGELESKVWPLGVGELSGIGRQTEKQLADLGIRTI
                     GDLAQASPQALRKGFGVYGAKLYAWANGRDERPVTPEDQAKDHSIGRSITLPQDITDP
                     EQGAEVLLFLADSVGRKVRREDTKAQTLTVQVKDAEFKTRTYSTTLFEPTDSTDVIYR
                     ESLKLLAKWPQGKPIRLLGLTASRLQKGIEQLSLFQEESEEQTELDRTVDELRDKYGS
                     GILMRGTQYLSLSRKLAGRSTKDKRE"
     gene            complement(487676..488713)
                     /locus_tag="DSY_RS02320"
                     /old_locus_tag="DSY0421"
     CDS             complement(487676..488713)
                     /locus_tag="DSY_RS02320"
                     /old_locus_tag="DSY0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459067.1"
                     /db_xref="GI:499778333"
                     /translation="MKIQSSAIVMAGESKHTESYKKEVTLQSWQNKDAAGKPVLNLEN
                     TDILDLSDSIKDRKSPAANVQQAQEISLEMSEGDKRKLELLQLMLEAITGKKLRFFVP
                     QKLVLNDSNRLPFSPTQAPTQGWGIVFESREQYIEQQSMSFSAQGQVTTADGKTIDLQ
                     LQLNISRSFAYQNNISFRAGDAVTIDPLAINLGVSSAQLTQQKYVFDLDYDGNTELIS
                     FLAPGSGFIALDKNGDGIINDGSELFGTRSGDGFADLALYDSDHNGWIDENDPIYDKL
                     RIWTKNEKGEDVLFALGEQSIGALYLGSAATDFSLKGDRNQSLGEIRRTGIYLNENGT
                     VGTLQHVDLTI"
     gene            488899..489435
                     /locus_tag="DSY_RS02325"
                     /old_locus_tag="DSY0422"
     CDS             488899..489435
                     /locus_tag="DSY_RS02325"
                     /old_locus_tag="DSY0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="WP_011459068.1"
                     /db_xref="GI:499778334"
                     /translation="MSFLELAQKRRSLRSYLPDPVEQEKLEYVLECARLAPSWKNLQC
                     WRFIVVEDADLRQELTTAYAETNPGRKALLQAPLIVVLCGVPAESEVWEGKDYMMLDA
                     GLAMEHLILAAAEQGLGTCWQGLFAEDKVREILKVPENVRVLAMTPLGYPAEERKPRP
                     RKEMSQIVFKGTWGSGNA"
     gene            489484..490212
                     /locus_tag="DSY_RS02330"
                     /old_locus_tag="DSY0423"
     CDS             489484..490212
                     /locus_tag="DSY_RS02330"
                     /old_locus_tag="DSY0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810266.1"
                     /db_xref="GI:492325084"
                     /translation="MPSSLKLGKTIIPYEERKSSRIKRISIRITPEKVRVSAPARTAK
                     GEIQAFIEKNQEWILENWTKLQETMVKPPRVYETGEKVSYLGKELNLEIIDTPHKMIS
                     AFYRKDQETLEIKMPQELQGEQRQEAVREILDKWYKQKARAVFLQKLNLWSRQMGVTY
                     NQFRLKEQKTRWGSCSSLGNINLNWRAVMAPEPVLDYLVIHELSHLIYLNHSAEFWEH
                     VARYCPEHAAHRRWLREKGHSLVI"
     gene            490314..491153
                     /locus_tag="DSY_RS02335"
                     /old_locus_tag="DSY0424"
     CDS             490314..491153
                     /locus_tag="DSY_RS02335"
                     /old_locus_tag="DSY0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="WP_011459069.1"
                     /db_xref="GI:499778335"
                     /translation="MEQGCQLIQTREGTRIYYRQRLPAHPKAVVMICHGYAEHSSFYV
                     QFMEFLAEHGYGAYALDHRGHGHSEAERGHLDRFEVFLEDLDVFVDHVRELHPTQPLF
                     MFGHSMGGLISFNYGILHPGKLQGQIFSGAALARPVGTEYIPTFLFKLLNVVLKRLRI
                     RPKLSGKTTRNMAVRKISDGDSLVLRYATLGFFYQFACRGVAFAQEKAGRYQLPCLIL
                     HGTGDRLVPYQASQRIFAEISSRDKTLKLYEGLYHELIHEPEREEVLADIVDWLERRV
                     KFC"
     gene            491368..492144
                     /locus_tag="DSY_RS02340"
                     /old_locus_tag="DSY0425"
     CDS             491368..492144
                     /locus_tag="DSY_RS02340"
                     /old_locus_tag="DSY0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272204.1"
                     /db_xref="GI:752602817"
                     /translation="MVKRSWGSWLSILAGIIGILDTIVVTGLKGGVNLGTILPAGVGS
                     LFLLWGLWGDKSRNTLFSQRFPGLRKLIRWGIVLLLGSFFIIEGLILWNTEDRIPEQG
                     KVLIILGAGLNGEQLSWTLRERVDKGVGILAENPQMKVVVSGGQGPGEWIPEAEAMAQ
                     YLIGQGIAPERILKEDRSTSTMENFRFSRVLLDQLEGFDPAEPVLVITSDFHMFRSKI
                     LAERNGLNPVGVPCSTPWYIRPNAYLREYFAVVKSILIDR"
     gene            492178..492705
                     /locus_tag="DSY_RS02345"
                     /old_locus_tag="DSY0426"
     CDS             492178..492705
                     /locus_tag="DSY_RS02345"
                     /old_locus_tag="DSY0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459071.1"
                     /db_xref="GI:499778337"
                     /translation="MLRGSHGDEFSLRIVGYEFPDKDNDLGFDSNWLIVEVYCKHGEK
                     TWVKRAPSLLTWEAGILIKWARDILYKQPESEVLEFIEPNLLFQALRGENGKIETLRV
                     TLGHETCPDWVHTLRKPAYFSMDFAINPEDIEAFCQSLEADLLIYPRRLQGIKELASS
                     PRDRLRIVKKDNDRT"
     gene            complement(492711..494831)
                     /locus_tag="DSY_RS02350"
                     /old_locus_tag="DSY0427"
     CDS             complement(492711..494831)
                     /locus_tag="DSY_RS02350"
                     /old_locus_tag="DSY0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_011459072.1"
                     /db_xref="GI:499778338"
                     /translation="MNNSPDPQGKWQAYLSKALAKCRTFKFPAFYKKPKFWRNLAILF
                     LFVLLSGLGAGYYWISTLDVSKLESPLAKPTYIYDQAGNKISQLSSSRIEPVTLEQVP
                     QLTQQAIIATEDKRFYEHQGVDFRSILRALIQDLKTRNFSEGGSTISQQLAKNLFLTS
                     DKTLSRKLKEAGYAIKIEATLSKEEILEAYLNHIYFGEGRWGLQEATRYYFGKNAEEL
                     NLEESALLAGILKGPTIYSPLQDKELALQRRNIVLAMMADQGYITAKEAAQATAAPIA
                     LRTKPLDNLSGKYAPYVDYVIEEAINRYGFTEDQILTLGLQIHTQMDAKVQQAAETVY
                     KDDQFFPQGQSDQKVQSGIAILDQHTGAIRGLVGYRGESAFRQFNHASQLKRQPGSII
                     KPLMVYGPALEKGYRPDALLYDGPLDLDGYAPKDWDGQTRGWVTMEEAIQQSWNIPAV
                     WLFDQIGIDTGKAFVQKAGIPLTEKDAHLSLALGGFAEGVSPLEIAQAYTAFANQGLM
                     HTAHAITKITTADGHVLAQMQPESVQVTEPAHAYTMTLLLQNVVQQGTAPKAALGSRP
                     VAGKTGSVELPPTQEFAGISKGQKDVWFVGYTPELTAAIWMGYDQTDRDHYLTTSGGS
                     GPAVVFHEVLSSALKDTPIKPFEVPAGYVKDWNIWPEGWDDQDEYDQNKDDDKDKKDK
                     KGKKNKKDPKDKNEFWDLFQDLWS"
     gene            495216..496052
                     /locus_tag="DSY_RS02355"
                     /old_locus_tag="DSY0428"
     CDS             495216..496052
                     /locus_tag="DSY_RS02355"
                     /old_locus_tag="DSY0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_011459073.1"
                     /db_xref="GI:499778339"
                     /translation="MKTTKDFWVMKNEGKKIVMITAYDYPSAKQAEQAGADIILVGDS
                     LGNVVLGYDSTVYVTMEDMIHHGKAAKRGAPNTFIVADMPFMSCHLSIRDTLLNGARL
                     IQETGAQAVKVEGADEMIPHIRALVRAGIPVVSHLGLTPQTAAVLGGFKVRGKDGEAA
                     RKMLEDVKECQEAGAFALVLECIPKQLAQEISTNLTIPTIGIGAGVHTDGQVLVYHDI
                     LTYGVNRAPKFVKAYANADQLMLKGLQDYADEVRSMNFPDDEHSFTMKEEELKTLYGG
                     RG"
     gene            complement(496101..496700)
                     /locus_tag="DSY_RS02360"
                     /old_locus_tag="DSY0429"
     CDS             complement(496101..496700)
                     /locus_tag="DSY_RS02360"
                     /old_locus_tag="DSY0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_011459074.1"
                     /db_xref="GI:499778340"
                     /translation="MPLPIVDYKFCPQCGKPLLSVDFSGQHRPHCPDCSFVFWGNFSL
                     GVGGVVWHEGKVLLVQRAHNPGKGNWTIPGGYVEQDEQIAVAITREIREETGIHAKPL
                     SVIALRDRPGEKHDAYIVFLLEYLGGTLQGEPEEVSDLGFFTLEECENLPIAQLSLSV
                     IKASRTLLIPTSPGFLPQTGVKMIGGDQAILYQISKEPE"
     gene            complement(496742..497965)
                     /locus_tag="DSY_RS02365"
                     /old_locus_tag="DSY0430"
     CDS             complement(496742..497965)
                     /locus_tag="DSY_RS02365"
                     /old_locus_tag="DSY0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose ABC transporter permease"
                     /protein_id="WP_011459075.1"
                     /db_xref="GI:499778341"
                     /translation="MNTQYLNKFNIPRPILVLIIGGFIHSVGSSFMWPLNSIFMHNIL
                     GRSLTEAGALISLQALATLVGQFISGVLADRFGSRRVMIYGLIGTILPLILISCFPVW
                     EVYAPGLLFYGFAIAFIFVPINALVFTLWPEGGRRGFNLLYVFNNAGVAVGTALGGFI
                     AALSFKLVFLLNGLFFFIYLLMVLIFLSAKDIQSKPLSKSRVKVPIFKDRGFPVLIAL
                     CAAIFLMWGAYIQINTVLPVTMTNLGYSLPQYSILWTLNGVIIVAFQPVIHWIIRHWA
                     PTLSRQFYVSCLFYAIGFLILLGNFPYPSYFIMMIIITLGEMLVLPGVPAAAALIAPE
                     GKTATYQGVVGGAASGGRALGPILGGLAFDHYGGNMAWALALVFVSIALLPFYLYQRR
                     ERTFTQGTGAKEQAI"
     gene            498217..498801
                     /locus_tag="DSY_RS02370"
                     /old_locus_tag="DSY0431"
     CDS             498217..498801
                     /locus_tag="DSY_RS02370"
                     /old_locus_tag="DSY0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="WP_005810244.1"
                     /db_xref="GI:492325062"
                     /translation="MDFKDSKTFQNLVNGFAGESQARNRYTFYAGVAKNEGHQAIQNI
                     FISTADNEKEHAKVFYKFLQKYAGDQTEVFRVNADYPLNYRDTLANLKSAAAGEGEEV
                     IDYNTFADIADEEGYADIAVAFRKIATVEAHHQERYARLAAELENGTLYKKDQKISWK
                     CENCGYVHEGSGAPDLCPACQHPQGYFKPLPEVY"
     gene            complement(499104..500423)
                     /locus_tag="DSY_RS02375"
                     /old_locus_tag="DSY0432"
     CDS             complement(499104..500423)
                     /locus_tag="DSY_RS02375"
                     /old_locus_tag="DSY0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011459076.1"
                     /db_xref="GI:499778342"
                     /translation="MQPYVKSFRYGWSSWSILVIAFITVFFHRLSVGSVADELTREIP
                     MNSVTLGNLTAMNYYAYALMQIPVGILVDRIGVRKINFCGLLVTAAGSILFGLAHTLE
                     AAYLSRFLVGIGSSVIIVSIFKIQATWFPLSRFSALSGLTSFFGNFGSLLALYPLTFL
                     SLTFGWRNVFYWMAGISLLLALLVLWGVRDARTEIYSPPRETAAAGSTGPTGSVSPLS
                     RKHSQTPEHTSTAVKPLPFLAYLKESLSCVLKNPRTWPNVLILFAFTGSSTTLLGLWG
                     IPLMTQLYSLDKATAAGYVTFATFGFILGAPLISLWVRLLKGIRPALLAGTGLNLLLW
                     IYIVIIAGGRPAAELWPAFFFIFGLLIMTHILAFSNVTAVNPLNYSGMATAITNMAEF
                     IGSSLASLTIGLILDFSGNPSAAWWVILSMAALGFMAALLMKEQPAS"
     gene            500585..501013
                     /locus_tag="DSY_RS02380"
                     /old_locus_tag="DSY0433"
     CDS             500585..501013
                     /locus_tag="DSY_RS02380"
                     /old_locus_tag="DSY0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspA"
                     /protein_id="WP_005810241.1"
                     /db_xref="GI:492325059"
                     /translation="MYKKILVPTDGSEFSVRAFKTAVELAGLFQSEIVLIHVTYTPQA
                     LWGNTVPYGYVFSQEDVAKNGQMALDATMAEVSAEGVPTKTVLEIGHPVIKIIDQIKK
                     DGIDLVVIGSHGYGPITGSVLGSVSQRVLQKSPVPVLLVK"
     gene            501199..501612
                     /locus_tag="DSY_RS02385"
                     /old_locus_tag="DSY0434"
     CDS             501199..501612
                     /locus_tag="DSY_RS02385"
                     /old_locus_tag="DSY0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810236.1"
                     /db_xref="GI:492325054"
                     /translation="MKEKEIRLTSEEIDYLLKGTIHWEDIASRTAGPLRKTVDLGTRE
                     AESGDFLKKPSFKDIEQTKVPDRGPFNSEGQGRNFNHNEKGRESFNFKEDTDEDFAED
                     FLAEDQPFWSGTKVYIILSLTGCITLGTWAYFVFA"
     gene            501839..502309
                     /locus_tag="DSY_RS02390"
                     /old_locus_tag="DSY0435"
     CDS             501839..502309
                     /locus_tag="DSY_RS02390"
                     /old_locus_tag="DSY0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CtsR family transcriptional regulator"
                     /protein_id="WP_005810233.1"
                     /db_xref="GI:492325051"
                     /translation="MGNLADRIEVYLKRILEQSAEGYVILQRGVLAEEFSCAPSQINY
                     VLDTRFSVERGYLVESRRGGGGYLRIVRLGFHDDGDFQTIMKQLIGSQLGESRAFNLL
                     QRLVEDEIITRREEEIIRTVFHRETLGPESPTINGLRAHMMKRILLTLSREDLH"
     gene            502326..502823
                     /locus_tag="DSY_RS02395"
                     /old_locus_tag="DSY0436"
     CDS             502326..502823
                     /locus_tag="DSY_RS02395"
                     /old_locus_tag="DSY0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UvrB/UvrC protein"
                     /protein_id="WP_015942740.1"
                     /db_xref="GI:506423021"
                     /translation="MLCQHCQQREANVQFTKIVNGEMVKLYLCDHCAKNAPEVSFVFS
                     PGIIPDFLQSLFNFTTNAQALKEEACPQCGRRLSEITQAGKLGCSGCYDKFQSELEPI
                     LRKIHGGGCHVGKIPARKGADLREKAEIEKLKEKLQQLIRKEEFEAAAVVRDQIRELE
                     QKLGG"
     gene            502828..503880
                     /locus_tag="DSY_RS02400"
                     /old_locus_tag="DSY0437"
     CDS             502828..503880
                     /locus_tag="DSY_RS02400"
                     /old_locus_tag="DSY0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:guanido phosphotransferase"
                     /protein_id="WP_005810224.1"
                     /db_xref="GI:492325042"
                     /translation="MERKEHLLKNSEWMRENPDTPVVLSSRIRLARNLEGVPFPLGLS
                     QEASQDIEQKVSAELESLTIDQDKLTYYSMKDLTPIEQYVLIEKHLISPALVNSRGAR
                     GVAINSDHRVSVMVNEEDHLRIQVLLPGDQLKEAYLLSNTMDDQLEERLDFAYREAQG
                     YLTACPTNVGTGMRASVMVHMPALVMTNRVQQLLGALNHLGLAVRGLYGEGSQAFGHI
                     YQVSNQITLGKSEEDTITHLEAVTRQIIEQEVHAREGLVREAPLVLQDKVWRARGTLE
                     KARLLNSEDALQCLSLDRLGVDMGILPPRQQSFSTLLVETLPASLQYGLERELSPEQR
                     DEERASYMRKAMAEVK"
     gene            503918..506398
                     /locus_tag="DSY_RS02405"
                     /old_locus_tag="DSY0438"
     CDS             503918..506398
                     /locus_tag="DSY_RS02405"
                     /old_locus_tag="DSY0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding protein"
                     /protein_id="WP_005810223.1"
                     /db_xref="GI:492325041"
                     /translation="MNEKYTEKALKALQFASDEAKRMGSNVIGTEHLLLGLVAEGEGI
                     AAKSLHGIGVTPEKIREQIGNLTGIGQPFTGEVSLTPRVKRVMELAHEEARRHGVSYI
                     GTEHLLLGLLMEGEGVAARVLRNLGVSPERIWKQVVQLLGGQPDDIPMPGGAPGPGTA
                     KNNGAANTPALNEFGRDLTQQAREGRLDPVVGREDEIERVVQVLSRRTKNNPVLIGEP
                     GVGKTAIAEGLAQRIINNKVPETLAGKRVVTLDLSAVVAGSKYRGEFEERLKKVMEEI
                     RVDGRIIVFIDELHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKYIEK
                     DPALERRFQPITVGEPTVEQAVQILLGLRDRYEAHHRTQITDEAVEAAVKMSDRYISD
                     RFLPDKAIDLMDEAASRVRLAAFTAPPDLKSLEEKIEALKSEKEAAVLGQEFEKAAKF
                     RDEEHQLREELAQLRNTWESKRDISQSQVTADDIAQIVASWTGIPVKKLAQEESERLL
                     GLEETLHQRVVGQEDAVKAVSRAVRRARAGLKDPKRPVGSFIFLGPTGVGKTELARAL
                     AEALFGEEDALIRIDMSEYMEKHAVSRLVGAPPGYIGHDEGGQLTEAIRRKPYSVILL
                     DEIEKAHPEVFNILLQVLEDGRLTDTKGRTVDFRNAVIIMTSNVGASFMKKEALGFAS
                     RRDEETEYKNMSSRVMEELKKTFRPEFLNRVDEIVVFHSLQTEGLLKITEILMKQVNG
                     RLQEQGYDLQVEKSALELIAKEGNDPTFGARPLRRAIQRLIEDSLSEKILLGEFKSGD
                     KIKVEAVEDKMKFAKVRARKSKKAEAAE"
     gene            506651..508000
                     /locus_tag="DSY_RS02410"
                     /old_locus_tag="DSY0439"
     CDS             506651..508000
                     /locus_tag="DSY_RS02410"
                     /old_locus_tag="DSY0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_011459079.1"
                     /db_xref="GI:499778345"
                     /translation="MAKVKTRFFCQSCGQESPRWLGKCPGCGEWNTLVEEVVERAAAK
                     RTPLGVKATPLTEIQIREEERVSSGSQELNRVLGGGIVPGSFVLLGGEPGIGKSTLLL
                     QTAGLLAKGMDVLYISGEESEKQIKLRAERLGIKESRLHILTETRLEVVRDVALAMGP
                     GLLIVDSIQTMVLEELQAAAGSVSQVREGAAFLMRLAKEEEIPIFLVGHVTKEGAIAG
                     PRVLEHIVDTVLYFEGDRHHVYRLLRAVKNRFGSTNEIGVFEMHEDGLVEVPNPSKVF
                     LGENSATAPGSSVAVIVEGSRPLLVEIQALVTPTTYGPPRRTATGIDYNRILMLLAVL
                     DKKVGLHLGAQDVFINIAGGIRIDEPGVDLACIAAIASSLGERPLKRYALIGEVGLTG
                     EVRGISQIENRVKEAVKLGFEGCIIPRINVSAVKVPGNFTVIAVKTVEEAVQVMFEQ"
     gene            complement(508136..508528)
                     /locus_tag="DSY_RS02415"
                     /old_locus_tag="DSY0440"
     CDS             complement(508136..508528)
                     /locus_tag="DSY_RS02415"
                     /old_locus_tag="DSY0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810220.1"
                     /db_xref="GI:492325038"
                     /translation="MENLTDRYQILVESLLIRHQSVLDILTKGQEASARVNRAVVKTV
                     TDCGCLSIDARKKPIPEEASFSDLKSLLDSQLDGELCESCKDIIETELGKQLFYIAAL
                     ANTLGISLDDVIQKEETRLSTLTIFNLT"
     gene            508730..509206
                     /locus_tag="DSY_RS02420"
                     /old_locus_tag="DSY0441"
     CDS             508730..509206
                     /locus_tag="DSY_RS02420"
                     /old_locus_tag="DSY0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CarD family transcriptional regulator"
                     /protein_id="WP_005810219.1"
                     /db_xref="GI:492325037"
                     /translation="MFDIGDRVVYPMHGAGIIEAIEEREVLGESHQYYVMNIPVGNMK
                     VYIPLKNVNQLGIRGVISSEEVPQVLKILENESTLPALAWNRRYRANMDRIKSGDIYS
                     VAEVVRSLSQRDREKGLSTGEKKMYDNAYQILVSELILAEGVQADEMSERIKGLLA"
     gene            509288..510454
                     /locus_tag="DSY_RS02425"
                     /old_locus_tag="DSY0442"
     CDS             509288..510454
                     /locus_tag="DSY_RS02425"
                     /old_locus_tag="DSY0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_015942743.1"
                     /db_xref="GI:506423024"
                     /translation="MIRNIVRVIITVLAGAIGFYLNVVLMRLDVLQSLGWQISPIWAF
                     VAMVAIFAILGFLIAPASMRGFLKMISWFDARMTKVPTHDLIGGAVGVIIGLIIASLL
                     SSALRGIPIIGSVISIILSVSLGYLGLIIGVKRKEEVLGFFTFLPKFKGDKGEKGKGK
                     DGNRQSLGAALPNYKILDTSVIIDGRIADIVQTGFLEGTLLIPGFVLEELQHIADSSD
                     LLKRNRGRRGLDILNQISKEELANNVEIMEIDFEDISEVDSKLVRLGQNLGAPILTND
                     YNLNKVAELQGVKVLNINELANAVKPIVLPGEEMEVQVMKEGKEPGQGVAYLDDGTMI
                     VVDTGRRYMGQTITVLVTSVLQTAAGRMIFAKPKALVEKKSIGLSGTNEVNALG"
     gene            510447..511175
                     /locus_tag="DSY_RS02430"
                     /old_locus_tag="DSY0443"
     CDS             510447..511175
                     /locus_tag="DSY_RS02430"
                     /old_locus_tag="DSY0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="WP_015942744.1"
                     /db_xref="GI:506423025"
                     /translation="MVKLGVIIPAAGQGKRMGASVNKQFLPLQGRPLLAHTLSLFERS
                     GAVAEIVIVSAKEDRERIAELVRTEGFQKVSAIVLGGEERQESVFAGVKALSSLIQRV
                     AVHDGARPLLTCLELNRFFTEAEKFGAAIMAVPVKDTIKRVDAQGKVLETPPRETLRA
                     VQTPQVFARSLLEEAHHKAREAGYLTTDDAALIEWLGHPVQTLMGSLENIKITTPEDL
                     DLAEAILAKRMNQVNHGDRSLDSL"
     gene            511265..511741
                     /locus_tag="DSY_RS02435"
                     /old_locus_tag="DSY0444"
     CDS             511265..511741
                     /locus_tag="DSY_RS02435"
                     /old_locus_tag="DSY0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250Q9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_011459082.1"
                     /db_xref="GI:499778348"
                     /translation="MLRVGIGYDVHALVAGRPLILAGIDIPHEKGLLGHSDADVLTHT
                     LMDALLGALALGDLGKHFPDTDERYRGISSMKLLEQVMKLLEERGYAIGNIDCIIAAQ
                     RPKLAPYIPQMRENLARALKTDLENVSVKATTTERLGFEGREEGISSQAIVCLVKV"
     gene            511772..513238
                     /locus_tag="DSY_RS02440"
                     /old_locus_tag="DSY0445"
     CDS             511772..513238
                     /locus_tag="DSY_RS02440"
                     /old_locus_tag="DSY0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250Q8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="WP_005810213.1"
                     /db_xref="GI:492325031"
                     /translation="MLKVRFAPSPTGPLHIGGARSALFNYLLARKEDGVFIVRSEDTD
                     LERSSRESEHNIMEALRWLNIQWDEGIEVGGDNGPYRQTERLALYQEYTDRLLASGDA
                     YYCYCSEEELEQERQDLMAKGETPRYLGKCRHLSAAERQTYEAAGRKPVVRFRVPEGR
                     QILINDRVRGEVVFDSDGIGDYVIVKSDGIPTYNFAVVIDDTTMNITHVIRGEEHLSN
                     TPRQVLIYQALGLPTPEFAHISLILNTEGKKMSKRDGDTAVIDYQAKGYLPEAVVNFI
                     ALMGWSPPGEEEFFTLEEMTQAFSLERVSKSPAVFDLNKLNYMNAHYIKQADPERLTD
                     LAVPYLREMGAIPQGTLSEEERAWVTHYVQAIINHLSYMAQVKDFVHYVQGGEAPTPE
                     GEALEILQGEQVPAVLDLFVEKLKSLEAIRVDTVKPLFKQITKETKLGGKQVFMPIRI
                     ALTGQMHGPELYDIVPLLGLENVLSRLAGTKALLAGSR"
     misc_feature    513433..513638
                     /note="T-box leader; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            513717..514388
                     /locus_tag="DSY_RS02445"
                     /old_locus_tag="DSY0446"
     CDS             513717..514388
                     /locus_tag="DSY_RS02445"
                     /old_locus_tag="DSY0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="WP_011459083.1"
                     /db_xref="GI:499778349"
                     /translation="MVFGQIKQDIKVIFERDPAAKTIVEVILCYPGLHALIAHRLAHC
                     LYKKNMVLIPRLISQTSRFFTGIEIHPGAKIGQGLFIDHGMGVVIGETAEVGDNVTIY
                     QGVTLGGTGKEKGKRHPTVGNNVFIGSGAKILGSIKIGDNVKIGAGSVVTKPVPSNTT
                     VVGVPGKVVSRHGMPLKELHVVTKSVCNKEIRAEEMPDPVQETLQILMERINYLEKKL
                     GEKES"
     gene            514394..515827
                     /locus_tag="DSY_RS02450"
                     /old_locus_tag="DSY0447"
     CDS             514394..515827
                     /locus_tag="DSY_RS02450"
                     /old_locus_tag="DSY0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250Q6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine--tRNA ligase"
                     /protein_id="WP_011459084.1"
                     /db_xref="GI:499778350"
                     /translation="MALRLFNTMSHQKEEFKPREEGKVGMYTCGPTVYNYFHVGNGRM
                     LVVFDMIRRYLLYKGYDVTFVQNFTDIDDKIIKRGQEEGRDPLELAQDYIGEYFKDAA
                     ALNLMPASIHPKATDHIPEMIEIIKGLEEQGLAYAVDGDVYFAVDKLPAYGKLSGRTL
                     EDMQAGARVEVGERKQNPMDFALWKNAKPGEPFWESPWGKGRPGWHIECSAMSLKYLG
                     SGFDIHGGGGDLVFPHHENEIAQAEGYLHGETFARYWMHNAFLTINQQKMSKSLGNFF
                     TVREILEHFPGEVIRFYLLGTHYRSPLDFDDENLQMAQKGLERLQTSIRLADEALGRQ
                     GQNSADAASGQKLRAAAEEARREFAEAMDDDFNSALAYASLFELGKAINAHVQAYPYS
                     SEGLLKARATLWELADVLGFDLAKPANQAEAGNQKLDQVMELLLEVRAIARKKKDWEM
                     SDLIRDRLKDLGIVLEDTPQGARWTLK"
     gene            515858..516331
                     /locus_tag="DSY_RS02455"
                     /old_locus_tag="DSY0448"
     CDS             515858..516331
                     /locus_tag="DSY_RS02455"
                     /old_locus_tag="DSY0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250Q5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mini-ribonuclease 3"
                     /protein_id="WP_011459085.1"
                     /db_xref="GI:499778351"
                     /translation="MPRSWQEMNALTLAYLGDVVYELWVRTHLLNNGYEKVNELHRLA
                     TQYVRAGTQAKLLHHILPHLDEQELSVVHRGRNAKGGHPKSTDVVTYRYATGFEALVG
                     YWQLTGRTERMLWAFEQVDQFVGEEDEGKGKGETAKEEESITDALSPAEQSEIDC"
     gene            516363..517067
                     /locus_tag="DSY_RS02460"
                     /old_locus_tag="DSY0449"
     CDS             516363..517067
                     /locus_tag="DSY_RS02460"
                     /old_locus_tag="DSY0449"
                     /EC_number="2.1.1.148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent thymidylate synthase"
                     /protein_id="WP_011459086.1"
                     /db_xref="GI:499778352"
                     /translation="MNVELIQYTPDPEKVIAAAARLCYSPDPVPELMEKLDEEKVANL
                     VQKLRAMGHLSTFEHISFQFSIDGVSRALSHQLVRHRIASYSQRSQRYVKEEGFDFVT
                     PPTIRRNPQTQERFENIMATLQEEYQALLAMVPAEDARYILPNACTTSLMATFNARSL
                     LNFFEHRTCMRAQWEIRILAEKMLELVREVAPNVFGQAGPTCVTQGVCHEGAMSCGRI
                     KALKKEAERMTLIYDR"
     gene            517057..517797
                     /locus_tag="DSY_RS02465"
                     /old_locus_tag="DSY0450"
     CDS             517057..517797
                     /locus_tag="DSY_RS02465"
                     /old_locus_tag="DSY0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_011459087.1"
                     /db_xref="GI:499778353"
                     /translation="MTDEIVYGRNAVWELLQSGKPVNKLLLQGEGTAGRFQDIVSHAR
                     AQKIPFQFVDKAALDRLTEKAKHQGILAYVAPREYAEVDDILALAGEKGEDPFILVLD
                     EVEDPHNLGALIRTADAAGVHGVIIPKRRSVSLTATVAKTSAGAVEHVLVARVGNLVQ
                     TLKDLQKAGCWVSGAEAEGTEVYRSDLTGARVIVIGSEGKGLSRLVKETCDEIVSLPM
                     KGRINSLNASVAGSILMYEVLRQRGSRN"
     gene            518059..518712
                     /locus_tag="DSY_RS02470"
                     /old_locus_tag="DSY0451"
     CDS             518059..518712
                     /locus_tag="DSY_RS02470"
                     /old_locus_tag="DSY0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792370.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma70 factor"
                     /protein_id="WP_015942746.1"
                     /db_xref="GI:506423027"
                     /translation="MTLNAQLEALEECDTNEVIVDEEVVELAKNGDAEAQEYLINKYK
                     NFVRAKARSYFLIGADREDIIQEGMIGLYKAIRDFRGDKLSSFRAFAELCITRQIITA
                     IKTATRQKHIPLNSYVSLNKPIYDEDSDRTLLDVISGTRITDPEELIISQEEFDDIEE
                     KMGEILSSLEWKVLMAYLEGKSYQEIAVDLHRHVKSIDNALQRVKRKLERYLERRDG"
     gene            518902..518985
                     /locus_tag="DSY_RS02475"
                     /old_locus_tag="DSY_tRNA14-Tyr"
     tRNA            518902..518985
                     /locus_tag="DSY_RS02475"
                     /old_locus_tag="DSY_tRNA14-Tyr"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:518936..518938,aa:Tyr,seq:gta)
     gene            518994..519068
                     /locus_tag="DSY_RS02480"
                     /old_locus_tag="DSY_tRNA15-Met"
     tRNA            518994..519068
                     /locus_tag="DSY_RS02480"
                     /old_locus_tag="DSY_tRNA15-Met"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:519026..519028,aa:Met,seq:cat)
     gene            519231..519380
                     /gene="rpmG"
                     /locus_tag="DSY_RS02485"
                     /old_locus_tag="DSY0452"
     CDS             519231..519380
                     /gene="rpmG"
                     /locus_tag="DSY_RS02485"
                     /old_locus_tag="DSY0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015260970.1"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group have the CXXC motif; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_005810204.1"
                     /db_xref="GI:492325022"
                     /translation="MRVGITLACTECKNRNYASIKNKKNNPDRLEVKKYCKFCKSHTA
                     HKETK"
     gene            519490..519708
                     /locus_tag="DSY_RS02490"
                     /old_locus_tag="DSY0453"
     CDS             519490..519708
                     /locus_tag="DSY_RS02490"
                     /old_locus_tag="DSY0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_005810200.1"
                     /db_xref="GI:492325018"
                     /translation="MGAVKKQTNAPAKEKSTEYFKGVWSELKKVHWPDRKQLLTYTGV
                     VLTAVAIVAVMLWVVDSGLSILMTKILG"
     gene            519783..520310
                     /locus_tag="DSY_RS02495"
                     /old_locus_tag="DSY0454"
     CDS             519783..520310
                     /locus_tag="DSY_RS02495"
                     /old_locus_tag="DSY0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_005810198.1"
                     /db_xref="GI:492325016"
                     /translation="MTKNWYVIHTYSGYENKVKTNLEKRVESMNMEDKIFRVLVPMED
                     EIEIKNGKKKIAKRKVFPGYVLVEMDMTDDSWYVVRNTPGVTGFVGTGAKPIPLLDHE
                     VQAILKQMGVEEVRTRVDYTVGQNVRVISGPFKDFIASVREILEDKGKLRVSVSMFGR
                     ETPVELDFAQVEKVD"
     gene            520358..520786
                     /locus_tag="DSY_RS02500"
                     /old_locus_tag="DSY0455"
     CDS             520358..520786
                     /locus_tag="DSY_RS02500"
                     /old_locus_tag="DSY0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_005810197.1"
                     /db_xref="GI:492325015"
                     /translation="MAKKVVGLVKLAINAGKANPAPPVGPALGQHGVNIMAFCKEYNE
                     RTKDQAGLIIPVEITVYEDRSFTFITKTPPASILLKKAANINSGSSEPNRKKVAQVSK
                     TKVREIAETKMKDLNAASVEAAMSMVEGTARSMGITIVEG"
     gene            520836..521528
                     /locus_tag="DSY_RS02505"
                     /old_locus_tag="DSY0456"
     CDS             520836..521528
                     /locus_tag="DSY_RS02505"
                     /old_locus_tag="DSY0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_005810196.1"
                     /db_xref="GI:492325014"
                     /translation="MAKVGKNYQEAVKAFDRAALHEPMEALAVVKKIAKAKFDETVEV
                     AFKLGIDTRHADQQIRGALVLPHGTGKTRSVLVFAKGDKAKEAEAAGADFVGAEDMIA
                     KIEQGWFGFDVVVATPDMMGMVGKLGRVLGPKGLMPNPKTGTVTFDVAKAVKEIKAGK
                     IEYRADKAGIIHAPIGKVSFSEEQLYQNYKVLVETLVKAKPAAAKGQYIRSVTVSSTM
                     GPGVRINPVKAN"
     misc_feature    521594..521729
                     /note="L10 leader; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            521757..522281
                     /locus_tag="DSY_RS02510"
                     /old_locus_tag="DSY0457"
     CDS             521757..522281
                     /locus_tag="DSY_RS02510"
                     /old_locus_tag="DSY0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_005810195.1"
                     /db_xref="GI:492325013"
                     /translation="MPNIEEKAQVVAEIKERFQNSTGVVLADYRGLTVAQVTQLRAQL
                     RQAGVEYHVLKNTMVRRAAHEVGIEGLDGYLEGPTAVAFSADPVAGAKVLADFAKTSK
                     TFAIKAGVVEGKVVDEAGVKALAELPSREVLLAQVLRGMQAPLVGMANVLQGPIRKMG
                     YALEEVRKLKEAQA"
     gene            522440..522814
                     /gene="rplL"
                     /locus_tag="DSY_RS02515"
                     /old_locus_tag="DSY0458"
     CDS             522440..522814
                     /gene="rplL"
                     /locus_tag="DSY_RS02515"
                     /old_locus_tag="DSY0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015260976.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_011459089.1"
                     /db_xref="GI:499778355"
                     /translation="MSKTAEILEAVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAP
                     GAAAAPVAEEQTEFDVVLMNAGAGKINVIKVVREITGLGLKEAKELVDGAPKPVKEKV
                     SKDDAEAIKAKLVEAGATVEVK"
     gene            complement(522890..524020)
                     /locus_tag="DSY_RS02520"
                     /old_locus_tag="DSY0459"
     CDS             complement(522890..524020)
                     /locus_tag="DSY_RS02520"
                     /old_locus_tag="DSY0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_011459090.1"
                     /db_xref="GI:499778356"
                     /translation="MLRAIIVDNEEPATQILQMLLEKTGQIRVVGTFLRAADALSSLR
                     LTKPDVAFLDIEIPDTSGLELANHILAMDSDVEIIFVTAYDHYALHAFRVNALDYLLK
                     PLLPEDVERAVRRLIKRKGLAKDSAPESPLGANIHYFGKFSVYGPASKKPVKWRTSKA
                     EELFAYLVQNLEKEVPKWRICEALWPEYHSEKVDIQLHTTVYKLKKVLTAANIPFDLS
                     FSNGCYWLSLPQAAIDKVEFDAHIASSVPVNQNTIARCEHALSLYTGDYLEENGYLWS
                     LALKAEYGQKFYKLASSVVNFYMTQGDWVRAEKILRSILERCPLDETVHEMLLTCYFT
                     QKDRTAFITHYHTVRKLFQAELGLEPGKSIQTLYHSLLKRMD"
     gene            complement(524080..527136)
                     /locus_tag="DSY_RS02525"
                     /old_locus_tag="DSY0460"
     CDS             complement(524080..527136)
                     /locus_tag="DSY_RS02525"
                     /old_locus_tag="DSY0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_011459091.1"
                     /db_xref="GI:499778357"
                     /translation="MNNTNMQKSFFVIMLLIMAASLAVPLFRLSLSDIPKAVKGTLDL
                     RDYNGVRDKTVKLSGEWEFYFGQLLTPEDFKNQEPSGKTIQNVPASWGSYQIEGEHLP
                     PQGSATYRLRILLPAEGGNFGIKITCISASARIFADDQLILECGSPGNSPETTVHKYY
                     ADTGYFQTDDGEVEILVQAADFSYVNSGILYEIHFGDQKSIAALRMYDSFLDISLISG
                     MSFLALYFFGLGLQRKKSAEILFFALYCLVSSLQASVRSEALLNYALPALSYNTSLKI
                     LIISYTLCLYALIKFLYHAQEGGSSRRANLIIDGITLFFILLDWFTDFYLWGYIYTVA
                     LVGQIYVLFLLIALLAKNTKGGSEGRYYLFSAVVSSLIHLLTILANFILLWESNLFLP
                     VFQPIFVLSLALYMSEKYENSFKTIEKLSDRLVVLDKLKDDFLAKTSHELKTPLNGII
                     NISQSLLDGAGGSLSRAQAEDIRLITSIGKRLSTLVYDILDYSKLKVMDIQLHIVCLD
                     VHQVAESTVDIFRYLIKGRPITLENKIPPNQHLIWADENRLKQIFSNLLDNSLKYTEL
                     GSISLSCRQDGGFLWIQVSDTGIGIPADKLKDIFAPYEQLGEQSANQRGIGLGLTITQ
                     QLIELHGGQIVARSEPGQGTSFTFSIPLAKDNKPQRSLPGDYVGYDGSESLATEALPQ
                     TVHVGGEFSILVVDDEFSNLKALMNILTLNQYNVTVAINGEAALHLLKGAFHYDLCIL
                     DVMMPGISGYEVCRKIRETYSPLELPILLLTAKALPEDMEAGFRAGANDFIEKPFEVR
                     ELKCRVSTLVQLKNSMDLLLKKETAFLQAQIRPHFLFNALNTIYSFCYTNPGKAGELL
                     AELGVFLRSSFDFSSTASLVTVEKELRLVKAYVAIEEARFGSQLEVEYAVEPSVLNFS
                     ILPLMIQPIVENSIRHGLLKRSQGGKVSLSLTHSEDCIQVEVIDNGVGIPASVLKDLI
                     HAKSETRGVGLTNISRRLLRFYGTTLTIFSVEDHGTTVSFRIPAKT"
     gene            527341..529344
                     /locus_tag="DSY_RS02530"
                     /old_locus_tag="DSY0461"
     CDS             527341..529344
                     /locus_tag="DSY_RS02530"
                     /old_locus_tag="DSY0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011459092.1"
                     /db_xref="GI:499778358"
                     /translation="MKIHSLSGKISVLMAGCVAVFTIAVYFIISLTVESVINQNIEDE
                     VRAKALVLSEELQNRQQRALNATELLTGSPGLLEAIRTGNRQGALAIGQQALKTLELD
                     FLVVTDQEGKVFVRTHEPEKYGDSIIDQVNIQKALQGEASVGIEEGTSINYSIRAGAP
                     LQDEEGRIYGAVSLGYALSENDYVDAQKKIFNCDVTVFLGDERIATTIMSKNGTRLVG
                     TKMEDQRIIDTVLKQGKAYYGSTTINGSKYFVGYTPLADVTGKVSGMLFLGQSYNMAA
                     MLSQKLIMNQAVFMAVLGVFMGFCVVFMFRIMILRKIKAITAMLKDIAEGEGDLTKRV
                     AVSAQDEIGEMSDYFNLFIENIHEVVKGIIAETNKVNTAILASHRNIGVLTGELENAA
                     ATVQELSAGMEETASSTEEITATSTEIASAVEVVAIKAQEGALSAHEISSKAVSLKDN
                     AFELQAEADQTRSAIKQTMDAALAKTTEVAKIKSLSEVILQIAVQTNLLALNAAIESA
                     RAGEAGKGFSVVSEEIRKLAENSQNTVKEIQDTLGVIFEVVENLADTSRQMLVYIDTK
                     VVENYKESVLVGENYDHDAQTIDGWAGELSATSQELLASIKTVADGIAEIARATESGS
                     ERTAHVAAQVAMLKDKANEIKTETDSVKDSADNLQALVRKFKI"
     gene            529416..530609
                     /locus_tag="DSY_RS02535"
                     /old_locus_tag="DSY0462"
     CDS             529416..530609
                     /locus_tag="DSY_RS02535"
                     /old_locus_tag="DSY0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810182.1"
                     /db_xref="GI:492325000"
                     /translation="MDAFLARQPIFDRGLKIYGYELLYRQSRDNFFSGIDDDQATAEL
                     IYNTFLVMGLQDLTDGSNAFINFSKKLIDSDIPFLLPKENIVVEILERDQVTPATVEA
                     CKKMKAMGYKLALDDFVADQNNLPLIEMADIIKIEFPAVSKNEQSSLMKRCGKNVKFL
                     AEKIETREEFRQAAAMGYDLFQGYFFSKPAIIQSKEVVTLNVNLFSVLEELNSAEPSY
                     GVMANIIKSDLGLSYKLLKLANSVYMGSKNKIQSIPHALSFIGIKEMHQWIALMLLKD
                     MQNVENAELIKQSLIRGKFMELLASELYPQSESSGFFFTGIFSAIDVLLNSPMEQVLK
                     GLPLSIQVKQALLGAENEQRQLLNFVTAWEKGHWEKAADRYTMSRKFMELYFEALKWT
                     QKLNY"
     gene            531107..534454
                     /locus_tag="DSY_RS02540"
                     /old_locus_tag="DSY0463"
     CDS             531107..534454
                     /locus_tag="DSY_RS02540"
                     /old_locus_tag="DSY0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_041272205.1"
                     /db_xref="GI:752602818"
                     /translation="MFYPVKVGTRERWSYSRIREVLDMPNLIEIQQNSYQWFLDEGLR
                     EMFRDISPIQDFTGNLVLEFIDYSLGEPKYEVEECKERDVTYAAPLRVKVRLINKETG
                     EVKEQEVFMGDFPLMTTKGTFIINGAERVIVSQLVRSPGVYYSESIDPSGKKVFGATV
                     IPNRGAWLEFETDVNDNIFVRVDRTRKLPATVLIRALGYATNGQIAELFDDNEHIRIT
                     LERDNTESAEEALVEIYKRLRPGEPPTVDSARSLLEALFFDPKRYDLAKVGRYKLNKK
                     LNLSVPTDVHHLTKEDIVASLRQMLTLMSGEGHKDDIDHLGNRRLRSVGELLQNQFRI
                     GLSRMERVVRERMTIQDVDVITPQVLINIRPVVAAIKEFFGSSQLSQFMDQTNPLAEL
                     THKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTYGRIN
                     PYGFIEAPYRKVNNGQVTDQIDYLTADEEEKFVVAQANAPLTDDGHFIEEKIDGRHGP
                     DFVLVAPERIDYMDVSPKQMVSIATALIPFLEHDDANRALMGANMQRQAVPLLRTDAP
                     YVGTGMEYKAAKDSGVCVLASKDGTVERATAEDIIIRHDDGTLEKHKLLKYLRSNQGT
                     CINQRPIVMKNERVEAGQIIADGPSTDHGELALGRNVLIAFMTWEGYNYEDAILISEK
                     LVKEDYYTSIHIEEYEADARDTKLGPEEITRDIPNVGEDVLKDLDERGIIRIGAEVST
                     GDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGEAGKIVDVKVFTRE
                     NGDELAPGVNELVRVYIAQKRKISVGDKMAGRHGNKGVISRIMKQEDMPFLPDGTPVE
                     IVLNPLGVPSRMNIGQVMETHLGWAAKALGLRLATPVFDGAQEEDVFATLRKAGLPET
                     GKTVLYDGRTGDPFDNKITVGYMYFLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQF
                     GGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIVKGENIPEPGVPESF
                     KVLIKELQSLGLDVRVLSENDEEIEIREIDEDVTETAKELGIDLHEDLPAPVIHEAGE
                     GEDDEYFEEDEEAVDDEPMTFDDDDME"
     gene            534479..537946
                     /locus_tag="DSY_RS02545"
                     /old_locus_tag="DSY0464"
     CDS             534479..537946
                     /locus_tag="DSY_RS02545"
                     /old_locus_tag="DSY0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_041272206.1"
                     /db_xref="GI:752602819"
                     /translation="MLDVNNFDRMRIGLASPTMIREWSHGEVRKPETINYRTLKPERE
                     GLFCEKIFGPTRDWECHCGKYKRVRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVS
                     HIWYFKGIPSRMGLLLDMSPRSLEKVLYFVSYIVTDAGDTSLMKKQLLTETEYREYRD
                     KYGSRFKASMGAEAIKMLLEEMDLDKLNDELRVELKEVSGQRKIRAIRRLEVVEAFKE
                     SGNRPEWMIMDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGA
                     PDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGK
                     RVDYSGRSVIVVGPNLRLHQCGLPKEMALELFKPFVMKKLVKEGHAHNIKSAKRMVER
                     VRSEVWDVLEEVITEHPVLLNRAPTLHRLGIQAFEPVLVEGRALQIHPLVCTAYNADF
                     DGDQMAVHVPLSAEAQAEARLLMLSAHNILNPKDGRPVASPTQDMVLGSYYLTMERPG
                     ALGEGKIFKNRDEAVLAYDTKQANLQAMIKVRQPNGELLETTIGRLIFNSVIPPEVGY
                     INEVAGKKALNNIVAKCYRLGGYKATAQLLDGIKSLGFKYSTRAGMTVGLADITVPEE
                     KRQILADADGMVNKTEQQFRRGLITDEERYEKVIDIWTKATDTVTKALMHSLDKFNPV
                     YMMATSGARGNIQQLRQLAGMRGLMADPSGRTIELPIKANFREGLTVLEYFISSHGAR
                     KGLADTALRTADSGYLTRRLVDVSQDVIVRDEDCGTTQGIMVDDVKDGPEVIEKLEER
                     LVGRFLLEDLKHPETGEILATADNEITEEQAHDIAEVYDKVTIRSVLTCKTRYGVCRK
                     CYGRNLATGHHVEMGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVEEL
                     FEARKPKGQAIISENDGVVAIREVKGRREVDVISDTEERMTYTIPYGSRLKVREGHRI
                     EAGDELTEGSINPHDMLKVKGIRGVQVYLLGEVQRVYRLQGVDINDKHIEVMVRQMLR
                     KVKVEEAGDTTLLPGGLIDVFDFEEENTKVIAAGGEPAVARPVLLGITKASLATDSFL
                     SAASFQETTRVLTEAAIKGKVDPLLGLKENVIIGKLIPAGTGMSRYRNVKVINLDEEQ
                     VENLDSVNP"
     gene            538040..538291
                     /locus_tag="DSY_RS02550"
                     /old_locus_tag="DSY0465"
     CDS             538040..538291
                     /locus_tag="DSY_RS02550"
                     /old_locus_tag="DSY0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7ae"
                     /protein_id="WP_011459096.1"
                     /db_xref="GI:499778362"
                     /translation="MLDEALKKSKNRTVGVKQTLRALEKESLICVYVAKDAESHVLRP
                     ILEQCRNKRIQVQEVQTMLELGKACGIEVGAAVAALLSE"
     gene            538392..538814
                     /locus_tag="DSY_RS02555"
                     /old_locus_tag="DSY0466"
     CDS             538392..538814
                     /locus_tag="DSY_RS02555"
                     /old_locus_tag="DSY0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_011459097.1"
                     /db_xref="GI:499778363"
                     /translation="MPTINQLIRNGRSKIAKKSTAPAMQWGYNSLQRKQFASGGSPQK
                     RGVCTRVYTTTPKKPNSALRKVARVRLTNTIEVSSYIPGIGHNLQEHSVVLVRGGRVK
                     DLPGVRYHIVRGALDTQGVQKRMQARSKYGAKRPKKGK"
     gene            538866..539336
                     /locus_tag="DSY_RS02560"
                     /old_locus_tag="DSY0467"
     CDS             538866..539336
                     /locus_tag="DSY_RS02560"
                     /old_locus_tag="DSY0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015260981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_005810168.1"
                     /db_xref="GI:492324986"
                     /translation="MPRKGYIAKREILPDPIYKNRVLTKFINQIMLDGKKGTAESICY
                     NAFELIQEKTGKDPIEVFETALKNVMPVLEVKARRVGGANYQVPIEVRADRRQTLGLR
                     WLVGYARKRSEKTMEERIAGELMDAANNTGGSIKKKEDTHKMAEANKAFAHYRW"
     gene            539405..541483
                     /gene="fusA"
                     /locus_tag="DSY_RS02565"
                     /old_locus_tag="DSY0468"
     CDS             539405..541483
                     /gene="fusA"
                     /locus_tag="DSY_RS02565"
                     /old_locus_tag="DSY0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250N5.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011459098.1"
                     /db_xref="GI:499778364"
                     /translation="MARQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVH
                     DGAATMDWMVQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGA
                     VAVFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRMGADFFRGVSMIADRLGANPV
                     PIQIPIGAEDQFKGIIDLVTMKAMVYTDDLGTTSDTADIPGDLVDQANEYREKLLEAV
                     ADTDEELMMKYLEGEELTEEEIRNGIRKGTIGLKFIPVVCGSSFKNKGVQPLLDAVVE
                     YMPAPTDVPNIKGVHPETGEADERHSSDKDPFSALAFKIMADPYVGKLAFFRVYSGVL
                     SSGSYVYNSTKGKRERIGRILQMHANHREEIPEVYAGDIAAAVGLKDTTTGDTLCDDK
                     APIILESMQFPDPVINVAIEPKTKQDQEKMGTALARLAEEDPTFKMHTDQDSGQTIIE
                     GMGELHLEIIVDRLQREFKVECNVGRPQVAYKETIRRAVKAEGKFVRQSGGRGQYGHC
                     WIEIEPLEQGSGFEFVNKIVGGVIPREYIAPIGQGIEEAMQNGIQAGYPVMDIRATVY
                     DGSYHDVDSSEMAFKIAGSMAFKAGAAKADPAIIEPVMKVEVTVPEEYMGEVIGDMNS
                     RRGRIEGMEATGTAQIVRGFVPLSEMFGYATDLRSKTQGRGVYVMMFDHYEEVPKNIA
                     EGIVAKRAGA"
     gene            541606..542808
                     /gene="tuf"
                     /locus_tag="DSY_RS02570"
                     /old_locus_tag="DSY0469"
     CDS             541606..542808
                     /gene="tuf"
                     /locus_tag="DSY_RS02570"
                     /old_locus_tag="DSY0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792382.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_005810165.1"
                     /db_xref="GI:492324983"
                     /translation="MAKQKFERTKPHVNVGTIGHVDHGKTTSTAAITLVLSKAGGAVA
                     QAFDQIDKAPEERERGITISTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVSAADGPMPQTREHILLARQVGVPYIVVWLNKADMVDDPELMELVEMEIRELLSE
                     YEFPGDDIPIIPGSGLKALQCGCGSRDCEWCGKIWNLMDAVDSYIPTPERATDKPFLM
                     PVEDVFTITGRGTVATGRVERGVIKVGDEIEIVGLTEAPRKTVCTGVEMFRKLLDQAQ
                     AGDNIGALLRGVDRKDIERGQVLAKTGSIKPHTKFTGEVFVLSKEEGGRHTPFFNNYR
                     PQFYFRTTDVTGVVTLPEGTEMVMPGDRVTITCEIISPIAMEEGLRFAIREGGRTVGA
                     GVVVSIIE"
     gene            543036..543344
                     /gene="rpsJ"
                     /locus_tag="DSY_RS02575"
                     /old_locus_tag="DSY0470"
                     /gene_synonym="nusE"
     CDS             543036..543344
                     /gene="rpsJ"
                     /locus_tag="DSY_RS02575"
                     /old_locus_tag="DSY0470"
                     /gene_synonym="nusE"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006716335.1"
                     /note="NusE; involved in assembly of the 30S subunit; in
                     the ribosome, this protein is involved in the binding of
                     tRNA; in Escherichia coli this protein was also found to
                     be involved in transcription antitermination; NusB/S10
                     heterodimers bind boxA sequences in the leader RNA of rrn
                     operons which is required for antitermination; binding of
                     NusB/S10 to boxA nucleates assembly of the antitermination
                     complex; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_005810163.1"
                     /db_xref="GI:492324981"
                     /translation="MSSQKIRIRLKAFDHKTLDQSAEKIVETAKRTGARVSGPIPLPT
                     EKSIYTILRSPHVNKDSREQFEMRTHKRLIDILEPTSKTVDALMRLDLPAGVDIEIKL
                     "
     gene            543601..544230
                     /locus_tag="DSY_RS02580"
                     /old_locus_tag="DSY0471"
     CDS             543601..544230
                     /locus_tag="DSY_RS02580"
                     /old_locus_tag="DSY0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250N2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_026184218.1"
                     /db_xref="GI:648492467"
                     /translation="MSKGILGKKVGMTQVFTEEGHLIPVTVVEAGPCYVIQKKTKATD
                     GYNAIQVGFGALRERLANKPQKGHVAKASVKPMRYIREFRVDDVEAYEIGQVITAELF
                     AAGDAVDVVGISKGKGFAGMIKRHGASRGPMKHGSKYHRRTGSLGAKGPARVFKGRNL
                     PGRMGGERVTVQNLKVVRVDADKNMILVKGAVPGAKKSLLILKPSVKAK"
     gene            544255..544878
                     /locus_tag="DSY_RS02585"
                     /old_locus_tag="DSY0472"
     CDS             544255..544878
                     /locus_tag="DSY_RS02585"
                     /old_locus_tag="DSY0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006716337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_005810159.1"
                     /db_xref="GI:492324977"
                     /translation="MPKVQVVNMQGSPVGELELDEYVFGIEPNTHVMHQAVVGQLASQ
                     RRGTHSTLLRGEVRGGGRKPWRQKGTGRARAGSIRSPLWRGGAVLFGPKPRKYGFSLP
                     KKVRRLALRSALSSKVNEQKLIVLEDLSLNEAKTREMVKVLQALNVSKKALIVTDEFM
                     ETIERSARNIAGIKTTAVEGMNIYDLLNSDVIVMTKAAVTKTEEVLA"
     gene            544878..545165
                     /locus_tag="DSY_RS02590"
                     /old_locus_tag="DSY0473"
     CDS             544878..545165
                     /locus_tag="DSY_RS02590"
                     /old_locus_tag="DSY0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G1W8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_005810158.1"
                     /db_xref="GI:492324976"
                     /translation="MRDARDVLKRPVISEKSVGLIEENKYSFWVDTAANKIEIKAAVE
                     KMFKVKVVDVRTINVDGKKKRVGKHVGRTADRKKAIVTLKAGDRIEGFAGL"
     gene            545190..546020
                     /gene="rplB"
                     /locus_tag="DSY_RS02595"
                     /old_locus_tag="DSY0474"
     CDS             545190..546020
                     /gene="rplB"
                     /locus_tag="DSY_RS02595"
                     /old_locus_tag="DSY0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G1W9.1"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_011459099.1"
                     /db_xref="GI:499778365"
                     /translation="MPVKGFKPYSPGRRQMTVSTFEEITKTTPERSLLAPLKSKAGRN
                     NQGKLTVRHQGGGHKRKYRLIDFKRNKDSVPAKVASIEYDPNRSANIALLHYLDGHKA
                     YILAPNGLQVGQMVVSGPDADIKVGNALPIKNIPVGTLLHNIEMKPGKGAQLVRSAGG
                     SAQLMAKEGKYATLRLPSGEMRMVHIDCRATIGQVGNLEHENINIGKAGRSRWLGIRP
                     TVRGAVMNPNDHPHGGGEGRNPIGRNPVTPWGKPALGAKTRKKKHPSNRFIVKRRGKK
                     "
     gene            546040..546321
                     /locus_tag="DSY_RS02600"
                     /old_locus_tag="DSY0475"
     CDS             546040..546321
                     /locus_tag="DSY_RS02600"
                     /old_locus_tag="DSY0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_005810155.1"
                     /db_xref="GI:492324973"
                     /translation="MSRSLKKGPYVEGRLLARVEKMNAANEKRVLKTWSRSSTIFPQM
                     VGHTIAVHEGRKHIPIYITEDMVGHKLGEFAPTRTYKGHAGSEKSSGLR"
     gene            546339..546683
                     /locus_tag="DSY_RS02605"
                     /old_locus_tag="DSY0476"
     CDS             546339..546683
                     /locus_tag="DSY_RS02605"
                     /old_locus_tag="DSY0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_005810154.1"
                     /db_xref="GI:492324972"
                     /translation="MQQAKAIARYVRISPRKVRQVVDLIRGKNVSDALAILQFTPKGA
                     TEPVTKVLQSAVANAEHNYEMDTDALIVKEIYVDEGPTLKRIKPRAMGRADQIRKRTS
                     HITVVVVEKKEG"
     gene            546687..547346
                     /locus_tag="DSY_RS02610"
                     /old_locus_tag="DSY0477"
     CDS             546687..547346
                     /locus_tag="DSY_RS02610"
                     /old_locus_tag="DSY0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006716342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_005810152.1"
                     /db_xref="GI:492324970"
                     /translation="MGQKVNPKGLRVGIIRDWEGRWFADKNYLELLHEDLKVRKFVKT
                     KLQQAGVPKVEIERAANRVKVSIHAAKPGIVIGRGGTEVENLRKQLEAMTGKQVAVNI
                     VEVKKPELDAQLVAESVAQQLEKRVSFRRAMKQTVQRTMRQGGQGIKISCSGRLGGAE
                     IARTEWYSEGKVPLHTLRADIDYGFAEANTTYGKIGVKVWIYKGEVLPAKKVAQVEGG
                     K"
     gene            547347..547784
                     /locus_tag="DSY_RS02615"
                     /old_locus_tag="DSY0478"
     CDS             547347..547784
                     /locus_tag="DSY_RS02615"
                     /old_locus_tag="DSY0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_005810150.1"
                     /db_xref="GI:492324968"
                     /translation="MLVPTRVKHRKQHRGRMHGKATRGNTITFGEYGLVALEPAWITN
                     RQIEAARIAMTRYIKRGGKVWIKIFPDKPITAKPAETRMGSGKGSPEYWVAVVKPGRV
                     MFELAGVPEEIAKEALRLAMHKLPVKCKIVRREELEGGDANEN"
     gene            547774..547977
                     /locus_tag="DSY_RS02620"
                     /old_locus_tag="DSY0479"
     CDS             547774..547977
                     /locus_tag="DSY_RS02620"
                     /old_locus_tag="DSY0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250M4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_005810148.1"
                     /db_xref="GI:492324966"
                     /translation="MKTKDFRDMTDEELLKEIDGFKTELFNLRFQLATGQLDNPARIR
                     EVRKGIARGKTILRERELKINRA"
     gene            548001..548261
                     /locus_tag="DSY_RS02625"
                     /old_locus_tag="DSY0480"
     CDS             548001..548261
                     /locus_tag="DSY_RS02625"
                     /old_locus_tag="DSY0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250M3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_011459100.1"
                     /db_xref="GI:499778366"
                     /translation="MERTQRKVRMGKVVSDKMDKTVVVAVEMKVRHPLYHRTITQTKK
                     FKAHDENNEAKTGDTVVIMETRPLSKDKRWRLIEITERAVAL"
     gene            548296..548664
                     /locus_tag="DSY_RS02630"
                     /old_locus_tag="DSY0481"
     CDS             548296..548664
                     /locus_tag="DSY_RS02630"
                     /old_locus_tag="DSY0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G1X6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_011459101.1"
                     /db_xref="GI:499778367"
                     /translation="MIQVQTRLRVGDNSGAKELMCIKVLGGSMRRYASIGDIIVASVK
                     EATPGGVVKKGDVVKAVVVRTKKEIKRKDGTYIRFSENAAVVIKDDRSPRGTRIFGPV
                     ARELRDKDFMKIISLAPEVI"
     gene            548692..549030
                     /locus_tag="DSY_RS02635"
                     /old_locus_tag="DSY0482"
     CDS             548692..549030
                     /locus_tag="DSY_RS02635"
                     /old_locus_tag="DSY0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250M1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_011459102.1"
                     /db_xref="GI:499778368"
                     /translation="MAAVKQKMHVKKGDMVMVITGKDAGKKGKVLEVFPKKGRVVIEK
                     VNIVKRHTKPSQSMPQGGIFEKEAPIASSNVMLYCTECNKVTRVSVKETEAGKVRVCK
                     KCGVNLPDKK"
     gene            549052..549591
                     /locus_tag="DSY_RS02640"
                     /old_locus_tag="DSY0483"
     CDS             549052..549591
                     /locus_tag="DSY_RS02640"
                     /old_locus_tag="DSY0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015260997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_011459103.1"
                     /db_xref="GI:499778369"
                     /translation="MARLKDKFSNEIAPALQQKFNYKNVMQIPKLEKVVINVGVGEAI
                     QNSKAIDAAVGDLSKITGQKPVVTRAKKSIAAFKLRTGMPIGTKVTLRGDRMYEFVDR
                     LMNVALPRVRDFHGVSDKAFDGRGNYTLGIKEQLIFPEIEYDKIDKVRGMDIIFVTTA
                     KTDEEARELLGMLGMPFRK"
     gene            549823..550221
                     /locus_tag="DSY_RS02645"
                     /old_locus_tag="DSY0485"
     CDS             549823..550221
                     /locus_tag="DSY_RS02645"
                     /old_locus_tag="DSY0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_011459105.1"
                     /db_xref="GI:499778371"
                     /translation="MAMSDPIADFLTRIRNAGMVYHDKVEVPASNVKKAIAEILKEEG
                     FIKDVEYISDNKQGVIRCYLKYGQNRERVITGLKRISRPGLRVYAKKDEVPKVLGGLG
                     VAILSTSKGLMTDKRARQEGLGGEVLCYIW"
     gene            550246..550800
                     /locus_tag="DSY_RS02650"
                     /old_locus_tag="DSY0486"
     CDS             550246..550800
                     /locus_tag="DSY_RS02650"
                     /old_locus_tag="DSY0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250L7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_005810135.1"
                     /db_xref="GI:492324953"
                     /translation="MSRIGKRPISIPGGVDVNIEGNVVTVKGPKGTLTKEMHSLINIA
                     VEEQQIVVTRPDDQPLSRSLHGLTRTLVANMVEGVTKGFSKSLDMVGVGYRAAKQGNK
                     LVLSVGKSHPVELIPFEGIEVEVPAQNKIIVKGMDKELVGDFAAEIRKERPPEPYKGK
                     GIKYENEVVRRKAGKTGAKKGGKK"
     gene            550853..551221
                     /locus_tag="DSY_RS02655"
                     /old_locus_tag="DSY0487"
     CDS             550853..551221
                     /locus_tag="DSY_RS02655"
                     /old_locus_tag="DSY0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G1Y2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_011459106.1"
                     /db_xref="GI:499778372"
                     /translation="MITQIDRKAIRMKKHKRVRKSVFGTAERPRLAVFRSLNHIYAQV
                     INDELGVTLATASSLDAEFKAAELAGGNVEGAKKVGDLVAKRALEKGVSKVVFDRGGN
                     IYHGRIAAVAEAAREAGLEF"
     gene            551246..551746
                     /locus_tag="DSY_RS02660"
                     /old_locus_tag="DSY0488"
     CDS             551246..551746
                     /locus_tag="DSY_RS02660"
                     /old_locus_tag="DSY0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_005810132.1"
                     /db_xref="GI:492324950"
                     /translation="MAKIDASKLELTEKVVHIARVAKVVKGGRRFSFSALVVVGDGQG
                     NVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLIGTTIPHAILGNYGAGSVLLKPATKG
                     TGVIAGGAVRAVLEAAGVSDILTKSLGSANPHNMVNATMAALKSLKRAEDVAKLRGKT
                     VEEILG"
     gene            551758..551940
                     /locus_tag="DSY_RS02665"
                     /old_locus_tag="DSY0489"
     CDS             551758..551940
                     /locus_tag="DSY_RS02665"
                     /old_locus_tag="DSY0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250L4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_005810130.1"
                     /db_xref="GI:492324948"
                     /translation="MKIKVTLVKSPIGYSENQRKVLKSLGLGKMGSSVVHDDTSSIQG
                     MIRKCAHLVAVENVAE"
     gene            551959..552402
                     /locus_tag="DSY_RS02670"
                     /old_locus_tag="DSY0490"
     CDS             551959..552402
                     /locus_tag="DSY_RS02670"
                     /old_locus_tag="DSY0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250L3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_005810128.1"
                     /db_xref="GI:492324946"
                     /translation="MKLHELKPAQGSTKAPKRLGRGIGSGTGKTSGKGHKGQKARAGG
                     GVRPGFEGGQQPLARRMPKRGFTNIFKKEYVVLNVRDLEERFENGAVVGYESLFEVGL
                     IKTIKDGVKILGTGELTKALTVQVDKVSQTAAEKIVAAGGKVEVE"
     gene            552404..553693
                     /locus_tag="DSY_RS02675"
                     /old_locus_tag="DSY0491"
     CDS             552404..553693
                     /locus_tag="DSY_RS02675"
                     /old_locus_tag="DSY0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_005810127.1"
                     /db_xref="GI:492324945"
                     /translation="MIVDSLKNAWKLPEIRTKIGFTLLMFLIFRIGAHIPIPFINHDI
                     LSNILGSGTLYDFLDTFSGGSFRRFSVFALSITPYITASIILQLLTIVIPSLERLAKE
                     GEFGRKKITQYTRYGTVILGFIQGFGMTFGLRGALIIPKPGMEWAIYLLVALILTAGT
                     AFLMWLGERITENGIGNGISLIIFAGIVAGVPDAIKRIAGLLSVGEINVFSVFGLIVI
                     GLGIIAGVVFIQEGQRRIQVQYAKRVVGRRVYGGQSSHIPMKVNQAGVIPIIFAISLL
                     AFPSTIATWMDPASAYVRFVNTWFVMNGSLTSIPYLIVYAVLIIFFTYFYTAVSFNPV
                     DVADNLKKYGGFIPGLRPGRATSDYLSKILSRLTLAGGTFLAMIAVLPSLVIGLTGIP
                     NITLGGTSLLIVVSVALETMKQLESMLMQRHYQGFMK"
     gene            553705..554358
                     /locus_tag="DSY_RS02680"
                     /old_locus_tag="DSY0492"
     CDS             553705..554358
                     /locus_tag="DSY_RS02680"
                     /old_locus_tag="DSY0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250L1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_005810125.1"
                     /db_xref="GI:492324943"
                     /translation="MRAILMGPPGAGKGTQAADLITRYQIPHISTGDMFRAAIKAGTA
                     LGMKAKEYMDAGSLVPDEVTIGIVAERLAEPDCSKGFLLDGFPRTVAQADALDKILTQ
                     LKMNLDGVINIEVPEAKLLERLTGRRICRQCGGTYHMVFNPPAAEAVCDKCGGELYQR
                     SDDTLETAKNRLQVYNDQTQPLIDYYREKGLLKEINGDQDIAQVLQDIVDAMEHGHD"
     gene            554351..555097
                     /locus_tag="DSY_RS02685"
                     /old_locus_tag="DSY0493"
     CDS             554351..555097
                     /locus_tag="DSY_RS02685"
                     /old_locus_tag="DSY0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_015942767.1"
                     /db_xref="GI:506423048"
                     /translation="MIELKNPSQIAVMRKAGKIVADTLQLMRENVRPGITTGELDGIA
                     EEYIRKCGAVPAFKGYNGFPSSLCTSVNEQVVHGFPGLRTLKSGDIISIDCGAVFDGY
                     VGDAAITLPVGEISEELQLLLRVTEESLMMGIPQAIKGNRLQDISHAVQTHVEAHGLS
                     VVRDYVGHGIGRAMHEDPQIPNYGKPGRGPRLEIGMVLAIEPMVNLGTYEVKVLSDHW
                     TVVTKDGKASAHFEHTVAITENGPEILTRS"
     gene            555132..555350
                     /gene="infA"
                     /locus_tag="DSY_RS02690"
                     /old_locus_tag="DSY0494"
     CDS             555132..555350
                     /gene="infA"
                     /locus_tag="DSY_RS02690"
                     /old_locus_tag="DSY0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792406.1"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_005810121.1"
                     /db_xref="GI:492324939"
                     /translation="MSKEDVIEVEGKVLEPLPNAMFLVELSNGHKVLAHVSGKIRMNF
                     IRILPGDRVTVELSPYDLSRGRIVYRFK"
     gene            555374..555487
                     /gene="rpmJ"
                     /locus_tag="DSY_RS02695"
                     /old_locus_tag="DSY0495"
     CDS             555374..555487
                     /gene="rpmJ"
                     /locus_tag="DSY_RS02695"
                     /old_locus_tag="DSY0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007778480.1"
                     /note="smallest protein in the large subunit; similar to
                     what is found with protein L31 and L33 several bacterial
                     genomes contain paralogs which may be regulated by zinc;
                     the protein from Thermus thermophilus has a zinc-binding
                     motif and contains a bound zinc ion; the proteins in this
                     group have the motif; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_005810119.1"
                     /db_xref="GI:492324937"
                     /translation="MKVRPSVKKICEKCKVIKRHGKVMVICENPKHKQRQG"
     gene            555664..556035
                     /locus_tag="DSY_RS02700"
                     /old_locus_tag="DSY0496"
     CDS             555664..556035
                     /locus_tag="DSY_RS02700"
                     /old_locus_tag="DSY0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250K7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_005810116.1"
                     /db_xref="GI:492324934"
                     /translation="MARIAGVDLPREKRVEVGLTYIYGIGLPTAQKILARTGVNPETR
                     IRDLSEEEVNRLREVIDKEIKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQR
                     TKTNARTRKGPIKTVGAKRKK"
     gene            556054..556443
                     /locus_tag="DSY_RS02705"
                     /old_locus_tag="DSY0497"
     CDS             556054..556443
                     /locus_tag="DSY_RS02705"
                     /old_locus_tag="DSY0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_005810114.1"
                     /db_xref="GI:492324932"
                     /translation="MARKVVRTKRRERKNIATGVAHIKSTFNNSMVTITDPKGNVISW
                     SSAGALGFKGSRKSTPYAAQMAAETAAKAAMEHGLKEVECFVKGPGAGREAAIRALQA
                     AGLEVNMIKDVTPIPHNGCRPPKRRRV"
     gene            556456..557082
                     /locus_tag="DSY_RS02710"
                     /old_locus_tag="DSY0498"
     CDS             556456..557082
                     /locus_tag="DSY_RS02710"
                     /old_locus_tag="DSY0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8G1Z3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_011459108.1"
                     /db_xref="GI:499778374"
                     /translation="MARYTGPVCRLCRREGMKLFLKGDRCYTGKCAIDRRAYAPGQHG
                     QSRGKKPTEYGIQLREKQKVRRIYGVQEKQFRSYYDKANRQKGIVGENLLRLLERRLD
                     NVVFQLGFATSRPEARQLVRHGHFTINGRRVDIPSFLVRVGDVVGVKEASKSSPRLKE
                     ILSSLDRTPPKWMNLDANAATGTIIALPDREDIQLPIQEHLIVEKYSR"
     gene            557146..558093
                     /locus_tag="DSY_RS02715"
                     /old_locus_tag="DSY0499"
     CDS             557146..558093
                     /locus_tag="DSY_RS02715"
                     /old_locus_tag="DSY0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250K4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_005810110.1"
                     /db_xref="GI:492324928"
                     /translation="MLEIEKPKIECVERTDDNSYAKFVVEPLERGYGITLGNSLRRIL
                     LSSLPGTAVTSVKIEGVLHEFSTVPGVLEDVTDIILNLKSLALKGHTDEPKVLRLEAE
                     GEGVIKAGDIITDADIEILNPDLKIATLDKDGRLFMEMTAERGRGYVSADKNKKPDQA
                     IGIIPIDSIFAPIYKVNYTVEDTRVGMVTDYDKLTLEVWSNGSITPEEATSLAAKILS
                     EHLRLFIGLTDKLNNVEIMVEKEEEAKDKILEMTIEDLDLSVRSYNCLKRAGINSVEE
                     LTQKTEEDMIKVRNLGRKSLEEVESKLKELGLGFRKADD"
     gene            558120..558458
                     /locus_tag="DSY_RS02720"
                     /old_locus_tag="DSY0500"
     CDS             558120..558458
                     /locus_tag="DSY_RS02720"
                     /old_locus_tag="DSY0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q250K3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_011459109.1"
                     /db_xref="GI:499778375"
                     /translation="MAYRKLGRNTGHRGSMLRNLATSLLKHERIQTTEARAKEVNAIA
                     EKMITLGKQGDLAARRNALTYLLEEDVVTKLFTEIAPKYADRQGGYTRVIKVGPRRGD
                     AAEMVLIELV"
     gene            558598..559689
                     /locus_tag="DSY_RS02725"
                     /old_locus_tag="DSY0501"
     CDS             558598..559689
                     /locus_tag="DSY_RS02725"
                     /old_locus_tag="DSY0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(4Fe-4S)-binding protein"
                     /protein_id="WP_005810099.1"
                     /db_xref="GI:492324917"
                     /translation="MYAKIMSKDVQEGWTIMSIKKEKKSRLKLLNQDRAPLERRAVQL
                     LFGLITLLIGIQFIRFVNSYADPNATLLVHRPAGVEAFLPISALVALKSWLYTGIFDI
                     IHPAGLVILLLAMALSLLFKRSFCSWICPIGTLCEGLAILGRKLWGRNFVLPRWLDYP
                     LRSLKYILLSFFLVFILILMDGPSAYGFLQTPYNMIADVKMLDFFKNLTLTGMTVIAV
                     LALLSAVIQNFWCRYLCPYGALMSLLSIFSPWKIRRNGDTCISCQKCTAVCPNQLKVA
                     EAKDIWSPECSGCLNCVKSCPVKGTLEFSLPSSSGKGLAFDPKRTAIVLILVWFMVVG
                     LAKFTGHWETSIPPEMYRVLIPQAEQFNH"
     gene            560013..561593
                     /locus_tag="DSY_RS02730"
                     /old_locus_tag="DSY0502"
     CDS             560013..561593
                     /locus_tag="DSY_RS02730"
                     /old_locus_tag="DSY0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011459110.1"
                     /db_xref="GI:499778376"
                     /translation="MKKGKRFIALALMVLLVGISITGCGGGSTSTGSPDSGEKVDKAK
                     ETLIYAQGAEPRGLDPALVDDGESAKVMINIYEGLLQYNKDSTKVEPSLAKKWDVSED
                     GLTYTFYLQEGVKFHDGTDFNAEAVKFNIDRQIPPQATPDMAYGSFVYGSVKSVEVVD
                     NYTVKINLTDPSTPFLNNLAMVMSAPMVSPKALQDNNNNVNQTPVGTGPYKYVSWAKD
                     ENIVLVRNDEYWGEKALTKNVIFKFIKDNSARVVALNNGEADMIDGIDATVVDQITGA
                     GNKVFQAPGMNINYMAYNTSKAPFNDAKARKAVSQAINVPELVDSLYQGYSETATSIL
                     PTFMEGYDKSITQAAYDPAASAEALKAAGITNVHIITYTNPRPYNAATGQALAEAIQG
                     YLSKVGVTATIDSFDWTTYKEKIKAGDYDICFYGWIGDNGDPDNFMYLLAHEDPTMNV
                     ARYANPEFNNLIKEGIKAPAGPERNKIYTELEKIAAADAAWLPISHAQTLAAYRPNVQ
                     NFLYHVTGVTPFAGVSKQ"
     gene            561754..562761
                     /locus_tag="DSY_RS02735"
                     /old_locus_tag="DSY0503"
     CDS             561754..562761
                     /locus_tag="DSY_RS02735"
                     /old_locus_tag="DSY0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214391.1"
                     /note="transports peptides consisting of two or three
                     amino acids; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_005810095.1"
                     /db_xref="GI:492324913"
                     /translation="MLKYIIKRILMLIPVLIGVSIIVFLIMRVFSPDPAPIVLGQHAT
                     QETVDVWRQANGLNDPIPLQYLHFITGALQGNFGTSYYTKAPVIEEIMSRFPATIELA
                     LFAIIIASVFGIIIGIISAVKKNSLFDNAGMFLALVGVSMPIFWLGILLIILFSGTLH
                     WLPSSGRIDPLLRPMSVTGFYLIDSLIAGDIEAFADAFQHLILPGTALAMYSMAIITR
                     MTRSSMLETLQQDYIRTARAKGVSEGKVIRKHAFRNGLIPIVTVIGLQLGSLLGGAVL
                     TETVFSWPGIGSYTVACILKSDFPVVQGVVLLIATVFVLMNLLVDVIYAFLDPRIKYS
                     K"
     gene            562774..563703
                     /locus_tag="DSY_RS02740"
                     /old_locus_tag="DSY0504"
     CDS             562774..563703
                     /locus_tag="DSY_RS02740"
                     /old_locus_tag="DSY0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_005810093.1"
                     /db_xref="GI:492324911"
                     /translation="MKNTNVSSSDNTLQAAEYVEKPESQLKEMWDTLKQNKAAVVGLC
                     IIIMLVLISLVVWVSNLLGIQVLPYDPNYSDMSKSFTHPNAEHWFGTDQLGRDMFSRV
                     MDGTKISLFVGIAAVSISLTVGVVLGAIAGYRGGRTDTIIMRFMDMILAIPSILLAIA
                     FMAALGKGLDKAVIAIGLVSIPEYARIVRGSILSIKESDYVQAAKVIGNRDSRIIFKH
                     ILPNIVSLIVVRATLGISTAVLDTAALGFLGLGVQPPFAEWGDMLGRARGFIFTAPYT
                     LIFPGIAITITVLAFNLLGDGLRDALDPKSRIK"
     gene            563717..564715
                     /locus_tag="DSY_RS02745"
                     /old_locus_tag="DSY0505"
     CDS             563717..564715
                     /locus_tag="DSY_RS02745"
                     /old_locus_tag="DSY0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020493357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_041272207.1"
                     /db_xref="GI:752602820"
                     /translation="MLLEVKNLKTEFKLKRGTVRAVDDISFSVDKGEILAIVGESGSG
                     KSVTSLSIMGLLQNPGKIAGGDILFDSQNLTRMNKKELQDIRGNKISMIFQEPMTSLN
                     PVQRIKDQIMESLIIHKKINKKEALARTIELLDMVGIPSAAQRADDYPHQMSGGMRQR
                     VMIAMALSCEPQLLIADEPTTALDVTIQAQILDLLYHMREKFNMAVLLITHDLGVVSE
                     AADRVIVMYCGKIVEEADVKTLFKNPLHPYTVGLLNSIPQIDDDSDERLYMIKGMVPN
                     PLNMPPGCSFSDRCDRSMERCTRETPELLEIDGHKVRCFLYEEAQEEAEEGGLAAQ"
     gene            564712..565677
                     /locus_tag="DSY_RS02750"
                     /old_locus_tag="DSY0506"
     CDS             564712..565677
                     /locus_tag="DSY_RS02750"
                     /old_locus_tag="DSY0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_011459112.1"
                     /db_xref="GI:499778378"
                     /translation="MSVLMEIQNLSKHFSVESNFFGKSSSLLKAVDDVSFTIHKGEAF
                     GLVGESGCGKTTLGKIIVNLYSPTKGSMIFEGKDLTKLKENQRRAYCKDMQMIFQDPY
                     ASLNPRMTVGDIIAEPIVINKLLPANKVEERVTYLLNCVGLAQHQRNRYPHEFSGGQR
                     QRVGIARALAVEPKLIVCDEPVSALDVSIQAQVLNLLADLKDEFGLTYLFIAHGLNVV
                     KHISDRVGVMYLGKLVEIAPKKELYANPLHPYTQALLSAIPIIDPEKKKQRIILEGDV
                     PSPINPPAGCRFCSRCFKEMPVCKETAPELKEISPGHWVACHLFD"
     gene            complement(565746..566294)
                     /locus_tag="DSY_RS02755"
                     /old_locus_tag="DSY0507"
     CDS             complement(565746..566294)
                     /locus_tag="DSY_RS02755"
                     /old_locus_tag="DSY0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459113.1"
                     /db_xref="GI:499778379"
                     /translation="MLLESIILAILIGFLVGGKLNSLFEINLKGLELLFLGALLQLFA
                     FWSVKLHLEWANYWVIPFSHSLSYLLLMGFTLKNRAYRSFSLVALGIALNGVVIVLNG
                     GLMPVDPAYLPEASRQLLQAGTGTHGILTDSTRLKMLADILFINIPVLGKQLFSLGDI
                     LIDLGMGTFIVMQMRRSENRPQ"
     gene            complement(566313..567599)
                     /locus_tag="DSY_RS02760"
                     /old_locus_tag="DSY0508"
     CDS             complement(566313..567599)
                     /locus_tag="DSY_RS02760"
                     /old_locus_tag="DSY0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459114.1"
                     /db_xref="GI:499778380"
                     /translation="MLKANFKFRSYFNFIVFCATLILIWSMLSTHWEIGMLSSFLIFA
                     VLTVASECLPVALPKGGYVTVSCAVFVAAAILFPMGVILPIATCGALILFGKAAEDQP
                     LWKRFFNASQFIISLAMAKTVLIQAGLTDFAVDIRHLPFYLLAAFTYMLSNVTLVSIA
                     LGKISGKSPWAIWKGNIRWSVPNFLALAPLGVLMAMIYVRYGPLGLIMLSVPLLLARH
                     SFQLYIDMRKNYLNTVTALVQALEAKDSYTSGHSSRVAQWSIKLAEEMNLPEDRVEFI
                     KYAGILHDVGKIGVSETILNKKGKLDDAEWKFICNHPVIGQNIIQSIDFLFDVGSAVR
                     FHHERFDGAGYPDGIKGKDIPQESRIIAVADTYDAMTSSRSYRQALSSSEAIAELRRV
                     AGSQLDPEVVEAFCRVIQKENQMEKLSPITDMPIAN"
     gene            complement(567863..568522)
                     /locus_tag="DSY_RS02765"
                     /old_locus_tag="DSY0509"
     CDS             complement(567863..568522)
                     /locus_tag="DSY_RS02765"
                     /old_locus_tag="DSY0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272208.1"
                     /db_xref="GI:752602821"
                     /translation="MSGEMIWASYEEAIKKIRSVIGTRIKGNESNEISEIHILANSER
                     NPKQIVRDVESVLAAQFGIEIDHKIVSVVQLEQQEDEESPSPNFPLKRAQIRPKLISI
                     SLHTNKMMAEVKVELSMGDETYEGIASGTSTTYNRLRLFVDATINALSGSLMEKLFFA
                     TEDVMITRLGKYQVAQVIICLITPLGEQNLVGCALVKNDEREAIVKATLDAVNRKLWF
                     Y"
     gene            complement(568642..569367)
                     /locus_tag="DSY_RS02770"
                     /old_locus_tag="DSY0510"
     CDS             complement(568642..569367)
                     /locus_tag="DSY_RS02770"
                     /old_locus_tag="DSY0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase, RluA family"
                     /protein_id="WP_005810083.1"
                     /db_xref="GI:492324901"
                     /translation="MRFEGVGELFTIPIVYEDNHLLVVDKPPNILSQKDSTGDMDILT
                     LLKQDIKIRYNKPGNVYLGLVHRLDRPVGGVMVFAKTSKSAARLSEQIRNREFTKTYL
                     ALIQGQPAKQKNTLIHYLVKDEKSNKVSAVKKGAKGAKEAILDYEVVHSQSDLSLVKV
                     NLRTGRPHQIRVQFAHLGHPLYGDYKYGKIVKTSKTSLTKPHLGLWSYEISCLHPISK
                     GQIHFKSYPHQHKPWNQFDLGLP"
     gene            complement(569486..571054)
                     /locus_tag="DSY_RS02775"
                     /old_locus_tag="DSY0511"
     CDS             complement(569486..571054)
                     /locus_tag="DSY_RS02775"
                     /old_locus_tag="DSY0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_035249686.1"
                     /db_xref="GI:737265755"
                     /translation="MNRRDFLKKASLGAAVVAGSGFLVGCNTTDATAPASAPEKWDME
                     TDVAIVGSGNGGLSAGCAVVEEGKKAVICEIAGFIGGGSIYSGGGIHCWGVNTWEEYR
                     KHFEDLHDPVLGKTYVETFRQTYIPWLQKNGFPITPAGGTRGYTKDWTMGSGEPGYLK
                     QKSYFDALHKFFESKGGQVLLSTRVMRLVIDEAGEVCGVHALKNDGTQLFIKAGAVIL
                     AAGGFQANKGLTARYMGPYGDSIRTMGVPYNTGSGMLMAQGVGALTGGSFSTFSGTLI
                     GISPNPQTEENPEAWEKARGSDPQSLPGIGDGRPPAIGWVSFLFPEDTTGLLVNLEGK
                     RFIDESSPIDAKYPRVPQSIIKQKRGMALMIGDQAIYDANKSSEAIMKMNEAQGCLTV
                     KGDTLEELAVKLQETYGFYKGAFLKTISEYNKAIDNGTADQLDVPRVAGHHKIAQGPF
                     YAFPTGTCAYHTFGGLVINEKAQVLDVQRQPIKNLYAAPPTAAMFKEPYGGGVAAAGT
                     FGYIAAKVITKGSV"
     gene            571511..573484
                     /locus_tag="DSY_RS02780"
                     /old_locus_tag="DSY0512"
                     /note="ArsR family transcriptional regulator; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            complement(573616..575190)
                     /locus_tag="DSY_RS02785"
                     /old_locus_tag="DSY0513"
     CDS             complement(573616..575190)
                     /locus_tag="DSY_RS02785"
                     /old_locus_tag="DSY0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_035249652.1"
                     /db_xref="GI:737265721"
                     /translation="MTLNRRDFLKKASLGAAVMAGSGFLVGCNTTNVTPPAATPDKWD
                     METDVVVVGAGNGGLSAGAAAAEEGKKVIICEISGFIGGGSIYSGGGLHTWGTKTWEE
                     YKAHTEDLHDPVLAKTYVETFRQTYIPWLQKIGIPITPAGGDRGYLKDYTMGSGEQGY
                     LRQKAYFDALQKFIEGKGGQILTNTRVRQLVIDENGAVNGVYAQKKGENPIFIKAGAV
                     VLAAGGFQANKGLTAQYIGSYGDTVRNMGTPYNTGSGMLMAQGVGALTGGSFSTFSGT
                     LIGISPNRQTEENPEEYEKARSGDPQTLPGIGNGRPPAPGWVSFLFPEDTTGILVNLQ
                     GKRFMDETSPIDAKYPRVPQTIIKQKRGMALMIADQAIFDKNKSSDAILKMNESQGVK
                     VIKGNTLDELATKLQDAYGVYKGTLIKTINDYNTAVGNGTAAQLDVPRVGGHFKVAAG
                     PFYAFPTGVAIYHTFGGLIINEKAQVLDLQRQPIANLYAAPPTAAMFREPYAGGIASA
                     GTFGYIAGKVIAKGSV"
     gene            complement(575505..576752)
                     /locus_tag="DSY_RS02790"
                     /old_locus_tag="DSY0514"
     CDS             complement(575505..576752)
                     /locus_tag="DSY_RS02790"
                     /old_locus_tag="DSY0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011459119.1"
                     /db_xref="GI:499778385"
                     /translation="MNKTTRGWTVTFAGTGINLALGVLYTWSVFAAALTEQLAWSKTA
                     ASLPYTVACAVFALMMVPGGRLQDRFGPRWVATAGGIFAGGGLILSSLTDSLFVLTLT
                     FGLIAGIGIGLGYSAATPAAVKWFPPQKKGLISGIVVAGFGLASLYIAPLTNSLIGNL
                     GVKSAFRIEGLIFLFAIVALSQVLAVPQSNPTPTAPSTPASPQAATSLNAPPSPPPAA
                     KGDFSWQEMLKDPRFYLLWVMFAAGATAGLMIIGQLSTITKLQTGISWGFAMVALLAI
                     FNAGGRVLAGWLSDRIGRSWTMRIFFSLQGLNMLAFTFYSSPALIALGAIMTGLSYGS
                     LLSLFPSATYDFFGTKNGGVNYGLIFTAWGVGGVFGPLMAGAVVDLTNSYFYAYLIAA
                     ALCLIAAFLTIFLKSSPLEAEKA"
     gene            complement(577021..578952)
                     /locus_tag="DSY_RS02795"
                     /old_locus_tag="DSY0515"
     CDS             complement(577021..578952)
                     /locus_tag="DSY_RS02795"
                     /old_locus_tag="DSY0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="WP_011459120.1"
                     /db_xref="GI:499778386"
                     /translation="MEEKNLEALLEEDRQFIPSEEFHKNALIQSADIYEQGQSLGFWE
                     EQAKQLSWLSPWEKTLEWNPPFAQWFVGGKLNASANCLDRHLQDWHRNKAAIIFEGEN
                     GDSQVLTYQDLHREVSKFANVLKANGVNKGDRVTIYLPMIPEAVISMLACARIGAPHS
                     VVFGGFSSEALRDRVIDAQAKAVITSDGSFRRGNTIPLKDNTDIALDGVDCVEHVFVI
                     QRTKQTVQMKEERDLWYHEEMAKASPVCPAEPMDAEDMLFILYTSGTTGKPKGVVHTT
                     GGYMVGVSTTHRWVFDLKEEDVYWCTADVGWITGHSYIVYGPLANGATVLMYEGSPDY
                     PNRDRFWEIVEKYKVTILYTAPTAIRTFMKWGPQYPQSRDLSSLRLLGSVGEPINPEA
                     WMWYYKYIGGERCPIVDTWWQTETGMIMMTPLPGITSLKPGSCTVPFPGVRIEVVDSA
                     GHPVPKGGGGYLAIKEPWPAMLRNIYGDPARFERTYFGNWPGVYFPGDGAKWDKDGYF
                     WILGRVDDVINVSGHRIGTMEVESALVDHPSVAEAAVIGKNHEVKGQALACFVTLKEG
                     IEITPDLEDELKKHVAKKIGALARPDDIFFTAELPKTRSGKIMRRLLRDIAEGRAIGD
                     TTTLADASVVNTLKANYQE"
     gene            579276..580091
                     /locus_tag="DSY_RS02800"
                     /old_locus_tag="DSY0516"
     CDS             579276..580091
                     /locus_tag="DSY_RS02800"
                     /old_locus_tag="DSY0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_011459121.1"
                     /db_xref="GI:499778387"
                     /translation="MDDKRNICLKVAYDGTYYHGFQRQPEFHGPTIQGTLEAVWAKLV
                     EEEVTLNTAGRTDTGVHAAGQVVNFRTGARIPVDKIPKAFNSLLPRDIRILAAQEAAE
                     NFHARFSAKWKRYDYRIDNHPVADVFTRLYSLHEPVRLDWQRMQQGAQYLVGRHNFKA
                     FSAAGGTSKTFERTLYLCQVAENQGHLRITCIGDGFLYNMVRIIAGTLVYVGKNRIQP
                     GEIPDILASLDRKRGGVTATPQGLTLSYVHYGEELPRDIFPELFQEGVSHDSR"
     gene            580353..581513
                     /locus_tag="DSY_RS02805"
                     /old_locus_tag="DSY0517"
     CDS             580353..581513
                     /locus_tag="DSY_RS02805"
                     /old_locus_tag="DSY0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="WP_015942780.1"
                     /db_xref="GI:506423061"
                     /translation="MNYQVKEVALKDSFAFWQSFEDEERVLFYHPFQQQLIMGARRLK
                     TFGPGESYRGYPFVFSTRTFFPTLKDPKWSGLGNETIAFQYYLVEEKAGQKLYYAHET
                     ADISAVPPKEFASHRHDYEILADDYQEWQELFQCAKQKVLAGKVQKVVISREIKIQCN
                     TMVSVESVLKNLMEKNPHSFVFAYCKEGKTFLGATPEIVARKEKGQIMSYALAGTRAR
                     TADEEDEQGKTALLNDPKNRHEHQIVLDYIAKVMNTYSDEVLIGETTTLQLRNLYHLK
                     TPLAAKAKENSSLTAWVARLHPTPALGGYPVAEALAIIARWEKHERGLYAAPLGIMNE
                     EGDGIFVAGIRSALIEGRTVYAYTGCGIVASSECAEEYAETAHKAKTILESL"
     gene            581529..583181
                     /locus_tag="DSY_RS02810"
                     /old_locus_tag="DSY0518"
     CDS             581529..583181
                     /locus_tag="DSY_RS02810"
                     /old_locus_tag="DSY0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylate synthase"
                     /protein_id="WP_011459122.1"
                     /db_xref="GI:499778388"
                     /translation="MTNYIAALVDELYQLGVREAVISPGSRSTPLSVLFCEYGFQVYV
                     GIDERSAGFFALGIAKEKERPVVLVCSSGSAVAHYFPAIVEAKHSHVPLIVLTADRPP
                     ELRQVGAPQTIDQIKFYHDYAKYFEELALPEEREGMYRYVRGVMRKAYVSSLDQGYGV
                     AHINIPLREPLSPDLDGVDFTAGRLDYPFAWKTGEKGLTMDSSVFQDKKGIIICGGDP
                     YADYHREVLELAERLKAPLLADPLANFRNDDHPLIMDCYDAFLKSDAVKVELKPEFII
                     HFGQTPVSKRLQNFTAMHQDVLYFQVNDYFQYRDPSLSISRYLVASPKAFARSVKVHN
                     TDDGYSGRWQHYQARMRRRLNLAQDEEELFEGKLVQKLQDSLPEGSRLFVANSMAIRD
                     VDYFLEARRQRIKVLGNRGANGIDGTVSTALGVATSGHPTVLLTGDLAFFHDLNGLLI
                     GKNHGLNLIIVLLNNNGGAIFKYLPQSENKYFELLFMTPHGMDFSGLKTLYDLTYYEP
                     VDYESFAQNFQEALTLSGVKVLNVKIDARLSKELHDRLTNLD"
     gene            583209..584012
                     /locus_tag="DSY_RS02815"
                     /old_locus_tag="DSY0519"
     CDS             583209..584012
                     /locus_tag="DSY_RS02815"
                     /old_locus_tag="DSY0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase"
                     /protein_id="WP_005810064.1"
                     /db_xref="GI:492324882"
                     /translation="MTIEGCRYYAEVKGSGPTLVCFHGFAENSGTWEALQLQDCQMVL
                     VDLLGHGRSAKPRSLEPYELPVLLGHLHELMAELGCTGYSLLGYSLGGRIALAYGAAY
                     PREVQGLILESSAYGIGDEEQRALRREQDVRLAQEILDRGIEWFAEHWSSLPLFASQT
                     RLPPEIRAKIRARRLGNAPHALANTLLGSGQGVFPCLREKIPALSMPILYIHGEQDEK
                     YKGIGREFMDLNPGIKREMIPGAGHNVHLEKPAAFEKIVRSFLRELFNP"
     gene            584066..584905
                     /locus_tag="DSY_RS02820"
                     /old_locus_tag="DSY0520"
     CDS             584066..584905
                     /locus_tag="DSY_RS02820"
                     /old_locus_tag="DSY0520"
                     /EC_number="4.1.3.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810062.1"
                     /note="catalyzes the formation of
                     1,4-dihydroxy-2-naphthoate from O-succinylbenzoyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxynaphthoic acid synthetase"
                     /protein_id="WP_011459123.1"
                     /db_xref="GI:499778389"
                     /translation="MKFAWERSAAQYEDIIYETYEGMAKITINRPEVRNAFRPKTVRE
                     LMEAFMVAREDSRIGVIILTGANHGQGQDREAFCSGGDQRVRGHGGYVGEDQIPRLNV
                     LDLQRLIRVIPKPVIAMVNGYAIGGGHVLHLVCDLSIASENARFGQTGPRVGSFDAGY
                     GAGYLARIVGHKKAREIWYLCRQYTAQEALAMGLVNRVVPFGQLEEETVNWAREILRH
                     SPTALRFLKAAFNADTDGLAGLQQLAGDATLLYYTTDEAKEGRDAYQEKRSPDFQQFP
                     KFP"
     gene            584952..586313
                     /locus_tag="DSY_RS02825"
                     /old_locus_tag="DSY0521"
     CDS             584952..586313
                     /locus_tag="DSY_RS02825"
                     /old_locus_tag="DSY0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinylbenzoate--CoA ligase"
                     /protein_id="WP_005810060.1"
                     /db_xref="GI:492324878"
                     /translation="MVVNWLKKQALENPHKLFLNELSFQEVDRRVTDLAGRIYPFVKA
                     EDRVALYAHNSVDMALFFLALQALQIEVFMMNTRLTPEERAKKLKTLNIRVAFSDDDT
                     FIPLGRVLAGDYDGQARCREEDAPEKIAVIMDTSATSGDYKSVPLRRKQFAAHVQASR
                     QVLGVREEDNWLLVLPLYHIGGLAILMRSLYNGTRVTLMGKFDEEQILKGIEEGSLTM
                     LSLVPTLLMRIVNRIRRHHLRVVLVSGEFIPKSLVETCLEKGIPIYKSYGMTETTSQC
                     TTFCVAENPGKLDSVGLPLPGVTLRIVNPDGSGIGEVLVQSPLVMDGYLGQEPAGGFI
                     NTQDMGYVDEEGYLYILDRRKDILISGGENIYPQEIEQVLYAHPEISECAIVGMKDEK
                     WGQVPVLFVVSSLEDEEIMDYLARKLARYKLPRKIVHLRWLPRNATGKILKKDLAELA
                     YAD"
     gene            586303..587439
                     /locus_tag="DSY_RS02830"
                     /old_locus_tag="DSY0522"
     CDS             586303..587439
                     /locus_tag="DSY_RS02830"
                     /old_locus_tag="DSY0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoate synthase"
                     /protein_id="WP_005810058.1"
                     /db_xref="GI:492324876"
                     /translation="MRIEKIEVFHLCMPMKFNFKSSQALLHQRETLVIKVTDELGHSG
                     FGEVVAFKEPFYTGETLPRAKEVLLQRLLPQLLEGEIPHPFAIHSWPDLGYPMAVAGV
                     ENALLDGFTRRQQQSIMDAVFDEETQERIYGGMVLGDLEPAILLRQIEDYRQEGYVRF
                     KIKIKPGDGFAKLQRVREKYPDLMLLADANRSFQAEQIPELRKIDQLGLLCLEEPLAS
                     GDPVSYQRLQEQMLTPLCLDESIQTKADLIQAAELRACQAVNLKVGRVGGLAYVKQMI
                     EICRRHKIHYWIGSMMESGISKILHVHLASLKDNYIPGDLSSSRRYFARDVIQPEITV
                     QRGRIQVPRGPGLGVEIDEEALNYYALDHRVLERGVGPGINGSS"
     gene            complement(587436..587873)
                     /locus_tag="DSY_RS02835"
                     /old_locus_tag="DSY0523"
     CDS             complement(587436..587873)
                     /locus_tag="DSY_RS02835"
                     /old_locus_tag="DSY0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810056.1"
                     /db_xref="GI:492324874"
                     /translation="MLNSTQKSAAQTTHETAFDLSLVKDERIGDVLFLIASLIAIIST
                     YQAEETIIIEELSQTPQPDRSARTIAASSWTFLIGSILIAYVAIVRYRETTATVPDAS
                     PLMLKGRWFTAIGDIVSVIGFGLSALGDQLKAHAASEGPTIAR"
     gene            588222..588785
                     /locus_tag="DSY_RS02840"
                     /old_locus_tag="DSY0524"
     CDS             588222..588785
                     /locus_tag="DSY_RS02840"
                     /old_locus_tag="DSY0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810052.1"
                     /note="with AhpF catalyzes the conversion of alkyl
                     hydroperoxides to their corresponding alcohols; AhpC
                     reduced the hydroperoxide substrate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_005810052.1"
                     /db_xref="GI:492324870"
                     /translation="MSLIGKEVNEFKVQAFVEGAFKEVTKGDLLGKWSVFVFYPADFT
                     FVCPTELGDLADQYDEFKKIGVEIYSVSTDTHFVHKAWHDASDTIRKIRYPMLADPTA
                     KLAKDFEVYIEEEGLALRGSFVVNPEGKIVAYEVNSNNIGREASELLRKVQAAQFVAE
                     HGDQVCPAKWRPGAETLKPSLDLVGKL"
     gene            588791..590458
                     /locus_tag="DSY_RS02845"
                     /old_locus_tag="DSY0525"
     CDS             588791..590458
                     /locus_tag="DSY_RS02845"
                     /old_locus_tag="DSY0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="WP_005810050.1"
                     /db_xref="GI:492324868"
                     /translation="MKELYDLIIIGSGSAGMAAGIYAGRSKLKTLVIDRDRAGGQIKI
                     TSEVENYPGILNISGEELSQAMRRQAEKFGVKFRQAAVESVDLAGDIKKIRTAEGDYE
                     ALAVIIATGSVPRKLGFIGEEEFRGRGIGYCATCDGEFFTGMDVFVIGGGLAAAEEGI
                     FLTRYARKVTMIVRGDGFSCPQTISERVLAHPKIEVKFNTELREAGGDAVLRYAEFVN
                     NRSGERWRYDVREQKQTFGVFVFVGYIPQSAEYAQEVRIDERGYIPTDESMGTNVEGV
                     YAAGDIRPKELRQLVTAVADGTIAATSAEKYLVGKKERLGLGELGELGESGERDELSD
                     EEKTPVTRQGTSLLDDSLKEQLVPILERLENRIGLLAFLEGSSGFSEELRSFLSEFAG
                     LTDKVEVEFLNRGEDAVREKEAKITLFPAVAVLGPDGVYTGVQFHGIPGGHEINSFIL
                     ALYNAAGPGQAVGEETLAKIRRVSRKVNFKIGVSLSCTLCPDVVTLAQLMALKNPLIE
                     AEMIDVAHYPDFKNKYGIMSVPAIVVNDEKVVFGKKNLEELLELAGG"
     gene            590847..592859
                     /locus_tag="DSY_RS02850"
                     /old_locus_tag="DSY0526"
     CDS             590847..592859
                     /locus_tag="DSY_RS02850"
                     /old_locus_tag="DSY0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_005810047.1"
                     /db_xref="GI:492324865"
                     /translation="MMQMTRHVCPLKCYDTCSILAYTDNGRLLKITGDPQNSYTLGTL
                     CAKGYSFVKHVYHPERILHPLRQSSRGSGDWQRITWEEALGEIARQIVQIYNRHNHLL
                     PLGLLDGKANTGVLARSLSGMLSAMAPITEIRGPQSSGPGMDAQFLDFGRVRLKDPED
                     MKKADLIILWGVNPAATAIHQMKILQQARQRGAKVILIDVFPSATAGRVDETIVVKPG
                     GDGALALAVLRELMFKTSINYRFLVHEAEGWENLKDWLLEADPEEMRTIAGVTPQMVA
                     DLANELRHSSNPAFWLGKGLQKYSNSGQNIRAIHALAAAGGVTENYGEGIFAARSGFS
                     PFADLWDSDKWGNRKLSLPTLPVNHGDDGADIRMLWITQSNPLVQGTHLQKLRELMGG
                     LDLIVGTDFFLTSTSRCCDIVLPAATFLEAEDLVAGEWHRWIGLNEQAIAPLGETRSE
                     LEIAQSLAVAISEEAPGLCPFPVERPLSQWLERAVPPELCETLGIDSYRELKQGPRKI
                     VQPDMLSDSHYPKYRFSVPQAMEWGCPELPLMVLPETAPQGYPYRLLNWRRADFFNSQ
                     FAHLDWLLERQATDELSLSWELARQKGIGAGDKVVVYNSWGEVVLKAKIRHDLPLHLI
                     LCSARQDINGKSINSLAGSQETDLGQAVNGVNEPAFHDVFVNIARD"
     gene            593056..595410
                     /locus_tag="DSY_RS02855"
                     /old_locus_tag="DSY0527"
     CDS             593056..595410
                     /locus_tag="DSY_RS02855"
                     /old_locus_tag="DSY0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_015942787.1"
                     /db_xref="GI:506423068"
                     /translation="MEISRRNFIKASGGLAAFGMIGTGSLNRWIRPAAAEGAEEEKIA
                     YTFHPPNCGGRCSMKCTVRKGKLVKIEPNEWPDGHHKKVCLRGLSEVERVYSPDRLKT
                     PLKRVGERGEGKFVAISWDEALTTIADKLTEIKGKYGGKSILWSNSSGVQYPMSTLAA
                     LIGAQEHGALDFGIDMSQAGGQSIVMGPFNITNTNEITDWVNSNLVLLVGNNLLETSL
                     TDAAFFFDAKEKGTKMVCIDPVFSTTAAKCDQWIPLRPGTDSALYLGMIHLVLNNQWY
                     DQEYVRSYTSAPFLIREDNQRILRDEGNNYLVWDKNSDSPRPVDAPGILPELEGEFTV
                     NGVKVKTVLTAFTEHIRQYTPAWAAKVTEIPEEVITDLTREYALGGPASIQWGLGGPD
                     KWYHSDTTGRLATILAGLTGNIGRVGGGVGQGTQHVTCWSWVTAMGSWDLPPEFAPAP
                     AEVPFSDIPTASTSIKAFFFQGNMLHQMIPDYNTSLKWADSLEFIAVVDNQHCDSVNY
                     ADIVLPACSSFESEYDIAYLINERNHILLQQKVIEPLFESKSDFQIEKELAQKLGLDQ
                     YLPETPEDYVRALLNSPDPALQGITVEALKANQCIMRLNVPDQPYVAYLDRVFGTEST
                     KLEFYNELFLEDHCAFPVWEEPNEASPANPLYQKYPLMLGSPHARFRAHSTFSNARWL
                     LQINNEPLVRINPIDAQARGIQNKEFVEVFNDRGSFQCRCQIVNDMRPGMVQLSEGWW
                     SRYFQKGDLQEVTNPNKNPRGKKLLYGPIVAFLDTLVEVKKVEG"
     gene            595415..596026
                     /locus_tag="DSY_RS02860"
                     /old_locus_tag="DSY0528"
     CDS             595415..596026
                     /locus_tag="DSY_RS02860"
                     /old_locus_tag="DSY0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_005810043.1"
                     /db_xref="GI:492324861"
                     /translation="MAKLGITIDQSRCVGCNTCAVACKMQNNVPMGMLWNRVLTESGE
                     GLDSAEGEYPHLTKNWLTVACQHCENAPCVKVCPVGATYKAEDGRVLINYDRCIGCRY
                     CMAACPYNARVFNWQRPVRQPDFSCGDAPVRPSGVVEKCSMCKERTDQGLEPLCVVVC
                     PAKARKFGNLDDLNSPVSQAIRGKNSYRLLEELGTKPQVYYLR"
     gene            596040..597281
                     /locus_tag="DSY_RS02865"
                     /old_locus_tag="DSY0529"
     CDS             596040..597281
                     /locus_tag="DSY_RS02865"
                     /old_locus_tag="DSY0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_005810041.1"
                     /db_xref="GI:492324859"
                     /translation="MDNKQKNLIWFGILGLLTLAGLGAWLYQMANGLILTGMRNIVSW
                     GLYITAFMFFVGLSAGGLIVSSSATVFNIAPFKKVSLPAVLLSVVCVIMAALFIVVDL
                     GKPQRMFNLLLHSQFKSPLMWDVIVITAYLLISVLYLYFMTRPNPDQRKIRIMSRIAL
                     PVAIGVHSVTAWIFGLQIARVAWHSALMAPLFVASALDSGLALLLIVLLALNRSGKYK
                     VEDQLFSSLAGLLAVFVAVDAFFIGCEVLTFIYPGEEKVMNAVSLLFTGSLAPFFWGE
                     ILLGLFLPFLILVFARNRAKKSSILLASVLIVVGVFFKRVWLLFSSFVFPLVPGQLGV
                     TLGEFREGVDSIVIPNIWATAGSYSPTMIEGLIFLGIISSGILLFRLLFQGLISAQSP
                     KALLSENITSRSNTSQVLGGK"
     gene            597284..597964
                     /locus_tag="DSY_RS02870"
                     /old_locus_tag="DSY0530"
     CDS             597284..597964
                     /locus_tag="DSY_RS02870"
                     /old_locus_tag="DSY0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_005810039.1"
                     /db_xref="GI:492324857"
                     /translation="MKLSWEEVCSLRTNLYGFLGNCLLESVPEEGSVSMQREFWDKFP
                     LESANPQMKDGLNRIISCTEYLAKLPPSQASQEVQLEFMDLFLGPGQPKAPPWESVYR
                     TPERLLFGWPTQEVRKIYGKAGFEISRKNQLPEDHLGLELMFLAMASDTLARLITGKG
                     SKNKIFEMIKLQRDFISSHPLTWIADFHEDAYTKGTIGFYSGLIQLIWGILLWDLDLL
                     EEMSRSFV"
     gene            598140..598664
                     /locus_tag="DSY_RS02875"
                     /old_locus_tag="DSY0531"
     CDS             598140..598664
                     /locus_tag="DSY_RS02875"
                     /old_locus_tag="DSY0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_005810038.1"
                     /db_xref="GI:492324856"
                     /translation="MSWRFLVNPDLCLGCRSCEIACRNEFVHQGGARWRWLKEVEDHS
                     GLHYFLSLSCNHCENPECVRVCPEGTYRKRKDGIVLHDPWRCSGCGKCTHACPFHVPK
                     YSLSSGRVDKCNLCFHRLDKGLPAACVAACPVNALCHLFPNEPDPMDARGSVTGFTNI
                     LITKPSIRFIHSSI"
     gene            598707..599966
                     /locus_tag="DSY_RS02880"
                     /old_locus_tag="DSY0532"
     CDS             598707..599966
                     /locus_tag="DSY_RS02880"
                     /old_locus_tag="DSY0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CdaR family transcriptional regulator"
                     /protein_id="WP_011459128.1"
                     /db_xref="GI:499778394"
                     /translation="MDFAGIGTDFSRRAVMASHLEWVKQIARVQVENGGLMGLSRLLM
                     QKIEKTVVVTSDQGHVLSRHIWDNQPVVIQERLSLPQSVAASTEMTRGISTFGGHKCA
                     YYCWPIVNQKKEGYLWILTEKENLSAEEMENAEYLRSALLVEIVKKQEQLKLKQYLRD
                     GSILNLLFNNSDQLETMGQVWGRNLLITHIVMILEGQTKVPDHGLTEVRTKAENFLEA
                     KYPGTVTGMIGKHLVVLFPYEKKTREKDGQTNDNWKNIPRQAYSELQEILDDVKLWAS
                     VGSIYPDQPLLYRSYQEAKVALEMGKVLGKKEKLTFFNELGAIRLFYNQRKQDLRDFF
                     EETLGPVLKYDRTNDGNLLLTLWHYYASGGDISAATKGMFIHANTLRYRLRKVEELTA
                     SSLDDQEVRFNIYAALKVGLMLGIFEV"
     gene            600261..600509
                     /locus_tag="DSY_RS02885"
     CDS             600261..600509
                     /locus_tag="DSY_RS02885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_018307142.1"
                     /db_xref="GI:517118324"
                     /translation="MDFVLTGSIVLFPYNYAPKTCLLCDGKTYSMDQYIVLFSLIGDF
                     YGGNAEEGIFAVPNLMNASPFPGMNYYIVYDGIYPSRS"
     gene            600586..600849
                     /locus_tag="DSY_RS02890"
                     /old_locus_tag="DSY0533"
     CDS             600586..600849
                     /locus_tag="DSY_RS02890"
                     /old_locus_tag="DSY0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
                     /protein_id="WP_005810028.1"
                     /db_xref="GI:492324846"
                     /translation="MMVIDEDLEILLGAIYLFPYPFVPKKWLICDGRSLPTAQYEPLF
                     SLLGNTYGGDGKTTFALPNLIGAEPHPNMKYCIAYSGIFPQRP"
     gene            600869..602236
                     /locus_tag="DSY_RS02895"
                     /old_locus_tag="DSY0534"
     CDS             600869..602236
                     /locus_tag="DSY_RS02895"
                     /old_locus_tag="DSY0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate-binding protein"
                     /protein_id="WP_005810027.1"
                     /db_xref="GI:492324845"
                     /translation="MAINLALKKPTISSSYLQPYEPVRAVNGDYMTPMSRWLCTHLPG
                     WLTVDLGEVYSFDRWVVRQMPIAGWPSPDYCMSDFTLQGSNDAESWADLDNVAANTSA
                     IVDRMLTAAASYRYVRIYVTKGLNANDKFASLMEFEIYQAPPSLAGLIVKDNSDHTVE
                     LNPAFNSNTDSYQATVLLSVASVTLIPTVLDSSAVIKVNNTEVVSGTSSAPITINVGT
                     NQIEVSVTVAGVTKIYTIEITKAAAANPYLKAISITGNNKGAISLAQTFDPKNSFNYT
                     ALADYDDTNATVVLTADDPNAKLSVNGGASSSGPITFPVTMSSLGDYSTAIVVEAADG
                     TTTQSYSLKVTRPSSAYISSIDPIPAVTFIKDPGPGTGFVRDYYNYKVVTSTPFRIKV
                     FLEDYPNINKVSFQINSGSSTDLPHGNFTSPILAPAVGSDLVTITVTSKTGEATKKYI
                     IEVSK"
     gene            602312..606676
                     /locus_tag="DSY_RS02900"
                     /old_locus_tag="DSY0535"
     CDS             602312..606676
                     /locus_tag="DSY_RS02900"
                     /old_locus_tag="DSY0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall-binding protein"
                     /protein_id="WP_011459129.1"
                     /db_xref="GI:499778395"
                     /translation="MYTNLIKKTMTILLTLCLVLGMIPGHGVYVLAATNVPTGNYTIS
                     SNGDYQLDAGYSGKITIAETATAVRIIGNGAHTDTSISVESGRSSALELTIEDLNITA
                     PVSGGNSGEHGIDFSNTGNYGHKLWLKGNCLITGDQAGIAVNDGVQLTIDKAADVAND
                     ADAVLTVLGKNGSAAIGGYYKNNHTDYGSCGEITINGGTINATGAAAYPNFVYGAAGI
                     GGSLISVQGFTKGGTITINGGIITATGGEAAAGIGGGMGFNYNGASQGIITINGGTVV
                     ASGNKTGAGIGGGNTGGGYIININGGTITANGSADMAEGAGAGIGSSSFGFGSPTIVN
                     ISGGTITATGGTNSNFGGSGIGSGYLSEQGTINITGGSITAIGGSNGGAGIGGTSGNN
                     GEKVTISGNPLVKAFAGTGAEDIGKGKGMGGSSGTLKNGTDDWVYLKFHVTKEGSNVA
                     GATININSSQYTTDAGGYAYCFAPKSNTAYTIDAAGCQQASGTASNAKISNLVNVTMT
                     AAVTYTVSFESNGGSPVAAIPNVVENSTVALPTPPPTKAGYSFAGWYTDNDTFADEFT
                     AGTFVTGNLTVYAKWTPLPPATYTVSFESNGGSPVAAIPNVVENSTVALPTPPPTKAG
                     YSFAGWYTDNDTFADEFTAGTFVTGNLTVYAKWTPLPPASYTVTFESNGGSAVAAIPN
                     VVENSTVALPTPPPTKAGYSFAGWYIDNDTFADEFTAGTFVTGNLTVYAKWTPLPPAT
                     YTVSFESNGGSAVAAIPNVVENSTVALPTPPPTKAGYSFAGWYIDNDTFADEFTADTP
                     VTGNLTVYAKWMPLPPATYTVSFESNGGSTVAAIPNVAENNTVALPTPPPTKAGYSFA
                     GWYIDNDTFADEFTAITPVTGNLTVYAKWATLPTDDSSDRDHSTPSSTPTPPSTPPAT
                     VTGNVKDGATGGTVSNVTATVAKDSHNQITLTLPAAQIAVTKQPDGTITPLLDLAKVV
                     ITKDTGTQLSISANGTFQIANLAQGTDHTFKIGYDLGNGQKITIGTMDITVDPSGSVK
                     LDVTLIDPYGIITDGRTGKTLAGAKVTLYYADTARNKAAGKTPGTLVELPRLEEFKPN
                     QNINPQNSDPSGAYGFMVFPESDYYLVADKEGYEEYKSPTISVEQDLVKWDFKMNQPL
                     LGIKRFAGPTRVDTALEIAKATFTAKVKHVILATAANYPDALAGSVLAYKLNAPILLI
                     GSSSEEQEKVLEYISMNLDSAGTVHILGGKGIVGSEIEEKIKARGFAKITRIGGKDRY
                     ETALKIAEYLEVPQGTPVVLVYGEDYPDALSISSSAAAMQSPILLVGRNEIRPEISQA
                     LQKIKPIKVYILGREGKISSAVEKQVAEAAGLGADKIVRIGGTDRYETALKIAQYFNL
                     SGQNVSIATGKNFPDALAGSIYAANHNSPLLLCDEELSEEAAAYLRTRAMTGGTLFGG
                     EGVVSKAVEEMLKQIIGK"
     gene            complement(606795..608126)
                     /locus_tag="DSY_RS02905"
                     /old_locus_tag="DSY0536"
     CDS             complement(606795..608126)
                     /locus_tag="DSY_RS02905"
                     /old_locus_tag="DSY0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011459130.1"
                     /db_xref="GI:499778396"
                     /translation="MTWKDILKMCLRNLRRRKSRTLLTVLGVLIGCCSIVIMVSIGIG
                     TKVSQEEMLAEMGDLTIITVMVPNMGNDQNKLDDAGIRTIAQIPNVIAVSPKISPDEL
                     FNDIYFKIYAGIGDRYINDWLPVAAYDSSSLEKLGFKLVDGAYPATTKGVLVGEMFAY
                     NFRDSYRPEGSNRVDRYANIDFNNFDPDQLKNNMPDPYFNPLTSSLTLVLEKEGIAKY
                     SIPLEATGRVKEDYNKGYETSEGVLLDLAFLEQILKDSGAANNTTEKKSYQNALVKVN
                     HISKVAEVEKEIKRLGFDTRSMESIREPMEKEARQKQLMLGGLGAISLFVAAIGITNT
                     MIMSISERTKEIGIMKALGCYVKDIRIIFLTESGIIGFLGGVIGNVVSLIISLVMNFV
                     SEGAGGSKLSIIPLWLIGFAVVFSIFIGVGSGYYPANKAVKISALEAIKSD"
     gene            complement(608130..610706)
                     /locus_tag="DSY_RS02910"
                     /old_locus_tag="DSY0537"
     CDS             complement(608130..610706)
                     /locus_tag="DSY_RS02910"
                     /old_locus_tag="DSY0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005810017.1"
                     /db_xref="GI:492324835"
                     /translation="MKSTLQKLRYIMAMLLAIILIVSPLRTAAALGADTTGIKSNLAI
                     TGYKVTDTSGNILSSVPSGYPVNLEIMVKNPSIKTSDITSDSANTSNIDVSKLVDSFS
                     GDGSPAVTITSQATDPLAMTIKFTGIKYTGSGKTFKFMVGYKNLTVDYDVTDLTITEC
                     ADQENKPDNQVTPTPTLLITGSLNRDTLKPDQLMDLTINIENLSDSSLQDAVVTLNPS
                     ESIYLVAGKTTFFLDTIGGKQTRSFTVKIKTGSELPPASQSVGVDLKYNYDNGSAIVQ
                     GTASEKVNLISEIDESSEPILFISGVQTDEVLKSNGERDVTIKVTNMSDTMASKINVV
                     LTPSDSIYFPNGKNSFFLPNMKGNSEERLTVRIKAAGALASTLQSIGVEVKYSYTNGS
                     SIVQETATGKIIIVTADKSPAPVLFISGSQTKDILKGDEEKDVTLQITNMGETTASDI
                     TVSLNPSDSLYFPDGQSSFFLKEIKGHTEESITVKVKAASEPSSSLQTIGVDASYSYD
                     SGGGIVPGTASGKVVVVTESHKETDASVPYLIVSNYSYGGAPVAANTAFKLSMDFYNT
                     SSNLSIENIVVTLETGENFSVASSSNTFYYESLGAGQTLTQDLDLQALLVANSGQTSI
                     SGAKTVEVSFKYEYNTGSKRATNTMSEKLSIPIYLPDRFELAQPQLPDFVAVGQESVI
                     TLSYVNKGKNPISNVEAAIEDITGEMETPAKVQQLGNIEAGKSSTIGFAFMPLQPGEL
                     SFTIRITYEDANLEPVIKEFPVLVSAFDAPPPMDMGMPEMAPEQDSKIPLPWLIGAAI
                     VLLAGIGIAVMRIRKARAQKKISAIDFSWEEDAPAQDLPLTEDKTGGTAPSTDAPSKT
                     EV"
     gene            complement(610726..611433)
                     /locus_tag="DSY_RS02915"
                     /old_locus_tag="DSY0538"
     CDS             complement(610726..611433)
                     /locus_tag="DSY_RS02915"
                     /old_locus_tag="DSY0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide ABC transporter ATP-binding protein"
                     /protein_id="WP_005810015.1"
                     /db_xref="GI:492324833"
                     /translation="MDLEKPLIEIRNLRKEYIMGEEVVVALKRINFSINRGELCCIFG
                     ASGSGKSTLLNQLAGMEKPSKGGVKIGGVPISHLNEDQLAEFRQKYIGFVFQSYNLLP
                     MLTATENVALPLMFRGVPEGKRNAMAQSMLQKVGLGHRLHHYPGQMSGGQQQRVGIAR
                     AFVTKPAVVFADEPTGNLDTKTTKEVMTMIKNFAGTFKQTIILVTHDPEMTVYADRIV
                     KLVDGEIVSNETKKQTD"
     gene            611820..614888
                     /locus_tag="DSY_RS02920"
                     /old_locus_tag="DSY0539"
     CDS             611820..614888
                     /locus_tag="DSY_RS02920"
                     /old_locus_tag="DSY0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_011459131.1"
                     /db_xref="GI:499778397"
                     /translation="MLDRLRRYFKIKQLIAVIILLSTMLLMLSTIYYTDAPEQESPAA
                     VQGTLDLSSWDFTKDRSVFLNGEWDFYPGKLLQPEELPKETHYFMKVPGGWDKTKGAF
                     LQKSRGNGTYRLSVKLPELQEQLGLKIHNIWMAHRLFINGQLVKESGLPSDSLEGYQA
                     LNTPYVVVVEPAEELEIVIQVSNQVHFTGGIAHPIQLGLKNYIEKKNMLAFGGDMAVF
                     LLFLMFGIYHLHMYNMRDKEKTYLFSGLFLLSISIVSITFGEKVLMQVFEEIPFAVAY
                     KLQDFFLFASFAALTLFIQSLEPGTIKGRNLILSLMPVLIYLGVVILIPYHWYSPVKL
                     YITFYANLLLFFYIIRLIYMLFYKKQGKLPLNESVYIFLCCIFAGVIIIDYNLYYSGY
                     TNGNMIARLGIFAFLLSLNLFLSRRFTNKMNEVQALSEELIRSREIKDEFLARTSHEL
                     KTPLHGIINISGHLLKGETSSLSLEQRENLLLLQDTSSRLSLLVNDLVDIIKLRHEDL
                     QLNLITVDLYVVIQLVFQLLSFDLQGKEVKMLNKVKPMTFVEADENRLRQILYNITSN
                     AMKHTEKGEIVAQAREEGLDIVLTISDTGKGIPQEHWELVFKDFNHDSLPQQDYKQGM
                     GLGLYISRQLARKMKGEVWIADSVVNKGTSMAVRLAKGQCLNTEMTAGSVLERKVWSS
                     KPTSSGLSEKMKKILIVDDEPTNIRVLSLMLEGEYQVSAAYSGEKALESLKNEKFHLL
                     LTDLMMPGMSGIELTQQIRQNYSLIELPIIIATARNREREIELAYQNGANDYITKPFT
                     AEEVQWRVRSLLKLTDTMEKAFESEMAYLQAQIKPHFIYNALSNIIALCHEDGEKASE
                     MLSLLSRYLRHIFQRDQNQQTLQLQQELDLIKTYVEIEQLRFGKHLHYETYVDPEILK
                     KGIKIPTLLIQPLVENAIRHGLFNKEGEGTVSLRITEGEGFIHIIVEDNGVGMSEDEV
                     GRILNGKGGKGVGLKNVLMRVASLPKAAFLIDSELEKGTRCSIFLPKELV"
     gene            615095..616909
                     /locus_tag="DSY_RS02925"
                     /old_locus_tag="DSY0540"
     CDS             615095..616909
                     /locus_tag="DSY_RS02925"
                     /old_locus_tag="DSY0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_005810009.1"
                     /db_xref="GI:492324827"
                     /translation="MDLSAWNIQKDPTLKLDGEWEFYWNQLLGPEDFQPDGGRIPQLT
                     GYMRVPSIWSGKELNGTVLPAFGCATYRLVLKNIPYHGVLGLKKENVRLSSRVYVDGQ
                     ELFSDGVPSLTEAEYESGNNPQLGFYYCDGSELEIIVQAANYDYINGGIPVSFKIGEQ
                     TAMLSQQEKGNLLGFSVLVTLWSIALLYLIFFINARFFKRKAASLLSFAIFCFLFAVG
                     NALTDQRPLVMMLPDISFEAIFKMKDFFLSASLIVVTVIFYQARKGIISLRMTGIVSA
                     VYGCYLIAVLILPIYIYYKLHPFIMLLNTIVLIILLVRTTVLFLRCKKSDVLDYLLLF
                     IAILALNLYSADSILFALSLKTVSSLCQIYIITFAFVTIFRLSMHYYEVLANLRISMK
                     RTQDAEIAFLRSQIKPHFLYNALNSIAALCKEAPDQAEDVVIQLSEYLRGSFDFKTLD
                     SLTTVKKETELLEAYLNIEKVRFGKRLNVEYDIDESINLPIPPLILQPLVENAVRHGL
                     MSGVSGGTVKISIKKEMANVVFAIEDDGIGMEPSQVKRLLEQAPDENGVGLWNINQRL
                     RLIYGNELEVWSERGAGTRVSFQLPWNSQETSLSRGNL"
     gene            616936..618033
                     /locus_tag="DSY_RS02930"
                     /old_locus_tag="DSY0541"
     CDS             616936..618033
                     /locus_tag="DSY_RS02930"
                     /old_locus_tag="DSY0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_011459132.1"
                     /db_xref="GI:499778398"
                     /translation="MEVIVVDDEELSLNRLGNMLAGMPGVEVCGLFYTAAEALRYINE
                     NKPDAVFLDICIPETDGLALANKIKDIDGSAKVVFVTGYDEYAVRAFELEAVDYLMKP
                     ISRDRLEKTVQRLQRTLLGTDRQSNPQMKVSCFGGFRATVCESDSGSVNWRSPKTEEL
                     FAFLIFKRNVSRDEIANTLWDGLEPGRALTNINSTMYYIRKALSPHGLEKCIAATRKE
                     IRIDSELISCDLYEFERLLRGRPSSKDRVETLDRLAELYKGELFQGKAYEWSFAKSRS
                     LESGFISALLETAEYYREKRGYEQAEKMYKRAFEIDPFNEDICGHIIQICLKMGRKSE
                     ALRLYLQMEKFLMEELGEKPQAKLKKLFEEQ"
     gene            618168..623096
                     /locus_tag="DSY_RS02935"
                     /old_locus_tag="DSY0542"
     CDS             618168..623096
                     /locus_tag="DSY_RS02935"
                     /old_locus_tag="DSY0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459133.1"
                     /db_xref="GI:499778399"
                     /translation="MNYRKMKKLLGMLLVVAMLLPMIPVSPVYADTQTDWQLLGNGAI
                     TPQSTSFTSLPVDGGTTYAAVTVGTSKTAVYRLDESGNGQIGSDLEYAWNGSLYADND
                     TLYFAYLKGDSELKLVKYNLNDMGGAWETLGTPTILTMTNEISLYAHNGILYVVYAQG
                     GQAKLARYDEAGGGFSEIGSFANGYARSLSLKGDGDGNLYVSYIEVGYVNVKKLSSGG
                     STLEQVGGAVSDFGTDASLFVYGGTPYVAFTNILNSQDQKCVVKKFEGDSWLTVGSGD
                     GVSNDIAAGNSLYIDDEGTPYVAYEGGNGHNATVYRLENTSWVPVGYQGYASTGSASH
                     LSLAVYDGIAYLAYGDGHNSNAPVVRWYELPAPPPSSVWETVGSGPLSSPYSSFTSLF
                     INGGIPYLAFSDYWNGGDRIVAEKFVGNQWEVMGLNRYSAETVQDGAVYVDENTDTPY
                     LAYITYDADVKVLKLVNSGGVSDWNTVGSTTSLEDSARGLSLYVHNGVSYVAYADMAN
                     GDSPVVKMFASGSNVPVPVGDVGETLASYVSMKGDAAGNLYLVFESSPSDRIKVMKKP
                     YASDTWSMVGDFVSPGRTNGPSLYLYDDGSGNVTPYVAYADAQSDYRPIVRKFVGDEW
                     VTVGDDYVSEDFTWETSLYVDRDGTPYVAYVIGEGEYSRVFKLDNNSWVPVGGNGYAS
                     DGDSYGISLAVWNGVPYLSYIDHENEGKAVVRRYAPFGIAPTISAQPSHQTVTAGQTA
                     TFTVAATGDAPLSYQWKKDGIDITGATSSTLTITDADESDAGSYTCYVSNAAGNVTSN
                     AATLTVNPAPVAPAITGQPNNQIVTAGQTATFTVTATGTAPLSHQWKKDGTDITGATA
                     STLTITDAQASDAGSYTCYVSNAAGNITSNAATLTVNQPGSLVLTAAPGNQHVTLTWN
                     DIPEAAGYSVFKDNALLEAVTGSAISVTGLTNGTTYNFEVKALDSNAVVIAASGQVSA
                     TPVTTPGIPTGITAVAGNGEATISFTAPSDHGGSPITGYIVTSSPGNIAATGTGTTIT
                     VTGLSNGTTYTFTVKAVNAAGNGTDSAASNAVTPQRPRSSDDESSGGNTTPVSSTPSG
                     VTQITVDVKQGNTDSTVAQITVERRTGSDGKKTDTVTYQESKAAETVKKLKEENRDTA
                     RIVIPDEKDEVAETKVNIPVQALEVLAQGGINLQIDTEEAKIDIAKKTITGISQEVEG
                     DLYFRLVPVKDEAQKKSTIDQALLKAALISGNTDSSLSIVGNPVTIETNMSSTEADIT
                     LPLTGMTLPSNPAEKAALLQQLAVYIEHSDGDKELLQGELVEYKEGVYGIRFHINKFS
                     IFTVVRTDAFLASSAAKSLRLFGPNRVETAIAIAQASYPGKVAQAVLATADNYPDALA
                     GSVLAYKLNAPLLLVGKTAKEQEALLAYLKDHVETQGTLTLLGGNGAIPAAVEQTLQA
                     NGYSQIIRLGGANRYETALKIVEELKVEQGRPVILAYGGNYPDALSVSSAAAVLQSPI
                     LLVEKNGISEGVKDKLTQIKPSKVYIIGLEGVITQQVEEEVARLTSLKQENIVRIGGT
                     DRYQTSLAVAKYFNLSGKNIGIATGNNFPDALAGSVYAANHNAPMLLLNDTIPGEVMD
                     YLKSRELTGVTLFGGEAVLNAEIEQKLRELIK"
     gene            623263..624354
                     /locus_tag="DSY_RS02940"
                     /old_locus_tag="DSY0543"
     CDS             623263..624354
                     /locus_tag="DSY_RS02940"
                     /old_locus_tag="DSY0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_005810004.1"
                     /db_xref="GI:492324822"
                     /translation="MYTAIIVEDELNILKHMNKLVVSMDEFLIKGTFATPHEALAAFP
                     DLMPDVAFIDIEMPRMNGLELARRLLKVKDDLSIIFTTAYGQYALDAFEVEAIDYLMK
                     PIMKEELQRVLKRLNRVFNIQKRQSPLLKRVPSFAVRCFGAFEVRDQQQQMVRWPTRK
                     AEEVFAYFLANQGRYISKWELLKIFWPEIEEERAIPNLYNTIYRVKQVLKKLPLSPKI
                     QKINEGYILEAQRNLSDLGEFLEVMKQSKENTDFPLEASISLFFSYATPLFGDKDYFW
                     SLHIEKYVAQEYGKLCHKLLLHYYEQNQLQKGEEIIQHYMAQYIEDEDMLRKWLKLVA
                     HWQGYEEKSDEYRHRFNEKLASAELPLLE"
     gene            624767..625786
                     /locus_tag="DSY_RS02945"
                     /old_locus_tag="DSY0544"
     CDS             624767..625786
                     /locus_tag="DSY_RS02945"
                     /old_locus_tag="DSY0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_005810003.1"
                     /db_xref="GI:492324821"
                     /translation="MKFGNYRFSSNKAILFALLLVLCFTLLGYSQQNVFPQENSLKTV
                     GILMGSDLRTNKVNGVIEGLKKYGYEENVNIRFRIVSAQDRIDDLPELAQELVRQNPD
                     LLIGTGERETLALQKAAADSQIPIVFIGVGFAEELGLVDSYTHPGGKITGVDNYYLQL
                     SGKRLEYLKRLLPDVQKVMVLYDETITPVEPTMDFLNRVAAQLDMTVIPVGVKNEAET
                     LKAINGILPGEADGVMLLCSLLMESVTDSISPLIQEKRLPAFGVSANQTKKGFLASYG
                     MDYREQGIQASRIAAKILQGQDPGIIPVEAPARVDFIINTKVAEVFKAGIDPAGFACA
                     SEFIR"
     gene            625822..627660
                     /locus_tag="DSY_RS02950"
     CDS             625822..627660
                     /locus_tag="DSY_RS02950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_005810002.1"
                     /db_xref="GI:492324820"
                     /translation="MNMSKHARRFQSIAFKLLAFSIIMSLIPLLFLGGSNLMRAKDYL
                     WESVRNQHSYGTSRVVKEINFLLEEAERVITVLAEANGTVLISSDTGEQERLLYSCLT
                     NLPYVERMSLLDGKGYEITGVSRFDIGKSGASQEKDVENIFKSIKNFQTYIGPVLLDQ
                     HGQPYFQLAIPIILQGNDVKGAVVADISLRSVVDLLSKVAGTSGAWLFLVDQEGHLIG
                     HEDFSQVLSNRNVQASLPLLSEEEEELTRENPLVRTYLSYTGEKVVGAYAKVSGTDWA
                     VIYEQPESKAFSSYIHLRNTFGLSTVILMLLVLGISLFFVVYFLRQLDILKKGVKRIT
                     SGEAGFVLPVQSQDEIGEVLTAFNELSEELKKKRELESALRQADKMASVGLLAAGIAH
                     EINNPMATIGLSVEELRYELQRMNSAQGEKDQDIDRYLDLIARQADRCSQITQNLLDF
                     SRQERNQNNAYDFYNLNELVQKALELNHYMLQKNQVQVRYDLDGAVPLIWGDGPGIQQ
                     VIFNLLCNAAQAMKQGGALKLVTQNEADCVCLQVMDNGEGISNEDLKRVFEPFFTTKP
                     PGLGTGLGLAVSYGLIKQAGGTIVMDSRLGEGTTVTVKLPHTKEVQ"
     gene            627662..629032
                     /locus_tag="DSY_RS02955"
                     /old_locus_tag="DSY0546"
     CDS             627662..629032
                     /locus_tag="DSY_RS02955"
                     /old_locus_tag="DSY0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005810000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_011459135.1"
                     /db_xref="GI:499778401"
                     /translation="MKLLIVEDEVDFATLLKQRLTRKKINIDLAHTIEQALDWLGKVS
                     YDVILLDQRLPDGEGLSLLTHVKEADPFVEVVVLTGHGSLETAIQSIKQGAYDYLTKP
                     CNTTKLEFTLTQAYEKKRLAEQAAGLSEALRRQTGSEPIIGQSSEIKGLMQMVEKVKD
                     SEATILVLGESGSGKELIARSLHFWSARKDKPFQALNCAALPNQLVESELFGHEKGAF
                     TGAAGVKMGLIEIADGGTLFLDEIAEMDLDIQAKLLRLLEYGEYFRVGATRSRKVKLR
                     VVAATNKRLEQEVAAGRFREDLYHRLNVVQIEVPPLRNRKADIPLLADYLLAQKCPQN
                     NPKVLSPEALEVLLSYDFPGNVRELANILERGCLLSYGPTIEAEHLFQPQMGKRTPVS
                     KKGLEEEAPRWGDTDLSLENCERQHILRVLKMAGENKTKAAQELKIGLKTLYRKVKEY
                     GIEPLP"
     gene            629222..629980
                     /locus_tag="DSY_RS02960"
     CDS             629222..629980
                     /locus_tag="DSY_RS02960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="WP_041272209.1"
                     /db_xref="GI:752602822"
                     /translation="MKRRDFIKLTAAAGMVTASGLGYDSMIMAEQPPGFIPKKTGSQE
                     VEARIDATSGKVEVNPNILMRNSACLGCYSSCGNRVKINKETGLATRVMGNPYNPSSA
                     QPHLAMETSLLDSYLSFSTYRDMGNEGRAALCARGNATLTAHHDPNRILVPLKRADKR
                     GEAKWQPITWEEAVKETVEGGTPFAHLGETTPIEGIKDVHDPNNPMDMANPELGPKSF
                     QLVNIGGRGDGRTAFAGRFAGAFGTPNNFSHGYT"
     gene            630029..632311
                     /locus_tag="DSY_RS02965"
     CDS             630029..632311
                     /locus_tag="DSY_RS02965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_041272210.1"
                     /db_xref="GI:752602823"
                     /translation="MRPDVNHAEFILYIGAFPGHSGKPMSTIARQVAQQTGEGTLKIV
                     VVDPVMCGGAISPVGKNTKWIPIKPTTDSAFIMGMLHWIIENQRYNEDYLSSPHLAAA
                     KSKGFASWCNASHLVIVDESHPNNRKLLRAEDLGLAVPPSTDPTKTVDYFMVIDPETN
                     QPAIYNQVSRADLVFDGEVQAKSGGSIRVKTAFAILKESVFSQGIAEYSQICKVPEET
                     IMDIAREFTAHGTKVAVDGTGNTASANGYDIANAMHVLATMVGCHNLKGGMLERRVAY
                     KSLVKGPRYDLGTVANAPNIKGKGILLSRTGVPYEKTPEYKQKVAKGENPYPSKLPWH
                     PIGSASDNQAFFSVINSYPYQTKILMLWMANPLMSVPAAGRQEIIDELKKVARVPLII
                     AMDAFMAETTALADYIIPDTTPYESWGLANNEGNTSEKVTTLRWPVVEPLTAKLSDNR
                     HACYENYIIDVAKAIGLPGFGEKAIKDTDGNTYALNTPEDYFLRGVANVAFDGQPVPD
                     LTDEEMQIQDLESCMQNWKDCLKPEEYRKAVFILSRGGRFEEFGQGYAGDRTKYPQEG
                     CFNLYGEKMALAKNSFTGQYFRSGTLVYNPETLADGTSLDQLFPEAEWPFKAAAYKPK
                     FRSVSMLENSILRELNQTNKVEINPEDAAQLGLVSGDKVRLVSATGGEAEGILQVRQG
                     IARGSVGIAYGYGHWEYGVKKHTLGEKELSALPGAGQGVFHSGISLIDPKVKNGIFGF
                     SEMSTGGTSRNGGAFKILKV"
     gene            632318..633013
                     /locus_tag="DSY_RS02970"
                     /old_locus_tag="DSY0548"
     CDS             632318..633013
                     /locus_tag="DSY_RS02970"
                     /old_locus_tag="DSY0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459137.1"
                     /db_xref="GI:499778403"
                     /translation="MKMQDAMNWTRDRFHSYAFFSSLLLEEPTLEKWLTIQKLSNSGE
                     VPETQKGIKGPEEAQAALERLRQDYYDCFFVPMSGKYVPPYESALRGYQQKPKPSFGK
                     LNTSLTVQVKQHYELTGFDPYGLELFSPLKNIPLADHVGFELAYMTYLCRQEHEARKE
                     ARQDKAERWLEIQKEFMADHLLMWIPGMAAALRTLEKGFYAQAIRILEIWLHDDDQDM
                     KNYFSRGGVCVEC"
     gene            633003..633608
                     /locus_tag="DSY_RS02975"
                     /old_locus_tag="DSY0549"
     CDS             633003..633608
                     /locus_tag="DSY_RS02975"
                     /old_locus_tag="DSY0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_011459138.1"
                     /db_xref="GI:499778404"
                     /translation="MSAKLEPRYGMVIDLRRCVGCHSCTVSCKMENNVPEEAYRSWVI
                     EGDKGIYPNVTRVKLPRLCNQCQDAPCQTVCPVKATHKDEGGVIVVDPDKCIGCRYCI
                     AACPYDARFLNKETGMAEKCDLCIGRIKAGLMPACISNCIAHARIFGDLNNPDSEITR
                     LLAEHPAQALRSDLGTRPSVYYIGLDEAFDGVSLNDLERRK"
     gene            633610..634632
                     /locus_tag="DSY_RS02980"
                     /old_locus_tag="DSY0550"
     CDS             633610..634632
                     /locus_tag="DSY_RS02980"
                     /old_locus_tag="DSY0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_011459139.1"
                     /db_xref="GI:499778405"
                     /translation="MDFSFVYEIQHHAAFGPLIVLYFFLAGLSAGLFLISALSTVFGW
                     QAVKPLAKPAALTALAVLIPGLLALVADLGRPFRALYLFLNVNPSSLMSWGSFILLFY
                     GLVCVPYIWFLWRDQEKNAKTWGKVGVVLAISLGLYTGFLLAVVPGKPLWNSALLPVL
                     FLVSGCVAALSLISLAKKAFVQGGAAGAAYESALHSLKVWFVVLEICLVFFHLLTVYF
                     LSGLGELTVMNLLAGEKAFTFWAVQIVVGIVAPLILLSLKQSPYSMGIAGLCSLLGVF
                     ALRYNFVYGGQELPAAGTQLYHQGGGIEWLSVLVLLGLGVVLIVTLPYLSQRLLHPTS
                     SKSISG"
     gene            635066..636271
                     /locus_tag="DSY_RS02985"
                     /old_locus_tag="DSY0551"
     CDS             635066..636271
                     /locus_tag="DSY_RS02985"
                     /old_locus_tag="DSY0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_005809990.1"
                     /db_xref="GI:492324808"
                     /translation="MAKENKAQVVMIAAITALCILGDSMLYVVLPTHWQEAGLTSFWE
                     VGALLSINRFIRVPLNPIVSRLYRKLSHRKGIILAILLSAMATASYGISGFWFLLLMR
                     AIWGIAWTFLRLGAYFFILDISADENRGHYMGIYNGIFRLGSLVGMLAGGIIADIFGM
                     KAVSFVFAGITLSALFLVYYSVYPSAGPTTPLATAAPPATYPLKLTNVWKDSQIIWML
                     LTGFLVTMLYQGAFTSTLSHLIDLRQTQQMAHVMIASASLAGIIQAIRWGWEPWLAPW
                     FGRKSDHWGRRPVLIIALLAASVLFALINTGVPFGIWIAIIFGVQLTATVLTTVVDAV
                     AGDVASQTTVKTSIMTAYSIVTDLGSAVGAVSVYLIASAINIEVYYWGAALILLLLAF
                     KWAAALRKA"
     gene            636377..637363
                     /locus_tag="DSY_RS02990"
                     /old_locus_tag="DSY0552"
     CDS             636377..637363
                     /locus_tag="DSY_RS02990"
                     /old_locus_tag="DSY0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809989.1"
                     /db_xref="GI:492324807"
                     /translation="MKHKVLGIVLGVEGAACVLFGILQTSFSSGFTAAMAFPFEQLGL
                     LLRMLSLSGGAGNAAALLIYGAAALLPLLILFILSRKRELQREDGLLALLSVVLFPVL
                     YFMTNPGMIGSLFGGALGGSGGAGLAVGKAVLGGTVYSLVCGYFVLRLLRLCFESSTV
                     RLQHYMMVLLSLLTVVFVYLIFGASFRELLHSLADLKAGNNGNEHLLGVSYAFLALQF
                     AVNALPYIFDVLVAFAALRLLEDMGADRYSAESVEGADRLARLCGTALAATVLSSIAF
                     NLLQLLFAQKLLVISSSVQIPVFSLAFVLAVLLVARFMEENKGLKDDNDMFI"
     gene            637374..637601
                     /locus_tag="DSY_RS02995"
                     /old_locus_tag="DSY0553"
     CDS             637374..637601
                     /locus_tag="DSY_RS02995"
                     /old_locus_tag="DSY0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_005809987.1"
                     /db_xref="GI:492324805"
                     /translation="MGIQVHLEDVLKARGMTSKELCALVGITEANLSILRSGKAKGVR
                     FGTINKICWHLKCDVGDILKFDGKLEEEDED"
     gene            637591..638583
                     /locus_tag="DSY_RS03000"
                     /old_locus_tag="DSY0554"
     CDS             637591..638583
                     /locus_tag="DSY_RS03000"
                     /old_locus_tag="DSY0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942807.1"
                     /db_xref="GI:506423088"
                     /translation="MKIKGRFMGLCLLVFIGCFLTGCQLAKEEGSAGRYEDRLVGVLV
                     TTEYLDLFDFAGYVEDHIGSFSGGEVQIDGAGEKYQGRLYAELTKEILTDVESGHKVE
                     REEYDFPGVEGIAYYSLRVPDTEEREGYFTTGSDEGISDGHTSLHSSDGGNSVALEGT
                     VYVSPGLGRTYYFNPMYQSADGRVYVTSGSGISSGGEQSEGEALTQTMKADYTVTENG
                     RTVKDSISVQLSIHMMYPPEEIVILQMGEDGAVISRGEYGPGEVPERITPEKDTAYLI
                     VETKKRDNSGRILKDRAIYDRDKEYLEAFFCREDGICIKKQVPIERELPSLSAL"
     gene            638787..640367
                     /locus_tag="DSY_RS03005"
                     /old_locus_tag="DSY0555"
     CDS             638787..640367
                     /locus_tag="DSY_RS03005"
                     /old_locus_tag="DSY0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011459143.1"
                     /db_xref="GI:499778409"
                     /translation="MNWTTFVTLILWEMGMWVINRRYTLTTIVIGSILCFVMILFYLL
                     SLDKIRDIYIGETQKTVYGLKKSFLANTVDNMISVIDHRRDARAEAMERFVNRTAVAI
                     NLKKGLADAEFNDFLISFFRDNPDYSFMSVILWDVGKDRAIYDGQNLAGSTWESTLNA
                     VIPGLSAYTVLDHGAKKILLGVSKTYVDELVKTEIADIIRNSEFEGNTYIWVNEILNY
                     EGGPHYAIRRVHPNLPETEGTYLSTEMRDIKGNQPYLTELEGIKKDGELYFEYYFKEL
                     NSEKVSLKLTYAKLYKDYDWVIAMGVYQDDIQAYIDQTTEKSQVLASRLTLLLVLLFV
                     AILILSFSLMVLIEKRHYRKSRKIMESEMNQDPLTMAGNRRSGTHDLSAAFKEYQASG
                     YSPGIMIYDLDSFKSINDQYGHSVGDLVLIEVVKAISGMIRSSDKIIRWGGDEFVVIF
                     YGLQEKNALVFGERILSKVSDLKILVAEGKEIGITLSIGFSFFKETDEDFAKVLKRAD
                     QALYLSKSKGRNQVNIIL"
     gene            640484..641023
                     /locus_tag="DSY_RS03010"
                     /old_locus_tag="DSY0556"
     CDS             640484..641023
                     /locus_tag="DSY_RS03010"
                     /old_locus_tag="DSY0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_011459144.1"
                     /db_xref="GI:499778410"
                     /translation="MTRLLVLGMLEVQPMSGYDIQQALQLTDAERWGGVLIGSIYHAL
                     KKMEQEGYVAVTSIERTGHRQKAVYSITEAGKIYLQELIKDALKMSSVLYPSTLYSGL
                     SFYEKLAKDECRKALQQQRSALEEEYNAVKQGLAAKDAAMNHKIPPMVMLVMDNMLSL
                     IKQQQDFVDKALELLDTEN"
     gene            641110..641829
                     /locus_tag="DSY_RS03015"
                     /old_locus_tag="DSY0557"
     CDS             641110..641829
                     /locus_tag="DSY_RS03015"
                     /old_locus_tag="DSY0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_005809981.1"
                     /db_xref="GI:492324799"
                     /translation="MNLIEAKGLRKRFRSREVVKGIDMEIQQGEILALIGTNGAGKST
                     TLALLLGILPTDAGKITRWREDYRAHVGVQLQATPFFEGYTAEENLRLFAALYHVKLD
                     KKQIDAKLAECNLQEARKTLASRLSGGQQKRLAIAVTTIHNPDLIILDEPASGLDPRA
                     RQEIRRMIQQLAKNKVTVLFSSHDMEEVSRIANRIILMHDGRIVAQGRPDRLLEQYHA
                     ENLDDLYLELTDTVPGKETQR"
     gene            641826..642542
                     /locus_tag="DSY_RS03020"
                     /old_locus_tag="DSY0558"
     CDS             641826..642542
                     /locus_tag="DSY_RS03020"
                     /old_locus_tag="DSY0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_005809980.1"
                     /db_xref="GI:492324798"
                     /translation="MKTLFSLTFKSASRDPFLLLWSILLPIGGMVGLGMLIKSPEYPQ
                     SIVTGMMAVSILFYAFTTTSFAILAQRRRGVYHLLRVTPLPLWQYVCGLSGAWTLISF
                     LCALLVLLSGVFVFKLNVSLPSFLAMIPIILVATLSYVFFSFVIASLSRTENNVSLLT
                     NLVTMPLLLSSSAFYSLNNAPAFIQAINRWNPFQWLVNGLRSAFDLAWADYFANMGLT
                     SLVAMAALLLALKTFRYAEV"
     gene            complement(642642..642884)
                     /locus_tag="DSY_RS03025"
     CDS             complement(642642..642884)
                     /locus_tag="DSY_RS03025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_005809979.1"
                     /db_xref="GI:492324797"
                     /translation="MNISQAVIRRIEELCRERHLSINALSNISGITQSTVNDIMSGKT
                     YNAGIGTIKKLCDGLGLSVRDFFDSELFSNLEQEIK"
     gene            complement(643405..643884)
                     /locus_tag="DSY_RS03030"
                     /old_locus_tag="DSY0560"
     CDS             complement(643405..643884)
                     /locus_tag="DSY_RS03030"
                     /old_locus_tag="DSY0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_005809976.1"
                     /db_xref="GI:492324794"
                     /translation="MEFKMGKGSQDFILNKIETLMTKLTLGNHEEEEWHTLLSESDLA
                     YRDQVTLSECHIIDYIGKNRLTNAIGIATNMNITKGGVSKITARLVKKGFIEVHRLEG
                     NRKEIFFTLTNEGKKIYELHDKLHVRVCQRITDLFDSYTESELQAIGRFFSELTDIV"
     gene            644103..644681
                     /locus_tag="DSY_RS03035"
     CDS             644103..644681
                     /locus_tag="DSY_RS03035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="WP_005809975.1"
                     /db_xref="GI:492324793"
                     /translation="MRIDLTYKLTRGMLDKFLEGVQNDGKYQKFGHIGTHFDVMDKSF
                     PLEYCELSGKVFDVSNVENRDIESGDFEMDEVEEKDFVIFHTGMMDKEGYGTEPYFRQ
                     HPQLSYELIRELIKKNVGLIGVDFAGVRRGAEHAPADQLCADNGIFIIENLNNTKQLL
                     EAAGAHSFTMHTYPLNLGGATGLPARVIAELA"
     gene            644815..645705
                     /locus_tag="DSY_RS03040"
                     /old_locus_tag="DSY0562"
     CDS             644815..645705
                     /locus_tag="DSY_RS03040"
                     /old_locus_tag="DSY0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459147.1"
                     /db_xref="GI:499778413"
                     /translation="MDDLLTERTPLLIATEINTIKQQTGKILLASAIEVGRRLREAKE
                     LLPYGEWTEWLEESVSYTERTAQNLMRIFDAYGSQQIPPAGAVSRKAGALNSGSPTSE
                     DQVQKQGPPPNLNYTQALLLLGVPEEERFQLMEELDLESMTTRELEKAIQERKQAAAE
                     RDQALQENAELQKTVEERDSRVTHLTKERDGLKKKAEELAGAKTKEEAKVEKLSMDLE
                     SKKQSTSAKAIDRMSRNLDAAYHKAKANRIAFLYESMERNFRELRHELKEFAAKEPET
                     YEVYRDKVMDFLTKGMKEKL"
     gene            complement(646109..646495)
                     /locus_tag="DSY_RS03045"
                     /old_locus_tag="DSY0563"
     CDS             complement(646109..646495)
                     /locus_tag="DSY_RS03045"
                     /old_locus_tag="DSY0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_011459148.1"
                     /db_xref="GI:499778414"
                     /translation="MFSIGVCDDRPLCRQLLEEFILLYEKEKGILFDIHQFGSGEELL
                     EELHKLDMILDLLFLDNSMKKLTGLETAKLIQQSDSMSACSIVFVTADDDHDQFMQIQ
                     PLQVVGKPVTRECIDAILDKVLAEKA"
     gene            complement(647038..648201)
                     /locus_tag="DSY_RS03050"
                     /old_locus_tag="DSY0565"
     CDS             complement(647038..648201)
                     /locus_tag="DSY_RS03050"
                     /old_locus_tag="DSY0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_011459150.1"
                     /db_xref="GI:499778416"
                     /translation="MSVVHQVYGYYMPTVNLMGAGAAQEAGKQAKILGGKTALLVTDA
                     FLNQSGLAKQIAEIIEAEGVKVVIYPGAEPNPTDKNVHDGVAVFEKENCNMIVSLGGG
                     SAHDCAKGVGLVAGNGGNIRDFEGVDKSAKPMVPMIAVNTTAGTASEMTRFCIITDTD
                     RHIKMAIVDWHATPNVSINDPLLMIGKPAPLTAATGMDALTHAVEAYVSTAATPITDS
                     AALMAIKLISKYLRRAVANGQDFEARDQMAYAQFLAGMAFNNASLGYVHAMAHQLGGF
                     YNLPHGVCNAILLPRVSRFNLIGNLERFVDIAEALGEEIKNLSARDAAEKALTAMTTL
                     SQDISIPSGLTELGVKEEDLQTMAVNAMKDACSLTNPRLAKLEDIIQIYKNSL"
     gene            648537..650408
                     /locus_tag="DSY_RS03055"
                     /old_locus_tag="DSY0566"
     CDS             648537..650408
                     /locus_tag="DSY_RS03055"
                     /old_locus_tag="DSY0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011459151.1"
                     /db_xref="GI:499778417"
                     /translation="MNVHWRKFLKGELIENGIAPMIYRSWQRSLSYNVNHTEISQNMI
                     LTTSQLRELKDAQEDIIRAAEFVLPHLGKLLQSANYTVLLGEKKGFILEALGDGPFLT
                     KAQKIHLSPGANWREDIKGTNAIGTALTEDCPITVSGCEHFVQENHFMSCWAAPIHDV
                     QGEIVGFIDISGETGNHQEQIIGIAILGAKLIEQNLRTLDIERQLKFYREGAKLAIDL
                     LKEGFISIDRFGVVTNISPSGASLIGRKRNDIIGKPVAEVFSAPKGWIVNNQALDLHL
                     KNQSGHEIASSWRRVADESGEFLGAFGTVQLTEPQTASPVWVGSSPSSRQIMDRVYKA
                     AAAPSSVLIQGESGTGKEIVARMIHDFSSFREGPFVALNCAALPSSLLESELFGYADG
                     AFTGSRRGGQPGKFELAHQGTIFLDEIGDMPLTAQVALLRVLQEKEVTRIGGTKPHKV
                     NVRIIAATHKDLKSLVEAKMFRLDLYYRLKVITIELPPLRERLEDIRDLVPYFIQKSC
                     TLNQLTCFGIEDNVYPYLYAYSWPGNVRELENCIESMIAMANSHVLTVDDLPWELRQT
                     PDSKRIESPSLLDQQTKQTILAALAQTQGKIAPAARLLGIGRNTLYRKIKEFDISVF"
     gene            650668..652662
                     /locus_tag="DSY_RS03060"
                     /old_locus_tag="DSY0567"
     CDS             650668..652662
                     /locus_tag="DSY_RS03060"
                     /old_locus_tag="DSY0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_041272211.1"
                     /db_xref="GI:752602824"
                     /translation="MLKSLATKFVFLISILLIIVCGSLGFISNHFSSQAVLKEVNQSL
                     EILSRETALELKNDLERQLGLLELLANLEAIKDPEVPAEEKVRVLKSEIQRAGYIDLG
                     IADLAGNLINGQGVAGVNIADQDYFKEAIAGKAVASDPKTSKVDDSVITAYAVPVKHG
                     SQIIGALIATRDGYELSRFTQSIELGGSRAIFVINGQGTAIANADLEKVKTMDNIFKN
                     AEKNPGLADFAALQKKMVAGESGVGSYTYGGIKKYTGYAPVEGTTWSLAVTAPQKEVM
                     AGVDNLRKILIICSFAFFLIGIVAAYGFTRTIVGPLNQLVVKIQEVAKGNLAVKDVEV
                     KSRDEVGLVGDALNTMLGSLRDLVNTAGDLAEQVAASSQELTTGAEQQAKAASEVANT
                     ITNLALGAENQEKSVDEITASVEESSATIEQLAVNSNRVAQQTKEAATASSQGQKSAL
                     RAVEQMKNIGEVSVKVQSAVDRLAVSSQEISEINDVISGIAEQTNLLALNAAIEAARA
                     GEQGRGFAVVAEEVRKLAEQSQAAAKQIAQRITLNQSHITEAVTAIELSSEDIQSGIE
                     VVNTAGGAFEAIDTLMSMVSSQVAEISTAIQQLAQGSQGIVQAVRSLESITKENMDTS
                     QTVSAATEEQTASIEEIAASSQNLAAMAESLQVSLSKFTV"
     gene            complement(652823..653113)
                     /locus_tag="DSY_RS03065"
                     /old_locus_tag="DSY0568"
     CDS             complement(652823..653113)
                     /locus_tag="DSY_RS03065"
                     /old_locus_tag="DSY0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272212.1"
                     /db_xref="GI:752602825"
                     /translation="MSVKAYLEITMVIKEADRPAAGKIYADYRQPFLRQIKGALTKDL
                     LIRGEDVQVLHGFDSVENAQAYLTSDLFKNDVFVGLKPLWSADPDVKIYTVA"
     gene            complement(653234..653617)
                     /locus_tag="DSY_RS03070"
                     /old_locus_tag="DSY0569"
     CDS             complement(653234..653617)
                     /locus_tag="DSY_RS03070"
                     /old_locus_tag="DSY0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459154.1"
                     /db_xref="GI:499778420"
                     /translation="MKYEPKIEKEIMCPIEYGLDVFGGKWKARILCVLSTNSVIRYNA
                     IRKELGNITDAVLAAMLKELMADELIERTQYNEIPPKVEYALTDRGRSVLPILQNICQ
                     WSRQQTKDELEKKLPPCKTCDQLKK"
     gene            653766..654245
                     /locus_tag="DSY_RS03075"
                     /old_locus_tag="DSY0570"
     CDS             653766..654245
                     /locus_tag="DSY_RS03075"
                     /old_locus_tag="DSY0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="WP_011459155.1"
                     /db_xref="GI:499778421"
                     /translation="MSKPLIVYYSYSGTTRSLAEDIAIITDGDIRELIPEKPYSFTYN
                     GATKEARSEIERGYCPKLLSGNEPIDDYDYIFIGTPNWFKSFAPPILSFLRSVDLKGK
                     TVIPFCTHGGGGFGQIEINIAQECPDAKLLPGLAVTGDFEEQQVQDWLLCLSCLKQL"
     gene            complement(654501..655700)
                     /locus_tag="DSY_RS03080"
                     /old_locus_tag="DSY0571"
     CDS             complement(654501..655700)
                     /locus_tag="DSY_RS03080"
                     /old_locus_tag="DSY0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_015942817.1"
                     /db_xref="GI:506423098"
                     /translation="MFLIIRVYKLPFRTSQDNLNRLYACNRISAQIWNQCLDLAKEHG
                     QRTNTWLSRKELHLATKGRYPIHSQSIQAVYEKYLDARENALQARALGYTQIRYPYKE
                     KHHFNTRWKKDGFRIGEKGRIELSLGLWEGKRQKPITVRVAHCPPGQIKEIELVYDRG
                     LKLAMAFEDGISPKANPAQGTAAIDLGEIHTLASVTDQGQGLLITGRKLRSIKRLRNK
                     KLKELQRKMAHCQKGSRQWKKYRRAFHYVLSKSEAQLTDALHKTTREFVRWCLDNAVK
                     DVVIGDVEGIQRHTSPKKKQTQRKRSRRINQNLSQWTFGKTRRYLQYKLAAEGISLKK
                     VDEAYTTQTCPVCGKRRVPSSRTYHCGCGYVQHRDLHGAGNILTQHLYGHYQAIVLKD
                     YKYLRIA"
     gene            655803..656495
                     /locus_tag="DSY_RS03085"
     CDS             655803..656495
                     /locus_tag="DSY_RS03085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoB family transcriptional regulator"
                     /protein_id="WP_041272034.1"
                     /db_xref="GI:752602647"
                     /translation="MGVFSPYVHKILIVEDDATIAEAIRKHIQSWGLEARCVEDFRNV
                     LAEFAALDPQLVLLDIALPFYNGYHWCGEIRKVSQVPIMFISSAGDNMNIVMAMNMGG
                     DDFIAKPFDLNVLTAKIQAILRRTYHFAGQVKILEHRGALLNTADASLTYQGQHIELT
                     KNDYRILQALMENKGRVVSRDTLMQRLWETDSFVDENTLTVNMTRLRKKLEAAGLKDF
                     IITKKGLGYLIE"
     gene            656592..657587
                     /locus_tag="DSY_RS03090"
                     /old_locus_tag="DSY0573"
     CDS             656592..657587
                     /locus_tag="DSY_RS03090"
                     /old_locus_tag="DSY0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041272213.1"
                     /db_xref="GI:752602826"
                     /translation="MDLFFSYLKSQCKIIGAFLGFCLIFAIVFALYELPVEAVGYGAV
                     LCAFLGVILVVLDYRAFYERHKRLEALRREITVTAAGLPQPWGPLEEDYQAVIRVLYE
                     DKLQLTGHMRQRYTDLVEYYTVWAHQIKTPIAAMGLLLQGEQGDTPHSRELREELQRI
                     EHYVEMVLCYLRLEAPPTDYLIREYDLDGIIKQAVRKYASQFIRRKIRLEYEPLNCWV
                     LTDEKWLLFVIEQILSNALKYTRSGTIAITLEEPKTLCIRDTGMGIAPEDLPRIFEKG
                     YTGFNGRTDKKASGIGLYLCRRICRNLGHEITAVSAAGRGTEIRLDLQSAELAIE"
     gene            657761..658512
                     /locus_tag="DSY_RS03095"
                     /note="bacteriocin ABC transporter ATP-binding protein;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
     gene            658509..660539
                     /locus_tag="DSY_RS03100"
                     /old_locus_tag="DSY0575"
     CDS             658509..660539
                     /locus_tag="DSY_RS03100"
                     /old_locus_tag="DSY0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011459160.1"
                     /db_xref="GI:499778426"
                     /translation="MTGGLYLRLALTAMAKNRKLYLPYILTCMGMVMMFYIISFLAVN
                     PAVGAMPGGGSLQAILTLGRGVMGVFSLIFLFYTNSFLIRKRKKEFGLYNILGMGKWN
                     LARILTWESIVIGTVSVAGGLFCGVLFAKVAELSLAHVLKSTIQSGFSVDWPSLLEAA
                     LLFAAIFLLILLNGLRQIHVSKPVELLRSDTVGEKPPKANWALALPGVLILAGAYYLA
                     LSIQQPLAAMLWFFVAVVMVIIGTYLLFIAGSVVFCRLLQKNKRYYYKTSHFVSVSSM
                     VYRMKRNGAGLASICILSTMVLVMLSSTVCLYIGAEDSLRSRYPRQVEVEIHSIDPAY
                     TAALTGAVDKALEKRGLQPENSLSYRYLGVTGYLEGEQVSFKREQGQTLRNEDSANLR
                     QLLIIPLEDYNRLTGAGETLGQNEILLYSSKGDYAYDRLEVAGAGTLKIKKTVSKFVD
                     NGMDGMQVVPSFFIVVPELAYMDAVFEKQREIYGDRASSLYHYYGFDLNLAEEVQIAL
                     REDIAESVSRMQLEDPQFPAASIHSVAQERADFYALYGGLLFLGVLLGIVFILGAVLI
                     MYYKQISEGYEDQARFDIMQKVGMTRREIRKSINSQVLTVFFLPLAAAGVHITFAFPM
                     ISKLMALFSLTNTSLLAAVTVGCYLVFTLFYVLVYVFTSRAYYSIVSGGVEH"
     gene            660742..>661056
                     /locus_tag="DSY_RS03105"
                     /old_locus_tag="DSY0576"
     CDS             660742..>661056
                     /locus_tag="DSY_RS03105"
                     /old_locus_tag="DSY0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015253037.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272035.1"
                     /db_xref="GI:752602648"
                     /translation="MDYRAKVYDSLDYIEENLDDRIDLEDLAQKAYLSKYYYHRLFHK
                     VTGESVTRYITRRRMAKAAEELVETEQPIIDIALKYQYASQESFTRAFMRIYGLAPGK
                     YRK"
     gene            661151..661732
                     /locus_tag="DSY_RS03110"
                     /old_locus_tag="DSY0577"
     CDS             661151..661732
                     /locus_tag="DSY_RS03110"
                     /old_locus_tag="DSY0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit
                     1"
                     /protein_id="WP_011459162.1"
                     /db_xref="GI:499778428"
                     /translation="MSQLVPMVIEQTSRGERSCDIFSRLLNDRVVMLNGMVTNESASL
                     IIAQMLFLESADCDKDIHFYINSPGGSVTDGLAIMDTMNYIKCDVSTISIGQSGSAAS
                     LLLAAGAKGKRFALANSEVLIHQPSISGGLQGQTTDIKIHSDWLTKTKEKLNETYSRL
                     TGQPLEKIQKDMERDYYMTAGQAQDYGLIDKIL"
     gene            662032..663486
                     /locus_tag="DSY_RS03115"
                     /old_locus_tag="DSY0578"
     CDS             662032..663486
                     /locus_tag="DSY_RS03115"
                     /old_locus_tag="DSY0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_011459163.1"
                     /db_xref="GI:499778429"
                     /translation="MNIRKTPLILSLMLAMFLAAVEGTIVTMATPTIARDLQGFEFIS
                     LVFSVYLLTSALSTPAYGKLADLYGRKNILSIGIIIFLAGSFLCGLAQSMVMLIVFRA
                     IQGLGAGAIFTVSFTIIGDVFSLAERAKIQGALSTVWGIASLVGPFFGGFLIDVLSWH
                     WIFFINIPFGLLSVILLQSSLKETFAKKKPSIDYAGTLTLSLAIVVFLSIFLFDRSTS
                     PYPSLWVAGLLLLTFFLLYAFYKIEKKAAEPIIPFAIFTRTTILVNLISFLIYAVLMG
                     VNVYLPIYLQNILGYRPTAAGLAMLPMSVSWLIVSFILGRLLVRYGGKNVILASNAVL
                     LLSTLLLFTLGIDTPLPIILVYGFIMGIGFGGASAALTIIVQDSAEYSQRGAAVGTNS
                     LLRTLGQTIGISVFGTIFNLYITKYFTRQGIEGINPGNLYQPDLSHTALAAEQITLSL
                     NSSMHVLFTAFIIITLLSMILAMTMPGMKKEKQA"
     gene            complement(663622..665343)
                     /locus_tag="DSY_RS03120"
                     /old_locus_tag="DSY0579"
     CDS             complement(663622..665343)
                     /locus_tag="DSY_RS03120"
                     /old_locus_tag="DSY0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_041272214.1"
                     /db_xref="GI:752602827"
                     /translation="MKWVENIKTVYKLGILVIIAFFSLGSVGFTGYYDLKIANDNLQT
                     MYEDRLIPVKIAYDTRSDIRALNGFLLELMLTVDRAKNQTLLDSIQEKGQGIEDKLSQ
                     LEDLSLDPQSQELFLKIKTSHKQYDQTKNQILAFAQANLNDKAYNLYETSGGHLSDQL
                     VEDMRALGEYYSSLSHQASLDYEASFKHTLWFMGAIVAAALFLLAGSGYLIASSLTKP
                     LGTMVEVCNDFAAGDFRDKQRQSGAGRADEIGLLYQALVAMQNNLRPLIKGISTSAEQ
                     VAASSQELTASSEQSAQAAGQVAASISQIALGAEQQLAAANETAAVVGQMSLNMQEIA
                     AKANQVTFQSSHANDQANQGITTVEKAVAQMTQIEGTVNSSADVVAKLGRRSQEIGEI
                     VDTISGIAAQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAEQSQEAARQIALLIS
                     KIQTDTEQAVAAMNHGTREVKAGTEAVDAAGQSFREIAHLVTQVSGQLQEIATGLQAM
                     DSDGRQIFSSVQSIDQISTTTASETQTVSAATEEQLASMEEIASSSQSLSELAQNLQN
                     EIARFKY"
     gene            complement(665970..667175)
                     /locus_tag="DSY_RS03125"
                     /old_locus_tag="DSY0580"
     CDS             complement(665970..667175)
                     /locus_tag="DSY_RS03125"
                     /old_locus_tag="DSY0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_005809937.1"
                     /db_xref="GI:492324755"
                     /translation="MNSQPNKKLGPIVAIMSMFIFIPDFFIISSILSKISESYPHISM
                     AGITYLLTSVSLAQMAGALITGVVLGRRISFRGLSLIAIAIYVIFGGMPFFFSMSFGA
                     LMFTRVAFGLGLGCWLPICQSYIAKLYDDEAKRADILGIGMALFNVGLILGIMAGGIL
                     GAFNWRYTFAFYLLGSISFVLVAIFMKEPVNEAEGKKEKIRIPKEAFGIMGFFILAQL
                     IFGVFSSYISYVVAEIHGTPILASTMMTAFSIACIVIALFFGPLYRLVKQYILLFASA
                     LVVVSYALLYLGGTSASIPLLFLGAVCCGLATNMCSTGVAMMLSITVPQASVAAAMSA
                     SIICMNVGTFLTSPFLQIISIAAGEGAPAYTAYLGALLLAVVLLIIAVPFSTKLRRAA
                     KAKETMPAA"
     gene            667504..669603
                     /locus_tag="DSY_RS03130"
                     /old_locus_tag="DSY0581"
     CDS             667504..669603
                     /locus_tag="DSY_RS03130"
                     /old_locus_tag="DSY0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_005809935.1"
                     /db_xref="GI:492324753"
                     /translation="MQSKSFNLKKFDDVLNQMIVPNLQQAPLWDVDNRPMTKDRWETT
                     VRCKKSLLDGDLDAVMTSEYPRAEIKKVWIESYKLGLRPSDKTHDPEEDMLRNENLMP
                     FAQIVFPTIHDLGDFNKIPIFMNIHDRQGTFFFQKTESGIESYFVQEFLFSNEPREIR
                     KSGLTSHLLCKRSMCPAVLLGPEHYLESDLNINSASAPIFDVSGNLDAIITLAYRETG
                     IPWEKDTAEKVSTILTQVLLLAHRIQTSIRPPAERDIPVGREEIPCPDLINDPPIIVV
                     DPAGTIIGINPAGRRFFPTLPTDGQAGNIRRYLPANSKLLPLIQTQAQTIITEVICSP
                     PATGLYSVQIRPFEAAGRSCSILLFSNAKESGQATAPGKCSPAADCFNSLIGESHAFR
                     NAIDQAVCFANSNGNILLTGESGTGKELFAKAIHNCQDKKGPFVAINCAAIPRELISS
                     ELFGYASGSFTGGDRKGRKGKIEMADGGTLFLDEIGDMPYELQAVLLRVLQDKQVTRI
                     GDHVSHQIEFNLITATNRNLKDLMESGQFRPDLFYRISMFPINIPPLRDRKGDIKLLV
                     SYFMNSCGQNNPESLSISNEALQILEEYDWPGNVRQLENVILYMMTIAKSRNCKVLLP
                     EHIPNIVIQSSPPSLAPGEAPDTEKADAYGTIHHVEKVMLEKMLKEFNHDIPLVAEIL
                     GVSKSTVYRKIKRYNLA"
     gene            complement(669618..670475)
                     /locus_tag="DSY_RS03135"
                     /old_locus_tag="DSY0582"
     CDS             complement(669618..670475)
                     /locus_tag="DSY_RS03135"
                     /old_locus_tag="DSY0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011459166.1"
                     /db_xref="GI:499778432"
                     /translation="MNLAVQSDEELLAGYAAILSRLKELIKEDLMVLITDKTHILYFY
                     PGYKLNASNMQLVGLELPADDDLGRCVRTGESNTELRPKEAFGVPFLAMTAPIHNSRG
                     EIIGCVSIGRSMEKEANLEEASQSLAASLQEVNAGLQEIASGSQILSSKINSVVQSAN
                     DSAVKIKEVNQVIRAIADVSAHSNLLGLNAAIEAARAGEQGKGFAVVAEEMRTLARQS
                     KDSAKMVTEILTQMKDSIESIIWEVDQIGGIAGNQAASTQEITAALEEISENSQTLVE
                     HAKIKIENR"
     gene            complement(670820..672019)
                     /locus_tag="DSY_RS03140"
                     /old_locus_tag="DSY0583"
     CDS             complement(670820..672019)
                     /locus_tag="DSY_RS03140"
                     /old_locus_tag="DSY0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809930.1"
                     /db_xref="GI:492324748"
                     /translation="MKGGFRLASLSLVQETQQNLWDATNFREPKKVPVGMEFTYWPFS
                     YAGVTYKEVAHDPQLTAEKYLQFLDDIHLDYTWGMASLPNPYKAFQALGSNSFFLAND
                     QTTVAHNQTADVYMEDDEYDEFSKDPYYFINEILLKRKLPKLDQGRKEAAYGALRQSM
                     LEFRHFDLTNELILQGLAERAVYTLVNAPIVFNSPLKLLFDKVRGMKNTLIDLRRRPD
                     KVRAACAQLLAADKAAIPLKPEDLAKMPGLKVGLTGYHVECFLSGKQFDEFFMKPFLE
                     VCEPYMQAGVKFFLKGEGKFLNTIERYRQTPKGSMIIMLEEDDPFEVHKLVGDWCTLA
                     TGISASLLKYGTKQQCIDYVKKCYDTFAPGGGFIFMQDRPLLSANDANPENITAVYEF
                     ANEYGKK"
     gene            complement(672109..673335)
                     /locus_tag="DSY_RS03145"
                     /old_locus_tag="DSY0584"
     CDS             complement(672109..673335)
                     /locus_tag="DSY_RS03145"
                     /old_locus_tag="DSY0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_005809928.1"
                     /db_xref="GI:492324746"
                     /translation="MNEMNRVTRYGIVFAIMFMNFFIPTHGIVATTFAAMAESYPDVS
                     ASALTYVTAVVNVAQVVASIGAGVLIGRKLKYKTAGIISLLLFTVAGGFPFLMGEGLS
                     FGALLASRCLFGLGLGAFSPIVNSTIAYLFDKENTRAFMMGAKDVFFSLGATIGNIIA
                     GILCLISWQTTYVFYLFGIIPLVFFVIFYKEPEFVQETKKEKIKIPKTAFYYLFLLLV
                     VMLLTQFCWNYIAFILTDMGYSSAVIGTIVTCFTVGAILGGIAYGFCYRFFKNYILFV
                     AMIMVSLSFIIIYGASSSVSTSLLFVFGIGFFLSGFASVMFTAGIPMSLSLTVPASAI
                     AAAMGLFFAFQNFGSFLASPVGQLFFSIVGQDAPINTIFIFGLVVALIFTVIVFITST
                     RDAKLAKAQKQEMNSV"
     gene            complement(673379..674194)
                     /locus_tag="DSY_RS03150"
                     /old_locus_tag="DSY0585"
     CDS             complement(673379..674194)
                     /locus_tag="DSY_RS03150"
                     /old_locus_tag="DSY0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_005809927.1"
                     /db_xref="GI:492324745"
                     /translation="MKVFIVDMERCNGCYGCQIACKDEHVGNAWPPYALPQPNTGQFW
                     MRVKEKDHGQVPKVTVEYTPWPCMHCDKPACLEAVPEAGYKREDGLVILDPEKVKDRK
                     EIVEACPYQAIFWNEELAIAQKCTGCAHLVDAGKLPHCVDLCATGGLRFGEEEEFAQE
                     IARAETMLPASGCRPRVYYLNLPKLFLAGEVWDPQANEIIEGATVSLTFPGGETLTTE
                     TDDFGDFWFRKLEAGMYFLSIEAEGYAPVEKTGIRLNESLNLGDFPLKKPGAL"
     gene            complement(674207..676780)
                     /locus_tag="DSY_RS03155"
                     /old_locus_tag="DSY0586"
     CDS             complement(674207..676780)
                     /locus_tag="DSY_RS03155"
                     /old_locus_tag="DSY0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_005809925.1"
                     /db_xref="GI:492324743"
                     /translation="MSDIKTTIKTLGFCGPCTASDPAEIDVKDGKILRTRPFRYTDHA
                     PKEGLNAWTIKARGKEFRAKEKSEISPFALAYKQRVYSPNRILYPLKRVDFDPNGERN
                     IQNRGKSKYVRISWDEATDIIAREVLRIKEKYGMNSIFVQSDGHHAVKTIHGPRGTQG
                     ALLDILGGYTLQARNPDSWEGWYWGAKHIWGQDPVGQGNQNNLFLDVARNSDMVLFWG
                     CDVVTTPWGWGGHFPSRYCFFLRDIGVRQIYICPDVNYGCAVHGNKWIPVLPNTDSAL
                     QLAIAHTWIKEDLYDQEYIATHAVGFGTFVNQVMGRDDGIEKTPEWAETVCGVPARTI
                     KALARSWAKQNTSIAHCNGGSFIRSTYSHEPARLEVALLGMQALGKPGRNQLKMMEYQ
                     LFSLDSQMPAPRAQFIPDLVSILFPYAADTRESLVTETLVPEALAGDYSRENPLTWYG
                     CTCAGVPVEDQFRKIEYPAPGCERIHMVWTDSPKWTSSWNGGFKFMDALHSEHIECVV
                     AQHIWMEDDCLLADIILPVNTKFEEYDINCDITSGNYNMLLIEEQSIPPLGESKSDYE
                     CAMAVAEKLGVLQELTGGESIADKVKKGFMNSGVQDYISFEEFKEQKCYVVPAAEDWE
                     EDVAGFYAFYSDPENFPLTTPSGKLEYYSQRLAESFPEDTERGPYPKWIEKGETHPDE
                     RLSTPRSESYPFLLVSNHPHWRLHSQMDDCAWFREIKTCKVKGPDGYAYEPVWINPVD
                     AQKLNIKSGDIVKLFNEGGWVLGGAYVTERIRPQVVLQDHGARIDPIVLGESDRGGSN
                     NLIAPKKITSKNCAGEVTSGYLVGIEKVDVFELAQRYPEAFSRKYDPETGVIVDAWLA
                     E"
     gene            complement(676794..677132)
                     /locus_tag="DSY_RS03160"
                     /old_locus_tag="DSY0587"
     CDS             complement(676794..677132)
                     /locus_tag="DSY_RS03160"
                     /old_locus_tag="DSY0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_015942827.1"
                     /db_xref="GI:506423108"
                     /translation="MAQYGLLIDNEYCTGCHSCEVACKNEKMLPLGQWGIKLLELGPW
                     QLMDDKHWEHRYIPVPTQYCDLCEDRVAGGGQPSCVLHCLASAMEFGPLEELTAKMAA
                     KGRQASIFIP"
     gene            complement(677163..677819)
                     /locus_tag="DSY_RS03165"
                     /old_locus_tag="DSY0588"
     CDS             complement(677163..677819)
                     /locus_tag="DSY_RS03165"
                     /old_locus_tag="DSY0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin-binding protein"
                     /protein_id="WP_011459167.1"
                     /db_xref="GI:499778433"
                     /translation="MIDLQKFTQSIGDLDENAVIETLNEFVAANPTEEEAQALVIACQ
                     NGMAIVGDLYEKNEYYVGDLIFSGEILSSALDILKPVLGTGNRAKAGSIVLGTVEGDL
                     HDIGKNIFKGMAEAAGFEVYDLGIDQSPSAFVKKVSEVKPAIVGMSGVLTLALDSMKH
                     VVDALEKAGLRKDLKVIIGGNPVTEIACRHIGADAFTVNAAEGVKICQGWTAQQPGDH
                     "
     gene            complement(677856..678671)
                     /locus_tag="DSY_RS03170"
                     /old_locus_tag="DSY0589"
     CDS             complement(677856..678671)
                     /locus_tag="DSY_RS03170"
                     /old_locus_tag="DSY0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809919.1"
                     /note="catalyzes the transfer of the N5-methyl group from
                     (6S)-methyl tetrahydrofolate to the cobalt center of a
                     corrinoid iron-sulfur protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltetrahydrofolate:corrinoid
                     methyltransferase"
                     /protein_id="WP_005809919.1"
                     /db_xref="GI:492324737"
                     /translation="MIIIGEKINGTIPNVKQAIETKNEGFIHDLAMKQGQAGAAYIDV
                     CAGTAPELEAETLAWLIDIVQQATDTPIAIDSPNPKAIEAVFNCVKHPGLINSVSLEG
                     DKCDVIFPLIKGTPWQTVALTCDNAGIPKDVQSRVKIAGAIVEKAQAYAITPDKIHID
                     PLVTALSADNQSLLNFAAAARKVKELYPDIKVTSGLSNISFGMPLRKIMNQNFLALAM
                     FAGMNSAILDPLNRDIIATILAVEALLGQDRHCRNYANAYRQNKIGPVKAAAD"
     gene            complement(678694..680961)
                     /locus_tag="DSY_RS03175"
                     /old_locus_tag="DSY0590"
     CDS             complement(678694..680961)
                     /locus_tag="DSY_RS03175"
                     /old_locus_tag="DSY0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_011459168.1"
                     /db_xref="GI:499778434"
                     /translation="MATLHWNEKSAPAVTELADGTKVYRTNAWSPPGCHGVGCGLRIF
                     VKDGELQKVEGDPDHPITKGRLCVRCLTMKEYFYHPDRIKYPMKRVGQRGENKWQRIT
                     WDEAYDIIVENYQACAEKWGVNSVSVWSGTGREACRYQTPLCLDVFGSKTIVHPNSGW
                     SCLVPRMAVMSWILGSAYVEYDYANGLPLRYDDPRWEPPKYMLVWGRDPLRCNADGLW
                     GHSMIELMKRGTKLISVDPRANWLATRAEYHLQLRPGTDAALALALLHAVIKTGKYDK
                     EFVEKWCYGFEELAERANQYNPEWAEGITGVAAADIYAVAECLVQKPSSACIGLAIDQ
                     NPNCIQIGHALYSIFAITGNLDIPGGLFMGQPTFFAGDVNNDPNQKSEEAEAEFEGIG
                     YKEFPAIPMIVNTTHPDCTLDTLETGRPYPIKFAFIQSTNFLASSIVVQPKRWYEAMR
                     KLDFIVASDIFMNPTIAGLADLVLPISTSLEHDGIVMNSMASQPGQYGALVKIIEDFG
                     ETKSDLEILLDLHHRLHPDSQDPRWKDTDSYLSHDMAPMPGVDITFPELKERVIAQYE
                     LEYRKYEKGLLRPDGQPGVNTPTGMIELYSTMLEALDEDPLPYYMEPKFSAVSRPDIA
                     GDYPMIMTTGARRFTSFHSEHRQIRTLREIHPWPTAEINPKTAAAKGITEGSWIYVEN
                     PWSKAKLYAHLTPIVKENVVSIDHGWWYPERGPEKMFDVWECNINNLIPNKENGKLGF
                     GTHFKSMPCTIYRAD"
     gene            681476..683032
                     /locus_tag="DSY_RS03180"
                     /old_locus_tag="DSY0591"
     CDS             681476..683032
                     /locus_tag="DSY_RS03180"
                     /old_locus_tag="DSY0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_011459169.1"
                     /db_xref="GI:499778435"
                     /translation="MEKKRVLIGSPIRQSPHVLKEFLDSLRGLEQGELELNYIFVDDN
                     ESEESSRLLVNFEEEGLATLIKGDKGEKRPGDYVCDDITHHWRDHLIQKVAGYKNLMI
                     EKALEWGYDYLFLVDSDLVLHPATLRHLVSTGKEIISEIFWTAWYPGSREMPNVWLYD
                     HYDMSPRQRGEKLSQKDLDIRAQGFIDQLRIPGVYEVGGLGACTLLSRQALQAGISFS
                     EIKNLTLWGEDRHFCVRANALGLSLWVDTHYPAYHIYRESSMAGVEEFKAVCRGEKPP
                     GQGSCTVQEQHKPKLTLSMVMKNEATKDLARVLREHRHYIDAAVIIDDGSTDNSVELC
                     LSILQGIPLQIIENSASKFANEVELRKQQWRATVATNPEWILNLDADEVFENRFRQEV
                     RMLIEDPDTDVWYFRLYDFWDESHYREDEYWNAHSTYRPFLLRYRPGFVAEWHEVAQH
                     CGRFPKSIKTLPYKLSSLRLKHLGWADPKHRMAKYQRYMELDPEARYGWKEQYESILD
                     PNPRLVKWEE"
     gene            683373..683588
                     /locus_tag="DSY_RS03185"
                     /old_locus_tag="DSY0593"
     CDS             683373..683588
                     /locus_tag="DSY_RS03185"
                     /old_locus_tag="DSY0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_005809912.1"
                     /db_xref="GI:492324727"
                     /translation="MDNKVEQLRRERGLNQEEFAKAIRVSRQTVSSIENGKYNPSLEL
                     AFAIADFFEKSIEEIFIYERRKENEKK"
     gene            683575..683985
                     /locus_tag="DSY_RS03190"
                     /old_locus_tag="DSY0594"
     CDS             683575..683985
                     /locus_tag="DSY_RS03190"
                     /old_locus_tag="DSY0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809910.1"
                     /db_xref="GI:492324724"
                     /translation="MKKSNLWAGMLFILGGVVCLAIALMLDTRLDSLLFGFAGGLIAP
                     GAIMIIKYFYWTAPQNRSRYAERLDNERIELGDERKERLRDKSGRYAYLLGLPVLSAS
                     VVLFAILGKLYLAGYFVFQYVAGVVIFRHLNHKY"
     gene            684104..685747
                     /locus_tag="DSY_RS03195"
                     /old_locus_tag="DSY0595"
     CDS             684104..685747
                     /locus_tag="DSY_RS03195"
                     /old_locus_tag="DSY0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809907.1"
                     /db_xref="GI:492324720"
                     /translation="MSRRKVSGLNHMPEAVTLGRFLEQQKLEPLREDPLFQEEMLALA
                     IQTLSFSSRESGLSKGGNNGLPGKSLSLPLAGSHVHLEDQGKYLRLRIAEGEEKTPRT
                     QGSFLCAFSGTWEDFCTQAADWMEREKGRILGACEGFTRNLTEQITQGYGLSILAELK
                     KTLGVDLFLLDKHFKVLSWEGGGRFPFHPVSFVTPKLSHFKSMDLLLETPLGIGKWND
                     AQYKELPLSWYPLAGHQGVLGYIGLGIEQGELNPVGRLFLYKAAVLLYFELAKAQSVE
                     DTERQHYRDFLFDLLYNNFDSLEVVQSRGKLWGMDLTKPHLVVVGEIPGYDPDSMDQL
                     AFQELLDTVSTALRSQPRTIFLERNDQIVLLYPLEGMIPLSQWEATAKKLLSPLLILL
                     EGLEEERSMMFGVGNLYPSARFIHRSFQEAKSALELGQLFNLQERVILFQDLGVMRLL
                     LNLEQQELEDFRNEVLGPLLKFDQENNLHLEETLLAYLASDGDLNLAGDRLFLHPNTL
                     RYRLKKAAEVLDRDLNSLETRMNLFIALKIGRLKSLWQE"
     gene            685907..686572
                     /locus_tag="DSY_RS03200"
                     /old_locus_tag="DSY0596"
     CDS             685907..686572
                     /locus_tag="DSY_RS03200"
                     /old_locus_tag="DSY0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_011459172.1"
                     /db_xref="GI:499778438"
                     /translation="MLMAELVCSPEGDAQTLHLQARIATLMALSGVFSAGGENLQRTL
                     TTLSEAYAQWLEEKEGVLAEEEEILNQLLQAQKGKEKKTLGYEFNRLFVGPQSPTVPP
                     YESVYRHGERLVMQKSTLDVRRWYRSEGLSLAGASKEPDDYIATELEFAAYLLAKALA
                     GFQKNQPGEAELYLKNYNAFYQEHLRIWLPRFVTGLFTQAREPLFHVLGEMILKTVRA
                     VPS"
     gene            686618..688816
                     /locus_tag="DSY_RS03205"
                     /old_locus_tag="DSY0597"
     CDS             686618..688816
                     /locus_tag="DSY_RS03205"
                     /old_locus_tag="DSY0597"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit A"
                     /protein_id="WP_011459173.1"
                     /db_xref="GI:499778439"
                     /translation="MKITRRQFIGGTAAVTAGAGLFGFNMLAESDFARAAGAEAGVKT
                     FRNVCPRNCYDTCAQISYVEDGVLKKVEGDPKSTYTNGKLCLKGYNYTRRVYSPDRIK
                     YPMKQTPRGSGNWERISWDEAMNTIAGKILDLKKRYGSTLPICMNKYSGNFGITHYGI
                     EGTMSSIGYTTRAIGTPCWPAGIDSQTYDFGTIVNNDPEDFVNANYIILWGSNCAWTG
                     VHSLPFITKAQERGAKVVAIDPVLTSTASKADLYIQINTSTDGALALGMARYILDHDL
                     VDWDYVQANSIGFAEWADYVKKNITLDWAAEKTGIPKEIIIQLAHEYATAKPASIWVG
                     YGMQRHTNGGQNVRIIDALGLMTGNIGKSGGGINYAHLETWGFNYHAMVMPAPEGSVG
                     MAGPDGTHTDRSVNMNNFAADVQALTDPPVKMLWIAARNPVSQDPDTHDIIKMFNSME
                     LVVTVDSFFNKTVEQSDIVLPATTHFEDWDVMASYWHHWVGVNQRAIDPMYESKSDVE
                     IAMALSKAMNALEPGSCTYPTEGDPEEWTAKEFNDGVYNMLGITDYKELLAGPRKAKF
                     SPAAWADGKFRTPSGKFEVHSERAAQNGLPAIPIWVEEMKAPAQYPIRFMTPHPQHGI
                     HSQFQNLDWMMAANPEPLLEIHPELAARHGIAEGDQVRVYNDLGEVTIKAHLTRTTSP
                     DVIVSYEAWYKDSPFNVNYTVKAIPADMGKLATGMDGIAFHDNFVAIEKA"
     gene            688831..689400
                     /locus_tag="DSY_RS03210"
                     /old_locus_tag="DSY0598"
     CDS             688831..689400
                     /locus_tag="DSY_RS03210"
                     /old_locus_tag="DSY0598"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit B"
                     /protein_id="WP_011459174.1"
                     /db_xref="GI:499778440"
                     /translation="MSKQLGFLHNSEKCIGCRGCEMACKNEYQSDASVRWRQVYQLRE
                     KDFSLPTRMFISVACNHCQNPECLRVCPVKAYTKREDGIVIHDQERCIGCKLCTMACP
                     YDRPQFNTVVKKVEKCNLCYERLDQGQQPACVAACVPEALQLVEMTDELDLKTGVLTT
                     LPGMPDPAVTHPSIRFIGPKQGKQIRRDV"
     gene            689400..690254
                     /locus_tag="DSY_RS03215"
                     /old_locus_tag="DSY0599"
     CDS             689400..690254
                     /locus_tag="DSY_RS03215"
                     /old_locus_tag="DSY0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMSO reductase subunit C"
                     /protein_id="WP_005809896.1"
                     /db_xref="GI:492324703"
                     /translation="MGHWEWPLVLFTVLGQTSVGIIFCLWLLERKRGKQAVQAGPEYQ
                     KFMQSSVLVSGVLLAVAMIASLFHLGHPLAAYRALTHLGTSWLSREILLFVFTFGAWA
                     YLALLSRRPGGKLTGVLALTSALGFLGIISSALIYTLPRVPAWNNLGPVIFFLMTGMI
                     LGALVTAVLGRKALAGGEMKQMLGIALGSVMGSAILYLLYFSGLEVTPEGAATAQALL
                     SSPVFWLRAAVGWILPILLILNTISKQDNPQSRLIVLALTCGVVGELLGRGLFYVSAV
                     GMQITALM"
     gene            690710..692752
                     /locus_tag="DSY_RS03220"
                     /old_locus_tag="DSY0600"
     CDS             690710..692752
                     /locus_tag="DSY_RS03220"
                     /old_locus_tag="DSY0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_041272215.1"
                     /db_xref="GI:752602828"
                     /translation="MDTLHHHICPRNCYDTCSIISTTRHGRLVSIEGNPAHPYTRGKL
                     CPKVMDEIHKVYSPQRIRYPLRQRKRFSGQWERITWDEALETISRKILDLKDKYGTTL
                     PLAHNKYSGNFGILHNALEAFLTGLGPTTRAVGSPCWSAGVEAQVFDFGAFFCSDPLD
                     MEKAKLIWIWGANPAWNAAHQMPIIFRAMDQGAKVICLDTHFSATAARVHQFVRVNPG
                     TDGLLALGLAKIIVDHQLTDPELPDYSLGYNEFIDYLKAEIDLQKCSAVTGVSLETMK
                     ELALEYGAVKPACIWAGFGLQRYTNGGQNLRAIDALGALTGNIGRPGGGVQYGHFETW
                     RFAGPLAHSQCGHAQDRELDINQFPQLALAADPPVKMLWIASRNPFQQDGNHAGWQKL
                     SEALELIVVSDLFHTRSSAAADLFLPVTTHYEHWDLHASYWHYYIGINEPAVESVGEA
                     RSDLQIAWDLSKRLNQSSPGSSAFPTEGSEKEWVLGAIGPEMLAILGIDSAEELLKGP
                     RRVNYPGTAWQGRQFQTPSGKYEFYAEKAQEWGLPPLPVYRPPRQAPPETPLRLLTPH
                     HLSGLNSQVYLYSEESDSLLKARLHPKTAEGYGLNRGDKAILWNRGGSFPVIIEPDLG
                     IGEGVIVIYQENPPNLKSPHLNLLNLGELTDMGKYATGAYGLALNETFVGIRKTTS"
     gene            692764..693321
                     /locus_tag="DSY_RS03225"
                     /old_locus_tag="DSY0601"
     CDS             692764..693321
                     /locus_tag="DSY_RS03225"
                     /old_locus_tag="DSY0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_005809890.1"
                     /db_xref="GI:492324694"
                     /translation="MAKQLGFFLDVNRCLGCGACIKACANHNRLPPSLTWRKLRQVED
                     VDYDRGQISRFFLSTACNHCANPECLRVCPYGAYAKRRDGIVLHFPDKCGSCKSCVAS
                     CPFGAPQINPQTGKAGKCQLCHERLDKGHAPYCVQACVTGALQLREIQGNPTDRILRL
                     TAPLPTLRLTKPSTFYYPPRGTKIL"
     gene            complement(693510..695051)
                     /locus_tag="DSY_RS03230"
                     /old_locus_tag="DSY0602"
     CDS             complement(693510..695051)
                     /locus_tag="DSY_RS03230"
                     /old_locus_tag="DSY0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CdaR family transcriptional regulator"
                     /protein_id="WP_011459177.1"
                     /db_xref="GI:499778443"
                     /translation="MNINMHILLDELRELNPKSYLHDSIDLTIRSMAGFDKTSDGFLK
                     DTLYLAATTALAAWEGKLQDVNLIVTGAFDLDFAQRNRCNIICFDDSLTPVEIAGHIF
                     RIQKKYDDWNNALLSALIAKKPTKHLFAIALEEIHNPMMLLGSLNTLILAAGDIPASC
                     TDTLWRELLNEGYLSYEHPLYSELLKIAEKKPSEQPFIVKFPMHDYTYLIANLFQSGK
                     RCGALHLLEVNQPFSLGQITLVAHFRSILEQAIKTIPDLQILSSNANGFVYQLLNHIY
                     VKESIIINSLQAKGWKVFDEFLCLNLMQNKMQRDDTLLNIIVQELTRVFPAAIILNYK
                     DGVVMILRHADFPFDREDLRARLASFVKKFFLTIGVSSVFYDFKNLKRHYDECSLAIK
                     YGLAQDPTLALHFFDDHVFRHLSRFIFVENGKNQFIHTKVELLHHYDLKNNTELVKTL
                     LTYFQFGQSKSLAAEKMHLHRNTLTYRLNSINNLVGIDCSSRNLQEEEIFHIMLSCKF
                     LEYIP"
     gene            695338..695904
                     /locus_tag="DSY_RS03235"
                     /old_locus_tag="DSY0603"
     CDS             695338..695904
                     /locus_tag="DSY_RS03235"
                     /old_locus_tag="DSY0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="WP_011459178.1"
                     /db_xref="GI:499778444"
                     /translation="MQLIEQAKIREAVLMILEAIGEDPEREGLKDTPDRVARMYAEIF
                     SGLAEDAGVYLECVFTEEHEEMIVVKDIPFYSTCEHHLVPFIGKAHVAYIPAGGKVTG
                     LSKLARVVESIARRPQLQERLTREIADVIMKKLNPQGVAVVVEAEHLCMSMRGIKKPG
                     SKTVTSAVRGLFRKSAKTRAEFLSLIKT"
     gene            695945..696850
                     /locus_tag="DSY_RS03240"
                     /old_locus_tag="DSY0604"
     CDS             695945..696850
                     /locus_tag="DSY_RS03240"
                     /old_locus_tag="DSY0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FdhC protein"
                     /protein_id="WP_041272216.1"
                     /db_xref="GI:752602829"
                     /translation="MANMYLSPKEITEEYVAIGQKKASTPAYKLFILGILAGALIAFA
                     SEGSNVAIHTLDSVGLGKLLAGIIFGTGLMMVVITGAELFTGNTLIVISCIEKKVRWL
                     DMLRNWVIVYLGNFIGALTIVIFIIYSGQLDFSGGLLGGFTIKTAVYKTGLTFSQALL
                     MGIMCNWLVCLAVWMAAAAKDIAGKVLAIFFPIMLFITSGFEHSIANMYYIPAGIIAK
                     MNPVWVEQAEALGVTAAKLAHLNWESFIVNNLIPVTLGNIIGGSLFVGVFYWLGTLYK
                     GRPAAAEKTDRLMPGKLDNAWAKSK"
     gene            696884..698560
                     /locus_tag="DSY_RS03245"
                     /old_locus_tag="DSY0605"
     CDS             696884..698560
                     /locus_tag="DSY_RS03245"
                     /old_locus_tag="DSY0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019851244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Formate--tetrahydrofolate ligase 2"
                     /protein_id="WP_005809880.1"
                     /db_xref="GI:492324680"
                     /translation="MAFKSDIEIAQESTMLPVAELAEKLNIAEEYVESYGKYKAKIDY
                     NLLKEKGNTPDGKLILVTAINPTPAGEGKTTTTVGLGDALTHLGKKVVIALREPSLGP
                     VFGVKGGAAGGGYAQVVPMEDINLHFTGDLHAIGAANNLIAALLDNHIYQGNALDIDV
                     RRITWKRCMDMNDRQLRYINDGLGGKANGMPREDGFDITVASEIMAILCLSSDLDDLK
                     QRVERIIVGYNRKGEPVTAGQLKAQGAVAALLKDALKPNLVQTLEHTPSFIHGGPFAN
                     IAHGCNSVMATKMALKLGDYVVTEAGFGADLGAEKFLDIKCRLSGLEPDAVVIVATVR
                     ALKSHGGVAKADLNQENLAALKEGLPNLLKHVENITVNFGLPAVVAINRFPTDTLAEV
                     QLVEEECKKLGVNVALSEVWEKGGAGGVELAEEVLKLMDSPKNFTFAYDIDLGLKEKI
                     TAIATKIYGADGVDFIGSSTKDIEGIESIGYRNIPVCMAKTQYSLSDDQKKLGRPTGF
                     RISIRSVKVSAGAGFAVALTGDIMTMPGLPKVPAAESIDVDNTGRISGLF"
     gene            698938..699576
                     /locus_tag="DSY_RS03250"
                     /old_locus_tag="DSY0606"
     CDS             698938..699576
                     /locus_tag="DSY_RS03250"
                     /old_locus_tag="DSY0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_026198967.1"
                     /db_xref="GI:648507216"
                     /translation="MLESSAKDFVSALSSKEPIPGGGGASAYVGSMGMALGVMVGNLT
                     VGKKKYADVEAEVKILIEKSEKVIARFQSLVAEDAAAFYPLSQAYGMPKNTEEEIQRK
                     EETLQKALVNATLVPLEIARCCAEGIDLQEEFAQKGTRIAISDVGVGVTFLKAALEGA
                     KLNVLINTQIMKDQEFKHRIETELADLCTVYTAKADRIFAEVQNSITGGKSS"
     gene            699573..700418
                     /locus_tag="DSY_RS03255"
                     /old_locus_tag="DSY0607"
     CDS             699573..700418
                     /locus_tag="DSY_RS03255"
                     /old_locus_tag="DSY0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional protein FolD 1"
                     /protein_id="WP_005809876.1"
                     /db_xref="GI:492324673"
                     /translation="MTQILNAKPVVQAMKENLRQEVAALQAEGKAPTLGIIRVGSRPD
                     DVYYENNIIKNCETIGIATKTYPLDLNISMEEFTAVMTQVNDDPSVHGIMLFRPLPPQ
                     LDEEVIKHLISADKDIDCMSPLNLEKVFEGDMSGLLPCTPAAVMAILRHYEIELKGAN
                     AVVMGRSLVVGKPLSMMLLQDNATVTICHSRTRNLPEVAKNADIVIAAMGRARMIDDN
                     YVAENSIVIDVGINDAGDGKICGDVDYDAVVDKVKAITPVPGGVGSVTTTILLNNLVR
                     ACKSQ"
     gene            700651..701598
                     /locus_tag="DSY_RS03260"
                     /old_locus_tag="DSY0608"
     CDS             700651..701598
                     /locus_tag="DSY_RS03260"
                     /old_locus_tag="DSY0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011459180.1"
                     /db_xref="GI:499778446"
                     /translation="MDSDELRQGLKEQGYIADDNTLMAMQCSLLLNKPLLIEGPAGAG
                     KTELAKAWSRYWQRPLIRLQCYEGIDEAKALYEWNYQKQLLYIQSQNTRLQGIQDKPF
                     QGAYPQDSDQQNPEDNAWAANSKTIYSEEFLLSRPLLKAIRSPQPVVLLIDEVDKSDE
                     EFESFLLEILSDWQVSIPETGTISAASIPSVLLTSNNTRNLSHALRRRCLYLYLDYPG
                     EQRELDILRLNFPELQETLGRQAVILIRKIRLERLKKHPSISEVLDWVNILNQMGARE
                     LSPPLALNTLGLLLKYKEDQEKIREKINQKDWFDGIFTA"
     gene            701579..702940
                     /locus_tag="DSY_RS03265"
                     /old_locus_tag="DSY0609"
     CDS             701579..702940
                     /locus_tag="DSY_RS03265"
                     /old_locus_tag="DSY0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809872.1"
                     /db_xref="GI:492324667"
                     /translation="MEYLLLDMARLLRRAGIHVGTPELEDCLQGLNHLGTKISKYAFY
                     QLVNTTMIKTPWGAEFVLWLTELYYGPDPELSNDHLQLLSRRQVTEVTGEGLGSSGQG
                     APVELLAEAVLKKNIGLIYAVLQGLNIRLEPHWEDEERALEFFRERSGWGEVRRRVEE
                     SRRRGELGEEEYAQAWETLSEWNRLLQDQIELQMIQTMSGQVLLDELKKHNPRTIDFL
                     AGEERQIEPMFREIQKLGRRLAVRPGRRHQVAGKGTIALSRTVRRALQTGGIPLAPVR
                     VRRKPAKPDLWLLCDMSNSVSPFSYFMLLFVYATQSRYAHIRTFLFVDALLEVTEHFQ
                     GQDWSDALHSMKRLKGFNLTGYSHYGKVLQQFAAEHLTQLSRKTTVIILGDGKNNGYK
                     PEGHEALAQIKESAAALYWLNPLSRNLWGTADCLMEKYEENCTGAWPCCNIQQLEQFL
                     LSL"
     gene            complement(702981..703175)
                     /locus_tag="DSY_RS03270"
     CDS             complement(702981..703175)
                     /locus_tag="DSY_RS03270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809871.1"
                     /db_xref="GI:492324665"
                     /translation="MKRYISKIVLTASLLSFLVAVIQALISRFGGSLGKDLYFIALIA
                     TIGVLFLGLYRIIDLLEARR"
     gene            complement(703247..704587)
                     /locus_tag="DSY_RS03275"
                     /old_locus_tag="DSY0610"
     CDS             complement(703247..704587)
                     /locus_tag="DSY_RS03275"
                     /old_locus_tag="DSY0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_005809868.1"
                     /db_xref="GI:492324660"
                     /translation="MSDSPLLWLFLLQLIFIFFNAIFACAEIAVITMNDNKLAKLSAA
                     GDKRALRLTKLTEQPAGFLATIQVGITLVNLLSSAVATENFSDRLVAWFAGMGFNIPA
                     AVISILSVAIITVLLTYFTVLLGELIPKRLAMKKAEQIALGMSGLIYTVSRIFTPAVW
                     LFTVSTNGLLRLFGVDPNSEDEENAEEEIRMILDAGKQKGTIQPDEQNMIQNIFEFDD
                     ISAGELMTHRTEVALLWLDETDEQWQQTINESRHSIYPICSDSPDNILGVLYAKDYFR
                     LKNKARDEVMKNAVQSAYFVPESVRADVLFRNMKKSRNHFAVVVDEYGGMSGIITMND
                     LLEHLVGDLDDDISMPAESPLIERIDSKTWRIQGSAPLDEVTKQLGVLLPDEDYDTFG
                     GMVFGLLGSIPGDGSTPELEEYGLAIKIIKVKDRRLESALVCLSGAESPDTAGG"
     gene            complement(704938..706230)
                     /locus_tag="DSY_RS03280"
                     /old_locus_tag="DSY0611"
     CDS             complement(704938..706230)
                     /locus_tag="DSY_RS03280"
                     /old_locus_tag="DSY0611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809866.1"
                     /db_xref="GI:492324657"
                     /translation="MKAYKEYMNNIDVSDALHQKLISCTDAGMGTGKARTQYRAPLLR
                     RYRAAFACLALILLGVFMLPRFMEHPLALMPGNPGISQSVDPSIKYPLVFNKAARLAA
                     ADMAIPGHFWQELTADELRAVFPGLADMRRITATANFSSEQNVAALFNIDAHMLSPSG
                     LETYLQLAPGQVQLDYAFDVETKTSDLLGTEVTAGYFETRPNSRGLKNIIYFAAFQLA
                     DLAYYVELGGPEAEKEALQAEISELVGRLIEGGRADLTVFHPVIPELREEGLTLGEAR
                     ADADFGAYLPTDLPEGFAFEDALRSINQNQDALFVNWTKSMGYINWRVSLLEDKDQER
                     ITPIAHKENYDLSLYPLPRTDSVPGELQDIVDNPIFLIDELTLDAVRARTYEIADAGD
                     EPGQRMSFSVLYGDVLVEIGVKGAAPEGIFEILQGIKQ"
     gene            complement(706217..706708)
                     /locus_tag="DSY_RS03285"
                     /old_locus_tag="DSY0612"
     CDS             complement(706217..706708)
                     /locus_tag="DSY_RS03285"
                     /old_locus_tag="DSY0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sigma-70 region 2"
                     /protein_id="WP_005809864.1"
                     /db_xref="GI:492324654"
                     /translation="MAYKSARPEDFEVFVTTHENRLYRTALAITGNIPDAEDIVQEVF
                     LRAYEKAPQFESAEHAKAWLIRVTVNLGKSRLRSPWHKRREPFLDSYPASEPKQYELL
                     EQIMALPSKYRTVIHLFYYEDYSIKDISELTGQKEATVRSLLTRARQKLKLSIKEDDY
                     ESL"
     gene            706907..707149
                     /locus_tag="DSY_RS03290"
     CDS             706907..707149
                     /locus_tag="DSY_RS03290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809862.1"
                     /db_xref="GI:492324650"
                     /translation="MYYTKEEINTILAGMQEGKTYAQIMDEMHPRSELLCLYDCAEEN
                     MRSFSLIGAIYNAITKKGKPKLQNPYTECLECADCL"
     gene            707387..707737
                     /locus_tag="DSY_RS03295"
                     /old_locus_tag="DSY0613"
     CDS             707387..707737
                     /locus_tag="DSY_RS03295"
                     /old_locus_tag="DSY0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809858.1"
                     /db_xref="GI:492324644"
                     /translation="MAKRYIMLRPEEEAAAEAESTLKEMICFGENSKNYRFPDVEVND
                     ENQVKLQKLVDEYNLLIEQEENKDLDLKTFFAGKQIKLEHVDEFEEPRDMFILLIYFK
                     EVCKLTDFEPVAVI"
     gene            complement(708390..709232)
                     /locus_tag="DSY_RS03300"
                     /old_locus_tag="DSY0615"
     CDS             complement(708390..709232)
                     /locus_tag="DSY_RS03300"
                     /old_locus_tag="DSY0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_005809856.1"
                     /db_xref="GI:492324641"
                     /translation="MNYNSIPTEIIDTILAELKIGLTLVNNTGKIIYFNQLAGELLGW
                     DNKLPENTILSCHKKENQPKVIEKLNQPAAMEWHKVIKTQNRFIENAYSPINIPDKFM
                     GAMILTKDVTAREESLEKLKKNAETDALTGLYNRNLFHTVIQSYITESKPYGLIMLDI
                     SGLKYINDHFGHEEGDRILKEAAEAIRSSIRDTDFAFRFGGDEFLILTSYQEAVLKTI
                     ANRIRSKNKIPTENTPAVLNLSLGYATSLEEKNMEAVLSSADQRMYRDKQLFYLGDGK
                     YFKQ"
     gene            709474..711930
                     /locus_tag="DSY_RS03305"
                     /old_locus_tag="DSY0616"
     CDS             709474..711930
                     /locus_tag="DSY_RS03305"
                     /old_locus_tag="DSY0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase D"
                     /protein_id="WP_005809852.1"
                     /db_xref="GI:492324635"
                     /translation="MRSKLNQYNQKRNFTRTLEPEGITEMPQEGLRFVVQHHLARRDH
                     YDLRLEWDGAMLSWAVPKGPSYNTWDKRLAVQVEDHPLEYRHFEGTIPKGEYGGGVVM
                     LWDEGFWEPYVDVDGGLHEGMLKFVLKGRRLKGRWALVRMKGKAGDKKDNWLLLKEKD
                     DYVQTADGISQFTTSIRTGRTMTEIEEGEEEKFTRNPFSSTEVQLAKLVRHLPEGEGW
                     LYELKYDGYRIVAYLEGHRVRLMTRNGHDYTERFQDVASSLADWAEGRAMILDGEMAI
                     TDPEGKTDFQALQNYLKNPRTKNLTYILFDLLALDGADLRGHPLIHRKETLAALLENA
                     PPNLHYSRHVRGKGEESFRAACEAGMEGIIGKKADALYSGTRNGDWIKLKCDQRQEFI
                     IVGYTLSQKRISGISSLLLGIYEGRELVYAGRAGTGLKESDMEELEEKFKDIRRSSAP
                     FKPAPKPRANERITWVEPELVVEVKFADWTEENLLRQASFKGLRADKNPREIRRERAD
                     EEKDDGELQLQPPAPERKSLMKINTNSMIIEGIKISSPDKVIFTDPEITKVDMIRYYA
                     KVAERMLPYVSRRILSIVRCPKGVAQTCFYKKHPGPGSQGVVTIPILTSDGTTEDYFY
                     IENPSGLIAEAQMGTLEFHIWGSRVDELEKPDLMVFDLDPDEGMELGTVRQGVRDLKA
                     ILAELSLNSYLKTSGGKGYHVVVPLKPAVSWGVFHDFAQGVAQVMEQKWPDRYTSNVR
                     KAKRTNRIFIDWIRNGRGATSIAPYSLRARRGAKVSMPITWEELDTVAPDGVDMAEAL
                     RRIQDSDPWEGFFRNQQRLQ"
     gene            complement(712133..713044)
                     /locus_tag="DSY_RS03310"
                     /old_locus_tag="DSY0617"
     CDS             complement(712133..713044)
                     /locus_tag="DSY_RS03310"
                     /old_locus_tag="DSY0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018307096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_005809851.1"
                     /db_xref="GI:492324633"
                     /translation="MDISKLKAFLVCCEEMNYTKAAVRLFISRQALRQTIQSLETELG
                     TTLFSNLRNRLSLTASGETVRNYAEELTRTYESMLMEVGAVQGKTLRLGISCSLLPFF
                     SPELPGYLEEFGTAHPELPLELLSLTTDQAIEKVLSGELTAAILVMMDWDIPGIAADT
                     ICRFPFGVTFAETHRFSRKKQIGIEDLAGEKCVVWGSPELIMRPLYEELQKAGVQISV
                     EVIPSAKTAFYLMENENRLMFEYTYPNTKQLQVERNSPLAGSAFSWSLMLIHKSQESI
                     LPLTLLKDFLIAKYDYITISRNIIPVS"
     gene            713171..715144
                     /locus_tag="DSY_RS03315"
                     /old_locus_tag="DSY0618"
     CDS             713171..715144
                     /locus_tag="DSY_RS03315"
                     /old_locus_tag="DSY0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_005809849.1"
                     /db_xref="GI:492324630"
                     /translation="MKKDFSRRDFLKAAAAGVVSTSTLGILSGCSSGSPASAPKGTYK
                     PGTYTATAQGMGEVTVTMTFDENTITDVVLDLANETAGIGQAAKDTLIAQILDGQSVQ
                     VDGVSGASITSKAVMKAAADCITQAGGNPVVVSPGSSGSAGTDWLGQAPEIADSEIVK
                     TYDYEVVVIGAGTSGTFAACSAVEEGAKTVLIEKSGADFGGSGIRDTLGAIGSKQQIA
                     NKDNPDKFDVIRLMYQHSQGYGDQRLFKVWADNSGEAIDWYTERMAKHDVKVLHEVDN
                     HDTGEKFEFYDVGHSVQWEGREYKSQFTMFLLLDDYKAKGLEVHHDTEMIKLLKDGSK
                     VTGILAKSGDKYVRYNASKGVIVCTGGYSNNTEMLQALQPETLKMTGVNRSFPGSSGQ
                     GIKACLWAGGIMDETHAGMIFDRACVKPDASGPEDAGWFWMGSQPFLKVDLKGRRFTN
                     ESGSYDHILHTAFNLLPEHTYAMIWDADYPEDIKRFESHGCSRLYPHANGTESVFPME
                     YIQNVMNPDLQKQGYIVQADTIEELAGKLNIPADNLKATVDRYNELYDQQKDEDFDKE
                     PFRLSQLRTAPFYGTRQCGGYFIATMDGVKINTDMNAIDKDGNAIEGLYVAGDCSGGY
                     FHGSYVNLLAGAAAGRSVTFGRLAGRNAARRRV"
     gene            complement(715225..715407)
                     /locus_tag="DSY_RS03320"
     CDS             complement(715225..715407)
                     /locus_tag="DSY_RS03320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809847.1"
                     /db_xref="GI:492324627"
                     /translation="MYQVPRQEITAVISGVLMEDVAVTNATVIIKGLETFATTTLDFV
                     DCLMVGYQKEERPNRF"
     gene            complement(715540..715830)
                     /locus_tag="DSY_RS03325"
     CDS             complement(715540..715830)
                     /locus_tag="DSY_RS03325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation repressor RelB"
                     /protein_id="WP_005809845.1"
                     /db_xref="GI:492324624"
                     /translation="MAKSSSMYIRIDPKIKAEVEEIYARYGMSITDAINVFLYQSRNV
                     NGLPFDLRPSAQETRVPLSPSMKGALRKYADPALRAKEEGAWEKAAEKHEGI"
     gene            716105..717046
                     /locus_tag="DSY_RS03330"
                     /old_locus_tag="DSY0619"
     CDS             716105..717046
                     /locus_tag="DSY_RS03330"
                     /old_locus_tag="DSY0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_026198966.1"
                     /db_xref="GI:648507215"
                     /translation="MKDKITIGIPRAFLFFKYQYLWQTFFAELNCQVILSPETNKKIL
                     KEGIDSSIDESCLSAKIYMGHLAYLRGKADFILVPRIVGFGRKEEVCTKFNALYDIVK
                     NTFKEVNLLSYNIDMAHQESEFKGFMKMGRELGKNPALVLKAYLKGKRLQKKMELQLA
                     EEQESLIQGKDKLKILIIAHDYNTYDKVVGYPVVKHLESLGIVPVYADAADKKKTALK
                     SRLISDTLYWTFNKELIGAIDHYQQNIDGIIFISTFPCGPDSLVNELCLRKIKGVPMA
                     NIIVDELQGEAGLQTRIESFVDIIMERKKTGREAQIG"
     gene            717039..718133
                     /locus_tag="DSY_RS03335"
                     /old_locus_tag="DSY0620"
     CDS             717039..718133
                     /locus_tag="DSY_RS03335"
                     /old_locus_tag="DSY0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809841.1"
                     /db_xref="GI:492324618"
                     /translation="MASQEKIMSFPHIGNYHVAIEFLLKHVLENIQVLTPPPITKKTL
                     ELGSKYSPDFVCVPFKYNLGNYLEALEQGANILVQSGGGCRFGYYGEIQEQILRDLGY
                     DFEFISLIDNEKVNPLAFFNRFKRLNPQLSLARFAYYFQLTFKMIEAMDSLDHMIRSN
                     IGFAVREGSFELLHKEFLRELAAVEGFRSLDKLYRKYDALFRQLEVNKPDNPLRVGIV
                     GELYTLMEPFSSCFIEKELAKKGIQVTRFITVSYLLRHHPQSSDLLKLAGNYLEYEIG
                     ADGTDSVARAKMLAEAGYDGVIHVKPFGCTPEVNSMPMLQNISNDYKMPILYFSFDAQ
                     TSETGVLTRLEAFHDMLMMRREANRWQNVI"
     gene            718115..719218
                     /locus_tag="DSY_RS03340"
                     /old_locus_tag="DSY0621"
     CDS             718115..719218
                     /locus_tag="DSY_RS03340"
                     /old_locus_tag="DSY0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005809839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyglutaryl-CoA dehydratase"
                     /protein_id="WP_005809839.1"
                     /db_xref="GI:492324615"
                     /translation="MAKCYLGVDSGSISTKGVIIDQNNKILAEKYLWTEGNPVEAVKA
                     VIADLKAQIDGINCTKDADGNDDISGNGGNDNSSNGDSGNRVTQGIEIKAVGTTGSAR
                     RLIGALLNAQVVKNEITAHAVGTLSVYPDVRTIFEIGGQDSKIILVEDGIVVDYAMNT
                     LCAAGTGSFLSSQAKRLGMEVEEFGELALRSQNPTKIAARCTVFAESDMVHKAQIGHK
                     KEDIVAGLCHAVVANYLNNVGKGKHTKAPIVFQGGVSKNVGVIKAFEEATGETIHVDP
                     HAHLMGALGAALLAKSSGQEQDFNFSMTEMHFDTRGVECQGCPNNCEVICVYRNEELI
                     DAWGNKCDKGAVRGSEAVREKEEPVVKGDEMVS"
     gene            719202..719399
                     /locus_tag="DSY_RS03345"
     CDS             719202..719399
                     /locus_tag="DSY_RS03345"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005809837.1"
                     /db_xref="GI:492324612"
                     /translation="MKWYRNEGAGKRDFRKFGTQVLEGAGKNAGAFFAITRKYKLDWL
                     ISSLRLSALTDCIQVAYNSAH"
     gene            719505..>720263
                     /locus_tag="DSY_RS03350"
     CDS             719505..>720263
                     /locus_tag="DSY_RS03350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942861.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="collagen"
                     /protein_id="WP_041272811.1"
                     /db_xref="GI:752603424"
                     /translation="MALLTTGLIENSPVSGIRATTVLSVRVVNDDSASASVQISGSYV
                     SGTTTTAYVLEVFILEPGEVATRSYSANFDAFQFQFTTSLENVEISAWGKDNEGNLIA
                     AHRVLPAELDPLDQNGGAGPTGATGATGPAGPTGATGATGPAGPTGATGATGPAGPTG
                     ATGATGPAGPTGATGATGPAGPTGATGATGPAGPTGATGATGPAGETGATGATGPAGE
                     TGATGATGPAGETGATGATGPAGETGATGATGPAG"
     gene            721068..721613
                     /locus_tag="DSY_RS03355"
     CDS             721068..721613
                     /locus_tag="DSY_RS03355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_018306036.1"
                     /db_xref="GI:517117218"
                     /translation="MNKAGVTLKGYPNTLIELQAAVIPFAVTGSGVTIDGLTITSDNP
                     YAVPFIQLGGSNHKLINNYFYGPPQAGPSDTWVVNRGFVTQANNMQNLTVQNNIFYFL
                     RQPAYLNPNTTGYIIDNVVYNTRGFVVDRAVVVLSGNSWGSPENAVDIALLVGTIAGP
                     PYDPLADLAANNSDASISDQR"
     gene            721712..722017
                     /locus_tag="DSY_RS03360"
     CDS             721712..722017
                     /locus_tag="DSY_RS03360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_005808260.1"
                     /db_xref="GI:492319843"
                     /translation="MILHVLSIVLVEAYWVLRKIYNFDKKMILGVFEDFIEADGVELE
                     EDGLVQRVLACFRRVNVDLVDVYLAERSRSPALSVLTWNAEDFRKLECEFYRPQDLR"
     gene            722385..723491
                     /locus_tag="DSY_RS03365"
                     /old_locus_tag="DSY0623"
     CDS             722385..723491
                     /locus_tag="DSY_RS03365"
                     /old_locus_tag="DSY0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_011459186.1"
                     /db_xref="GI:499778452"
                     /translation="MEFRYFMPTEIYFGEDVVLKHQEVFKTIGSKALIVTGRSSAKNN
                     GSYDEVTKALSETGVEYILFDEVEQNPSLETIEKAGAIGKANKADFVIGIGGGSPMDA
                     AKAIAVFIKNPEITKDNIFSGQKLASIPVVVVATTAGTGSEVTQYSIITSNKERTKKN
                     LGQRIFPKVAFLDCKYTYDLPYDITVNTALDAFTHLVEGYLSSKSTPMSDIYGEKGFE
                     LFKDCFDRLLNNELDKEFRRKMMLASTLAGMLISQSGTSLPHGMGYALTYHKGLPHGL
                     ANSILTMEYLKSFQDQRKIKKMLSILQLDDLTELEGIFKKLLKVRIEIAEEEIREYAK
                     NFMANKDKLKNHPEAVELEDIVGIYYRSLCEHRE"
     gene            complement(723531..724574)
                     /locus_tag="DSY_RS03370"
                     /old_locus_tag="DSY0624"
     CDS             complement(723531..724574)
                     /locus_tag="DSY_RS03370"
                     /old_locus_tag="DSY0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459187.1"
                     /db_xref="GI:499778453"
                     /translation="MNIGYLQETLSSITEVKPLGKTAEVNGVLCHIIGLVRYGDILRL
                     AALQYDDEFAERAEAAEIAELNGLPEKPETNRERLRGDRSLDMTNIFHAVQTIRIGEK
                     QFEINEMETSRCDWQNWQIPVLLTEFLKQGWHPAGLEYQSMENLFLTFMRLSGDYDCL
                     PDVGENPAVQLTFRREHIPHPVEQPLTLSVGADYPDRLYFQDKNTGEKHWVQINRVYL
                     ADMWAEMRQTFNDPRLTEQFSAAELAEHQGEFERRFATICPPGMCFPVIEYECEEDLY
                     LQFYSQEWLDNLPQSNSSCIGFIMKPDKKAGISGLPLKAAVIEEPMPADRRIIDTELF
                     SCSLPRQYDDVIL"
     gene            724877..725083
                     /locus_tag="DSY_RS03375"
     CDS             724877..725083
                     /locus_tag="DSY_RS03375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808264.1"
                     /db_xref="GI:492319851"
                     /translation="MGTKKKKQTIGVIKPLELMKRSPNKMNTSMAVVRQGTGVHQDKT
                     KYNRKRMKQGGFDDGYPCVSHWAV"
     gene            725133..725822
                     /locus_tag="DSY_RS03380"
                     /old_locus_tag="DSY0625"
     CDS             725133..725822
                     /locus_tag="DSY_RS03380"
                     /old_locus_tag="DSY0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-binding protein"
                     /protein_id="WP_005808268.1"
                     /db_xref="GI:492319862"
                     /translation="MSKDQKAGKIKIIKNGPYWVTGNVPLSEKIITPKGKGYEFKEGR
                     RFPPSEEYYLCRCGKSKKAPFCDGSHTRTNFAGTETASRAKYQDRAEVFTGPGLDLLD
                     DNRCAFGRFCHTEKGIVWELIENSDQDEYREMAIKSANECFAGRLTAVDKTGKAIEPE
                     YEPAIEVLQDPEKGVSGGLFVKGYIPLESADGEVYEVRNRVALCRCGRSGNKPFCDAT
                     HVPIGFSDGEL"
     gene            725865..726194
                     /locus_tag="DSY_RS03385"
                     /old_locus_tag="DSY0626"
     CDS             725865..726194
                     /locus_tag="DSY_RS03385"
                     /old_locus_tag="DSY0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019849363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-binding protein"
                     /protein_id="WP_041272217.1"
                     /db_xref="GI:752602830"
                     /translation="MKVGIIRCQQTEDMCPGTTDFKVAREGKLAFAETGPVEVIGFLS
                     CGGCPGKKAISRAKLMVDRGAEIIAFASCIKKGNPIGFPCPHFAQINEAVVKKVGSEV
                     QVIDWTH"
     gene            complement(726333..726599)
                     /locus_tag="DSY_RS03390"
     CDS             complement(726333..726599)
                     /locus_tag="DSY_RS03390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="growth inhibitor PemK"
                     /protein_id="WP_015942865.1"
                     /db_xref="GI:506423146"
                     /translation="MERFVKGDVVVVPFPFSDLTQAKRRPALVISSLKSDDLILCQIT
                     SQNVRDDYAITFENQDMNDGKLDKISNVRPNRLFTADHHIVLYT"
     gene            complement(726584..726778)
                     /locus_tag="DSY_RS03395"
     CDS             complement(726584..726778)
                     /locus_tag="DSY_RS03395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018211978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808281.1"
                     /db_xref="GI:492319884"
                     /translation="MENREVLLKELEQIPDPILVEILRYARFLKAKAAQEKFLSAHMS
                     ENVLAKDWLLPEEDDAWNDL"
     gene            complement(726957..727601)
                     /locus_tag="DSY_RS03400"
                     /old_locus_tag="DSY0628"
     CDS             complement(726957..727601)
                     /locus_tag="DSY_RS03400"
                     /old_locus_tag="DSY0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_005808283.1"
                     /db_xref="GI:492319887"
                     /translation="MLRVSHIIYKVDHLQQAVEDFRRRGFEVEYGTKRRPYNALIYFS
                     EGPYLELLASTGMPKPLKRLLRFFGKDAMVDRLDYWDTHGGGPCGLALETLKKDLNEE
                     RKVLERQGLGYFLMKSGRSDTKGRKLRFTGLFPDDMQIPFFMTYFNIDPKPRNFTHPN
                     GVKRIGSIAFGTEERYIPLIRELCSDEMLHLFVGKGIKDMEFEYAPGSTPVSLD"
     gene            complement(727628..728461)
                     /locus_tag="DSY_RS03405"
     CDS             complement(727628..728461)
                     /locus_tag="DSY_RS03405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyketide methyltransferase"
                     /protein_id="WP_005808284.1"
                     /db_xref="GI:492319889"
                     /translation="MKNQPALDTHSIQSTMLLPLWGRAAASEKNPDILYDRQAIEIIK
                     NCDYDFDSIAKVFGEFSGICYVVRARQIDDAIRAYMQAHPRAVIVNIGAGLDTTFSRV
                     DNGLIRWYNLDLPDAIAYRQSFIPDSERSQSIAKSFFDTAWFEDVHFTPEEGIMFVAG
                     GVFYYFREEELREVVAAMARRFPGGELYFDAESKQAVDKSNRMVQKTGNQGAPMYFYV
                     NDAAALNSWAPEISVVSCLDYFAGIPRSRQWSWRSRLMARASAWMGLMKFIHLRFSHE
                     R"
     gene            complement(728746..728967)
                     /locus_tag="DSY_RS03410"
                     /old_locus_tag="DSY0630"
     CDS             complement(728746..728967)
                     /locus_tag="DSY_RS03410"
                     /old_locus_tag="DSY0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011459191.1"
                     /db_xref="GI:499778457"
                     /translation="MYERIRNMREDMDMTQSQIAEHLNIHQTTYSDYEIGKLNIPVQV
                     LGKIADLFGTSIDYLVNRTDVKKPYPRRK"
     gene            729327..729710
                     /locus_tag="DSY_RS03415"
                     /old_locus_tag="DSY0631"
     CDS             729327..729710
                     /locus_tag="DSY_RS03415"
                     /old_locus_tag="DSY0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="death-on-curing protein"
                     /protein_id="WP_005808288.1"
                     /db_xref="GI:492319896"
                     /translation="MIRVLNIENIILFHEKIIKETGGSKGVRDIRLIESALNRPFMTY
                     DGRDLYSSNIEKIAVIMHSLISNHGFVDGNKRIGIAVMLILLKMNKLMITYTQDELID
                     LGLKTAEGTIDEKDIINWIKEHIRE"
     gene            complement(729843..731150)
                     /locus_tag="DSY_RS03420"
                     /old_locus_tag="DSY0632"
     CDS             complement(729843..731150)
                     /locus_tag="DSY_RS03420"
                     /old_locus_tag="DSY0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_011459192.1"
                     /db_xref="GI:499778458"
                     /translation="MSFVKSKEDIVCVSAVRTPFGKFGGSMKDIDVYELGAIAMSKAM
                     AKISLDPALIDEVWWGNGDTSSTKDPFTPVVARQTMLKAGISPETPSITYDQACTSAL
                     STVKYGARSIKLGEAQMVMTGGSTSFSTVPFLLRDIRWEGKKHSSFLVEDPIIPLGYK
                     DYAPVAVDSGNVAVEYGVSRQEQDELALTSHVKYGQAWERGFFKGEMEPLEITKKDKK
                     GKVLSAQLLAKDEQYRPEISMESLARLKPIFDNPTCTAGNAPGMNDGAAAQIITTREH
                     AEQLGLPILYTLVGISAIALQPRIMPVSPAFAIKKCLDEAKLTIDDLKVIEINEAFAC
                     VPLVSLKLLANERFLTGNYKAMVREASAQPILDHDPDRYLKLKEKLNPNGSAIAVGHP
                     NTASGARLMMTAAYQLREAGGGYAACAICGGLTQGAGAIIWVE"
     gene            complement(731169..732473)
                     /locus_tag="DSY_RS03425"
                     /old_locus_tag="DSY0633"
     CDS             complement(731169..732473)
                     /locus_tag="DSY_RS03425"
                     /old_locus_tag="DSY0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybutyrate CoA transferase"
                     /protein_id="WP_011459193.1"
                     /db_xref="GI:499778459"
                     /translation="MDWKETYKKRLTTADEAVKVVQSGDFVIPGHAASESELLVSALV
                     KRYRELENVTIIQGVSLGSSPYCQPEMAGHFFLKSIFLGANTRKSVWDNRGAFFTLMF
                     HEFPRAFREGHLRSDVFMTMVSPPDEHGYCSLGMSVDHSKELVKCAKTVIAEVNPNVP
                     RTYGDTLVHVSDLDYIVENDGPILELTRFAAMNDVTQAIGRHVAALIQDGDTLQMGAG
                     TIPDAILYYLKDKRDLGIHTEMFSDGLIELIEAGIVNGSRKTLNPGKIVVTFAQGTKR
                     VYDYIHNNPLFEFRPVDYVNNPCVIAQHDNMVAINSALEVDLSGQVCAEAIGHQQYSG
                     IGGQLDFIRGAGAAKNGRPIIVLQSSAKNGTVSRISCKFKPGTPVTTTRNDVRWVVTE
                     YGAVNLYCKSDSERAAALISIAHPNFREQLQEEYQAMYGRAL"
     gene            732824..734254
                     /locus_tag="DSY_RS03430"
                     /old_locus_tag="DSY0634"
     CDS             732824..734254
                     /locus_tag="DSY_RS03430"
                     /old_locus_tag="DSY0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_011459194.1"
                     /db_xref="GI:499778460"
                     /translation="MIEPSTMPSNSYSLEEVMDNSYDSIFVTDAVGNILMANPTAERL
                     LNLTITQMVGRNIRELVEQGHWDKSIALEAIEKRTTVTGMIKTRDGINLMCTSRPLFD
                     TQGNITMVISNSRDRDTLVKLAQTLDKERELVQRYKEEVQYLREQGVKDRHLVAESTA
                     MKNLLLEANWVGPTESSVLLYGESGTGKEILAKYIYSISRRAKEAFITVNCSAIPENL
                     IEAELFGYEKGSFTGADAKGKPGLFELADRGTIFLDEIGEMPLVLQAKLLRVLENGEV
                     RRLGGIHSRKVDFRLICATNRDLKKMVEHKTFREDLFYRINVVPLQLAPLRDRPEDIM
                     AISDVLLKELNKKYGYDKVFSTETLKGFLNYSWPGNVRELRNLIERLAITTRGRVIDY
                     QVEEMPYPPDNRAAGSHQEENGTLRIQVKAKAPLKKVMSQVEQEYIKNTLQDCQGCVS
                     EAARILGIDRSAIYRKVQVVQLRDQD"
     gene            complement(734400..735014)
                     /locus_tag="DSY_RS03435"
                     /old_locus_tag="DSY0635"
     CDS             complement(734400..735014)
                     /locus_tag="DSY_RS03435"
                     /old_locus_tag="DSY0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_005808295.1"
                     /db_xref="GI:492319909"
                     /translation="MAEDKRIRKTKRYIKQTLIEILTEKPFEQITVTELCKRSDISRI
                     TFYAHYNDKFALVDEMFAEMLESATRDYRNSQKENNPANDTIQTFCNLLDCILNLYNE
                     NMSLLTYTTIDKNPYLYYMFYSYIVRNVELVIIHRDKVIKPKYSIKQVSGFICNSLWA
                     FIIEAQTEGSTINMVRKDAKKVLTGILEANIVTEMRDNDPEKEG"
     gene            735155..736042
                     /locus_tag="DSY_RS03440"
                     /old_locus_tag="DSY0636"
     CDS             735155..736042
                     /locus_tag="DSY_RS03440"
                     /old_locus_tag="DSY0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808296.1"
                     /db_xref="GI:492319911"
                     /translation="MQDYILSCCSTADLSAEHFSEKNIHYVCFHFSLDGEQYLDDLGH
                     SIPFDDFYSAMARGAATMTSQVNTEEFVAYFTPFLEEGRDILHVCLSSGLTGVINSAY
                     TAKDILQERFPQRRIYIVDSLGASSGYGLIMDTLAEKKAAGMDLDSLYTWLEDHKLEM
                     HHWFFSTTLEYYIKGGRISKTAGFFGTLLGVCPLLNMDNNGKLIPRKKVRGKKRVITE
                     IVDRMAEHAQGGLSYGGKCYISNAGCYEDARAVADLVEGRFKNLNGSVEINHVGTTIG
                     SHTGPGTVALFFWGDRRND"
     gene            736035..736688
                     /locus_tag="DSY_RS03445"
                     /old_locus_tag="DSY0637"
     CDS             736035..736688
                     /locus_tag="DSY_RS03445"
                     /old_locus_tag="DSY0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005808298.1"
                     /db_xref="GI:492319914"
                     /translation="MTRREKAAQAVRVITVPPVMVLALLLLLFFQHKGVFTSAGELLL
                     SVFFLSVIPLLAYPFSRLFPRCKAKGRDGQRNLAFTLSLIGYAGAVLWGMIAGVSGEL
                     LFIFLVYLASVVILTFFNRVIGVRASGHASGITGPLLLTVYFIGGKTVIPCVLLLGAI
                     LWSSLTLKRHTLRELLLGALSAMLAFFLCLIVICFRHSMGAVSKLVDSLLASPLLLV"
     gene            737100..737843
                     /locus_tag="DSY_RS03450"
                     /old_locus_tag="DSY0638"
     CDS             737100..737843
                     /locus_tag="DSY_RS03450"
                     /old_locus_tag="DSY0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetyl-CoA reductase"
                     /protein_id="WP_041272218.1"
                     /db_xref="GI:752602831"
                     /translation="MAKFAGRVAVITGGAKGIGEAIVRKFYGEGAKVAVLDVDAAGAR
                     QLALELDPSGEKVIGLGCNVVSREGVKAAFAEIMAKFGTVDILVNNAGITRDAIFHKM
                     TEQQWDDVMAVNGKGLFNCTQEAWLIMREKKYGKICNLSSTNSSGEAGQANYSFTKAG
                     TIAFTKSLAREGGRYNINVNCVRPGVIDTEMMRAVPEQALEDYINKTAFKRMGQPSEV
                     ADVIAYLCSEESSFVTGEEILVAGGYIYR"
     gene            737898..739076
                     /locus_tag="DSY_RS03455"
                     /old_locus_tag="DSY0639"
     CDS             737898..739076
                     /locus_tag="DSY_RS03455"
                     /old_locus_tag="DSY0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_011459196.1"
                     /db_xref="GI:499778462"
                     /translation="MQDVVIVSAVRTPIASFGGALQGYGAVNLGALVIREAVQRAGIQ
                     GKQVDEVIMGNVLQAGLGQNPARQAALKAGLPVETTAQTINVVCGSGLKAVIAAAQAI
                     RAGDAEIVAAGGMESMSDAAFLLEQARWGQRMGHGTLVDSMIKDGLWCAFNEYHMGIT
                     AENVAEKYGISRREQDEFAAWSQAKAVAAIAEGRFREEIVPVAIPQRKGEPVIFDRDE
                     YPRAGTTVETLAKLKPAFKKDGTVTAGNASGINDAAAACVLMSKEKAAALGIPYLAVI
                     KGYGMAGVDPAIMGVGPVDAVKKALQKAGISLDELDLIEANEAFAAQALAVTKELGFP
                     GEKVNVNGGAIALGHPIGASGTRILVTLVHEMKKRRDKLGLATLCIGGGQGIALVVGG
                     "
     gene            739137..740657
                     /locus_tag="DSY_RS03460"
                     /old_locus_tag="DSY0640"
     CDS             739137..740657
                     /locus_tag="DSY_RS03460"
                     /old_locus_tag="DSY0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_041272219.1"
                     /db_xref="GI:752602832"
                     /translation="MSATLVETRFGLVEGIREGGVSIWKGIPYAAPPLHSLRFRPPRE
                     PAAWAGVREAKEFGPAALQGESPSMKFLGDSPLHKREDCLYLNIWSPGADQKKRPVMV
                     WIHGGSFMYGSGSSHLYDGKSFAEQGDVVVVTLNYRLGVFGFLHLSDIGGEAYRGSGN
                     CGLLDQVAALTWVRENIEAFGGDPDNVTIFGESAGAVSVGNLLAMPLARGLFHKAILQ
                     SGTARCKVTLEAAVKMTEQLLAQLQIERQNLSELAALPAEKIIEASGIFPRRAFGPVG
                     DGVVIPEHPEKVLYAGLAKDIPVLVGTNAHENKLFTYFDPAWKDMDESEIKVFLERTF
                     GSSWAAGSHSAAQADALNQALSKALNQASNQAGYEDAMTHYVFTYPAIYFSEGQAKHG
                     APVWMYRFDYASKALGGEAKAFHGLEIPFAWNTLLAQETEELTGKEPCRFQLAGLMHR
                     AWIAFARHGDPNTPGLPDWPPYNEENRATMLFNTHNEVVNDPDGRQRLSWEHVFKN"
     gene            complement(740875..742122)
                     /locus_tag="DSY_RS03465"
                     /old_locus_tag="DSY0641"
     CDS             complement(740875..742122)
                     /locus_tag="DSY_RS03465"
                     /old_locus_tag="DSY0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005808714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS116/IS110/IS902 family"
                     /protein_id="WP_005808714.1"
                     /db_xref="GI:492320698"
                     /translation="MSLFVGIDVSSSDFKVRILDERGNEPVKRLRALNDQPGCEQVAR
                     YLFDACAQVNVDRLVIGLEATSVYSWPLQMFLAEDHSLAPLQPQIYSFNPKVVANFKK
                     AYVDLPKNDWIDAWVIAERLRFGRLPEGSQVDFRYLPLQRLTRFRCHLIEMISREKNY
                     FLTNLFLKFSTLAQGAVFSNTFGATSESLTLEFFSPEEVAARPLDELIDFLMEKGKRH
                     FEDPETKARELKEAARKAHRLRGSLLQPINLILATSIETIHTLEKQVKKIDKAIEAEI
                     RHFPNTLITIPGIGPVLSAGIIAEIGDIRRFPNEGALAKFIGLTWRTHQSGDFTADDT
                     PLTRTGNTYLRSYIIQAANLVRQKEPEYKVFYQRKFSESKTHHHRRALVLTARKLVRM
                     VDALLRSNQIYRPHGNRGNANQA"
     gene            742762..744345
                     /locus_tag="DSY_RS03470"
                     /old_locus_tag="DSY0643"
     CDS             742762..744345
                     /locus_tag="DSY_RS03470"
                     /old_locus_tag="DSY0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011459198.1"
                     /db_xref="GI:499778464"
                     /translation="MSKLKRRSLTMVTLFVVLMMVISGCGSQSGSTKTPDTPPTANPV
                     SESPGTPQHGGSLTVAYVADVTNFDPIKGTTGNDHALLWPLYDTLVKFSPDMKPEPGL
                     AASWEFPDNMTILLHLREGVKFSDGSPFNAEAVKFNIDRVNSTDSQISDLKNIQSVEV
                     VDDKTVKLQLSQPDSSIILALSDRGGMMVSPTAVKTHGADYSLHPVGAGPFIVTNHIP
                     NGEIGYEANQNYWQKGLPYLDKLTVKVIPDANSQINALKTGQVDFLPNVQPQMVAALK
                     ADANIVLSPTNTLALNMIYLRTDAPPFNDKAARLAVLYGINRQQLIDAINFGQGTVAV
                     QPFPKDYWAHDDSINIPYDPEKSKQLLKDAGLSNVSFTLTTYPIEWWTRLANGIKGQL
                     EEVGINVNIKTLEPNAAVQSFLGDKETNALTGNWSGRPDPQMTIASLYGKDSYYNPGK
                     ATTSELESLIKEAAATTDQNQRAGLYKKIVNTSVVENAFSIPTFSQPMTAAMSKKIQG
                     FEPNLLGKAIFSSLWVEQK"
     gene            744411..745355
                     /locus_tag="DSY_RS03475"
                     /old_locus_tag="DSY0644"
     CDS             744411..745355
                     /locus_tag="DSY_RS03475"
                     /old_locus_tag="DSY0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015263084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_005813354.1"
                     /db_xref="GI:492336616"
                     /translation="MFLKFMLRRFLYVIPMLFITTLVVFSLILLIPGDPVLAILGENA
                     TYEKVAELRQQLGLDQPVIMQYIHWLNNAVHGDLGRSLFTGQLVGHAIQQHLAITIQL
                     VAVGMTFAIAGGMFFAITSIYFPKSWMDYAARFLGTLGTAVPNFLCAMILIIIFSLNL
                     NWLPATGFISITDGAGSFLKHILLPGFSLSLAGIAVITRQLRSSLMETMDAEYIRTAY
                     AKGAGRYRAIFKHGLQNAMLPVVTTIGLLMGTMLGATVVVENIFAIPGMGQLVINAIG
                     QRDFTVVQGVVLVMIVMVVVINFLTDIVYALLDPRIEY"
     gene            745369..746211
                     /locus_tag="DSY_RS03480"
                     /old_locus_tag="DSY0645"
     CDS             745369..746211
                     /locus_tag="DSY_RS03480"
                     /old_locus_tag="DSY0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter permease GsiD"
                     /protein_id="WP_015942881.1"
                     /db_xref="GI:506423162"
                     /translation="MSFKTIFKRLMAERLAFASFIFLVMLVIVALLAPHIQPYDPFKQ
                     DLTKVMQLPSAEHWLGTDGLGCDVLSKMLMGSQTAIKSALFAIMIPLLVGVPLGVLSG
                     YFGGVIDDVFMRIVDAIIAIPALILALGITSALGVNLWNAMMAIGIVFTPKFARLARG
                     QTLQVRLEPYVEAAKISGAGFVWIMFRHILPNISPPIVVQASFNLSMAILTETTLSFL
                     GMGAQPPDVSWGNLIQQGYSLIYINPWMIVYPGIAIMLTILAGNFLGDGLRVALDPKQ
                     QRIF"
     gene            746227..747264
                     /locus_tag="DSY_RS03485"
                     /old_locus_tag="DSY0646"
     CDS             746227..747264
                     /locus_tag="DSY_RS03485"
                     /old_locus_tag="DSY0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_011459200.1"
                     /db_xref="GI:499778466"
                     /translation="MKTETPLLEVNHLKTYIPTSKGEIKPVDDVSFTIAKGEIVALVG
                     ESGSGKSVSSLSIMRLNAGAIKYRPDSSILFAGRDLLKLKEKELRKIRGNDIAMIFQD
                     PMSALNPVHPIGRQIAEAILLHKKVSPKEAQKTALELLNKVGIPDAQRRLKDYPHQLS
                     GGMRQRAMIAIALACNPKLLIADEPTTALDVTIQSQILNLLRDLQKEFGISILLITHD
                     LGVVAETADRVLVMYCGKIVEEGNVEDIFAHPQHPYTKGLMVSIPSLSGPSKETLDAI
                     PGVVPNPLELPQGCNFVTRCGSAMAKCHEAAPELEQHPSGNRVSCWLHTSGKGDDEDD
                     REATALVTAGH"
     gene            747224..748207
                     /locus_tag="DSY_RS03490"
                     /old_locus_tag="DSY0647"
     CDS             747224..748207
                     /locus_tag="DSY_RS03490"
                     /old_locus_tag="DSY0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_041272220.1"
                     /db_xref="GI:752602833"
                     /translation="MTEKQPLLSLQGIKKHFPVGSGLFGQKSNSVKAVDGVSLDIYPG
                     QTVGLVGESGCGKSTIGRMVVGLTEPTAGEIYFEGRKLSDYKSKKAMGKNLQMIFQDS
                     YSSLNPRMTVADIIAEPLVLHKVGTHKERGKRVDELLERVGLAAYHGSRYPIEFSGGQ
                     RQRIGIARSLALQPKLIVCDEPVSALDVSIQAQILNLLKEIQKDLGLSYLFIAHGIQV
                     VKHISDQIAVMYLGKIAEFAGKEELFANPRHPYTKALLAAVPLPDPKLRDRERILLKG
                     DLPSPANPPAGCRFHTRCPVAMEKCKVTDPALIPTSQDSRTACLLYDRSIV"
     gene            complement(748336..749244)
                     /locus_tag="DSY_RS03495"
                     /old_locus_tag="DSY0648"
     CDS             complement(748336..749244)
                     /locus_tag="DSY_RS03495"
                     /old_locus_tag="DSY0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011459202.1"
                     /db_xref="GI:499778468"
                     /translation="MRIEYLHYFIEVARCRSINKASKNLRLTQANLSKMMAALERHFA
                     TPLFERSNRGITLTEHGKHVLEWSQKVMAEQTQLIQAFAEDKTHQNRQGKLTILCPAN
                     IAGDSNANVINKFTGEYPNLTISYQEMGVPEIIKQVHKNRDYVGIIMLIDDLYNELIT
                     DELCYYPMREIKFVVYSHKDSRFAKQGFKSISLKALSKEQLILYKPTSLSPSPFEDLF
                     DQYGLDNIKFSVSNLFTFYDILQKGQYITLGAARQAKFFPKVLDGLVTTPIRDKINCR
                     IGILIHRENKDNAMIQQFIRFYSESK"
     gene            749449..751503
                     /locus_tag="DSY_RS03500"
                     /old_locus_tag="DSY0649"
     CDS             749449..751503
                     /locus_tag="DSY_RS03500"
                     /old_locus_tag="DSY0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide pyrophosphatase"
                     /protein_id="WP_011459203.1"
                     /db_xref="GI:499778469"
                     /translation="MKRKALTDKVIVLGVDGFDPRLAKKFMDQGKMPALKEFTGRGSA
                     REDLVLLGAMPTVTPPLWTTLATGANPGTHGITCFFASDPVNIDTMYYNLDSRQSKAE
                     PLWNVFAEEAGKKTLVWHWPGSSWPPTSDSPNLHVVDGTQPSGINNGIPFLDLLKVIT
                     GSEKIASSQYLPNTSHVAQGQGCIIDNAADLMEDGDQAETSVFRKVIAAGNHAKGFQF
                     SITEQDECEIEALGNMVCDTIKAAIKPAAGWAQAPAEAKEFTFFVSGGLERRPALILP
                     NEQGVYDSIQFYKSKKETDPYLTLKRGEIRFDVRDTVKNDQGENVPCNRNYQVLELAE
                     DGSKFNLIINNASQVGRDDYFHPKSLYREVVENIGNVPVNFRVNGANEILVRETMLPS
                     WENYCNWQAECLTYFMKNNKYDIIFSHLHNLDGVGHYFWHYACNQEEWKDNNELTYQQ
                     YQEEAYCQTDRYLSKFLPFLDQGWTMIITSDHGLLTQEYHGVILGEIHGVNVPVMAEL
                     GYTVMVKDEKGRDTKEIDWSKTRAIAIRGDHIYINLKGRNPHGIVEPADKYELETQII
                     SDLYNYRDPHTGRRVISVAVRNKDAVHFGMGGPECGDIVYFTEEGFNKIHADSLSTQW
                     GYADTSVSPLFVAAGPGIKENCVTERVIRQADVAPTIAALTGVRMPAQCEGAPVYQII
                     SE"
     gene            751564..753531
                     /locus_tag="DSY_RS03505"
                     /old_locus_tag="DSY0650"
     CDS             751564..753531
                     /locus_tag="DSY_RS03505"
                     /old_locus_tag="DSY0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011459204.1"
                     /db_xref="GI:499778470"
                     /translation="MGRSQSMTKDEKDLDSMDEKDLEALAEDGKRRPLTGGVALLVGA
                     LAVIWTLYTIYSTIFGVLNVLVYRGIHLTFALALGFVLFPPSKKLAGHKIAYAIDLLL
                     ALTSVALGIYVLNSAGSFADRIGIPNRADFIFGAIAVVLILELTRRVVGKSMTIVAGV
                     FLVYALFGRHLPSFLAHPGVDVKMLTSTLLISLEGIFGVALGVSANLLLIFIVVAQFL
                     VGTGTGQFIMDLSSSLIGWARGGPAKIAIISSGLFGSISGSAVANVLSTGAVTIPMMK
                     KLGYKPHFAGAVEAAASTGGQIMPPVMGAAAFVMAEVLGVPYAKVCVSAALPAILYYV
                     ALLIMVDLEAARTQLRGIPKENLVPVKKTLKEGWFYIIPLVILIYLIMTGSSPQRAGV
                     ITIAASIIINLLNWKNRLSLKQYLHMLKEGSLGCILIAMACATAGIIMGCVNLTGLGP
                     NFSGILVSLASGNQLALLLLTMVASIILGMALPTLICYMILAVLIAPALVSMGVEPMA
                     AHLFVLYFGVISFVTPPVALAAYAGAAIANANAMKTGWTAAKIATCMFVLPFMFVYNP
                     ELILIHGLSWSVLPIIITSVIGTTAICMAIQGYAFTPIRHWPVRVILFLAGISLIYPG
                     MYTDLLGIACFALIVGANYRFKQKDRVILSE"
     gene            753565..754578
                     /locus_tag="DSY_RS03510"
                     /old_locus_tag="DSY0651"
     CDS             753565..754578
                     /locus_tag="DSY_RS03510"
                     /old_locus_tag="DSY0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018214286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter"
                     /protein_id="WP_018214286.1"
                     /db_xref="GI:517016564"
                     /translation="MKKMNKAVSVLVLTAMVLMLISGCGSGAGSSSGNDQDKQKPAAN
                     TQLRIMSTSGGDKYFLTTGICKISDDSSLPIKVVHQTVAGDAEAVRRLKAETADIGMA
                     NVFVASMFYNGTYTFEKDGAFKEMRALFAGPSAVAQFAVRADSPVKSFEDIKNKTRMA
                     TFMGASQVYTKLILDAYGKQENVDYIFISSNYADMADQIKDKTVDVIQFWSGAPCPQA
                     ENIEADVPIRLLPVNDQAIENIKKAIDPSAYPAVVKAGTYKGQAEDVTVPATPTYFIA
                     RANTDEETIYNFTQLVLENLDELVKIHPLAKEIDINNLTQGLPFPLHPGAEKYLREKG
                     YLK"
     gene            complement(754681..755586)
                     /locus_tag="DSY_RS03515"
                     /old_locus_tag="DSY0652"
     CDS             complement(754681..755586)
                     /locus_tag="DSY_RS03515"
                     /old_locus_tag="DSY0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011459206.1"
                     /db_xref="GI:499778472"
                     /translation="MEMRQLRYFDSVVKYGTMREAAAKLFISEPSISQQINELQKEIG
                     VPLFEKQGRKIALTAEGKQLLPLVQAILEAVTELETGISEILNPSSGLIRLGVIPITR
                     LDLVPKKLTEFVKIYPDICVELIESGTSEIIERLLNDTMDVALIAANSRIKSLMEMSG
                     IKHKVVSNANSVAVVSCSHPLAKYDKISFSRLLNERIILRRQGIYREEIDNFLGDSVK
                     NDGIYSTDTYETAIKLVDSNLGIAIVPETFIRTYGLNEGSNIKILFLDDFQVSLDICF
                     IYKKRNYYPLFLTNFMRIFTDNNDG"
     gene            755863..756363
                     /locus_tag="DSY_RS03520"
                     /old_locus_tag="DSY0653"
     CDS             755863..756363
                     /locus_tag="DSY_RS03520"
                     /old_locus_tag="DSY0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tricarboxylate transporter"
                     /protein_id="WP_011459207.1"
                     /db_xref="GI:499778473"
                     /translation="MSPNTLPGRCEAMKNLLADRIAGGFFLVIGGMAIYEAIRLYPMH
                     IGRSIVGDETFIGFLGVALLILGGLFLFVLKPQGDEQAEFPTGQLRKKMLFVMGLVFA
                     YWGLLQVIGYPASTFIIGLGLFRTIGDYGWLRCTVFSALLSIVFYGIFVMWLKTPFPQ
                     PLITIF"
     gene            756377..757885
                     /locus_tag="DSY_RS03525"
                     /old_locus_tag="DSY0654"
     CDS             756377..757885
                     /locus_tag="DSY_RS03525"
                     /old_locus_tag="DSY0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459208.1"
                     /db_xref="GI:499778474"
                     /translation="MEALQMLFSGFALALEPSNILMAALGAFVGTMVGVLPGLGPTSA
                     IAILLPLTAVLPPTQAIIMLAGIYYGAMYGGSSTAILLNIPGEVASVPTCLDGYPMAQ
                     QGRGGPALGIAAIGSFIAGIMGIIALTFFAPLFAEQALKFGPPEYFALMLLALTIVVS
                     LGGASISKALAMGFFGYLLSLIGLGTMTNMPRLTFGYTPLWGGLDVISVVIGLFAISE
                     VLNGIEEKKIAISMGNIGSVFPGLKDLKQSIKSIFRGGALGFFMGLLPGCSPAVTTFL
                     AYDLEKKCSKTPERFGKGAIEGVAAPESANNATSSAGFIPLFALGIPASPPLAVLLGG
                     LMIYGLTPGPLLFEQNGDFVWAVIASMFIGNVMCLVLNLPLVGLWAKLTQIPYGILAP
                     IILLISIVGAYTVRNDMFDVLVALIFGVLGYFMNKFNWPVVPFIICFILGPMLERSLL
                     QSFGMAFENPFIFFQRPISLTLLVATGIFLVVSLKLRRRTQSRIDNSGFEVK"
     gene            757916..758926
                     /locus_tag="DSY_RS03530"
                     /old_locus_tag="DSY0655"
     CDS             757916..758926
                     /locus_tag="DSY_RS03530"
                     /old_locus_tag="DSY0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035214213.1"
                     /db_xref="GI:737229880"
                     /translation="MNKKMTWLIGILILTLALAGCSSSAQGPSETAKEDPPYPTRQIE
                     LVVPAGPGGLTDLTARAVADYVSKKWNQPILVVNKPGAGNVTGLQYGLMQGKPDGYTV
                     VADNIAASVLMVAGMKNPPIKLEDRIFVSKFVENPMCFSVAADSQFKDMKELVEWTKK
                     SPEKLTHTSLSATSMNALTAAELCKAIGVDYKQTQPILVTSGSEGITMIAGGHAILGD
                     QSVQETYPLAAGGKLKVLAIAAKERSPLFPDVPTCQELGIDIDVTWYGGISAPKGTPD
                     YIVKKWDETIAEMVKDQDFINKMNELHANISYLNTADYNASIKEQVERYTQLFDSIGV
                     RQ"
     gene            759514..761247
                     /locus_tag="DSY_RS03535"
                     /old_locus_tag="DSY0657"
     CDS             759514..761247
                     /locus_tag="DSY_RS03535"
                     /old_locus_tag="DSY0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011459210.1"
                     /db_xref="GI:499778476"
                     /translation="MGWFINLKTSRKLLICFLLMALLILTVGVTGLFNLGKVNANIKK
                     ITQDGIQPILILEDLNKSFAKGAAELAGIVWESQVAEDPAVISDSRRVIAQSIEDGDL
                     LLQQYQMLNLTDEEKGLLGEFKREEAVYRDLREKALTAVELKSYALAGDFNQQAGLQQ
                     AKVEGIIDQMIECSLAYNEELQRASEQDFAKAGMIIMILTAGGFGLALVLSLLLGRMI
                     SRPILAAVEQAELFAQGDFSTDQQRAFLGRKDEIGQLAQAYDEIDSNMSRLLEQVMAA
                     AEDLKTVGAELSVSAEELNAQGQNINAGAEQIAAGMEETAASAQEMLASGEEISNGAG
                     RLAGKAAEGSRIVQDIEKKAQQMRANAEASRGATLSMYQQKQAEILAAIKNGEVVQEI
                     RIMAETIDGIAGQTNLLALNAAIEAARAGEQGRGFAVVAEEVRKLAEQSAQTVAGIHA
                     VISKVTEAFGQLSRNSSDVLSFMEEKVIPDYEMLVEAEGQYARDAHQVGTLVEDFAAT
                     SEQMLAAIGQMSNAIQTVSASVQESTGSSQEIAHNMSRMAGVMEQVARAAQSQAEHAM
                     DLNTMVEKFKI"
     gene            761522..763561
                     /locus_tag="DSY_RS03540"
                     /old_locus_tag="DSY0658"
     CDS             761522..763561
                     /locus_tag="DSY_RS03540"
                     /old_locus_tag="DSY0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005813329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide pyrophosphatase"
                     /protein_id="WP_041272221.1"
                     /db_xref="GI:752602834"
                     /translation="MKRKALTEKIAVIGVDGFEPRLAKKFLDQGKMPNLQKFIDRGSC
                     RDDLVLLGAVPTVTPTLWTTLSTGAYPGTHGITCFFGHNHGQLDSLVYNLDSRRCKAE
                     PLWNIYAEEANKKTLVWHWPGSSWPATSDSPNLHVVDGTQPQTINTGIAGIDISKIVV
                     ASDKFTEVQFLPNTSTITPGAGCIIENVEELMEDDGEVSYLRAAISSGAKVIKNIITC
                     EEENEVNVLAKMIADSVKSPIKEAAGWANAPAGAKEFTIILGKGLERRPVLLLQNEQG
                     VYDTIQVYKAKKDAQPLVTLKAEQSAYDVVDTITNDDGEPVLGNRNYHALTISPDGSQ
                     VTMLIGMAMDVSRDDLFHPKSLYKEVIDNIGYVPNRPVVNGANEILVDKVFIPTWDHY
                     SQWQADCLTYFMKNNKYDIIFSHLHNVDNGGHLFWHFAKHQEMWKNNEEAYKVFIERM
                     YIQTDNYIGRFLPYLDEGWTIIVTADHGLSCQENHGVELGEAGGITTPVMEELGYAKI
                     ITDENGNHEFDWANTKAVASRGNHIYINLIGRDEHGIVDPKDQYDLETQIISDLYQYR
                     DHKTGKRVVALAMRNKDAVLLGLSGPECGDIVYFKEETFNVIHADSLSTQNGYADTSL
                     SPIFVAAGPGIKEGYKTERVIRQVDIAPTMAFLSGVRLPAQSEGSPVHQILTEEI"
     gene            763683..764009
                     /locus_tag="DSY_RS03545"
                     /old_locus_tag="DSY0659"
     CDS             763683..764009
                     /locus_tag="DSY_RS03545"
                     /old_locus_tag="DSY0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005813327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_011459212.1"
                     /db_xref="GI:499778478"
                     /translation="MSLQRLNAKSFEEIVYDQGSPCLVIFSRKTCHVCKEVVPILEEM
                     QPDYEGKFGFYYVDVEDEQALYQRFSLKGVPQILFFKDGEFQGKLVGAVDEEKVSDKI
                     MEVGEG"
     gene            complement(764373..764843)
                     /locus_tag="DSY_RS03550"
     CDS             complement(764373..764843)
                     /locus_tag="DSY_RS03550"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272222.1"
                     /db_xref="GI:752602835"
                     /translation="MEIQTKIENWVSDYENKGTNELRQFRLILSRTIQAIDLKLDSID
                     KTKKIDVRSGRCPHCKSRHTKGYGLKPPRFYCLDCHHAFVKERAPLYYRKRNRLKILD
                     LIVAIHATDKSIPEIISELKISLQTYYKWKSEVIQVFPQLEEKFNLRGKKPGKL"
     gene            765015..765464
                     /locus_tag="DSY_RS03555"
                     /old_locus_tag="DSY0660"
     CDS             765015..765464
                     /locus_tag="DSY_RS03555"
                     /old_locus_tag="DSY0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272223.1"
                     /db_xref="GI:752602836"
                     /translation="MNIFLGSSSSQKAKDDMLKIAMLIEEEGHTPFPWNKEGLFPLGE
                     YPAESLRNICQQVDAAILIFHEDDMTWYRNNYVLKPRDNVVYEYGLFEGHLGPKRTII
                     CRRGTPKLASDLEGITYCDLDKEYRAQSELIKWLRFLGPLDGIQKLM"
     gene            765490..767025
                     /locus_tag="DSY_RS03560"
                     /old_locus_tag="DSY0661"
     CDS             765490..767025
                     /locus_tag="DSY_RS03560"
                     /old_locus_tag="DSY0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459214.1"
                     /db_xref="GI:499778480"
                     /translation="MSKNPNLQSLRSVKELKYVNADNVTRYRAIMRYLYQQYQKLNYW
                     LKPEQIYNGLMAWNLLKTYTLEQCQIDLDQLVEWGNLNSRHDGGRAVTVEEYLRKKSQ
                     YLITPYSIEIERLLGNLETVRGYGGSLEPTLFDTIGNILSIIREKAGLYTAGEALELW
                     NNLFESFQKLHEASVDYIASLQTGTAEELMATDAFLLYKDSITRYLQDFVQALQRRSY
                     KIEGALKQMTDEETQRFFQAVIDDEGRIPKLDEQVSPEQQFDELADKWDGLYRWFVGK
                     GDSGSELMMLERASKDAIMKIVRSVVRIQERKRSGISRRKELDYLGQWFYRLDKLNEA
                     HKLAAYAFGLFSARHLQGEDNRESDSQEQSMWKEVPIPRTLRSRSRKKNERQDTEAVI
                     DRSRQKEAMREAFRLQHRRELEFLIKMVAAEEVRISQLDVISTETRLQILYWIGRCNA
                     SSTSSFQTPEGIEIQLHQPAQGERAILLSEDGRLELLDYRFNFRVVNESAWGDLLIGL
                     EAS"
     gene            767083..768291
                     /locus_tag="DSY_RS03565"
                     /old_locus_tag="DSY0662"
     CDS             767083..768291
                     /locus_tag="DSY_RS03565"
                     /old_locus_tag="DSY0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272812.1"
                     /db_xref="GI:752603425"
                     /translation="MYSARRRRSTVVDQKESTNRIKVCMKALLNRPWIGKESDPQLYY
                     WIKEQSDSIREWFMYHTGYSLIINRKLAKLDKVPVIAFPWMGFQEFREALDYALFTYS
                     LWFLEGKTEGEQFLLTDLVKEIKEYMTEQGMTIDWKNYFQRLSMARALKKLKSLNIVQ
                     AIDGKEADWAMDQEAYNVLYECTAYSRYVLRNFPRDLTSYTTMDEMGEIPDAGDKQEE
                     INRVRRYRLYRRFLLEPVVWDKDWKDDLLYYHGQKNYLIRQFKEMFGWEGSRYREGVL
                     FFEPEAGAEAELFPTLSSLSDLSMLVCGKIRQDVNNPELENLKAELDGSVRVTKSEVE
                     RILIQLKEDHSKYWISDHQKMQSSALAEEVCGHLIEWGFARWAEGGFLILHAAAGRWL
                     AQYGSMELDE"
     gene            768318..772391
                     /locus_tag="DSY_RS03570"
                     /old_locus_tag="DSY0663"
     CDS             768318..772391
                     /locus_tag="DSY_RS03570"
                     /old_locus_tag="DSY0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272813.1"
                     /db_xref="GI:752603426"
                     /translation="MKRAGVLNFWYYDEEEFLFEEGRLILRGTNGSGKSVTMQSFIPL
                     VLDGDKRPERLDPFGSRDRRLEYYLLGEADQGHTDRTGYLWLEFYHPEKELYKSVGIG
                     LRARRGVPQLGFWGFLIDDGRRIGQDFHLYDYPLWLEQGKKVPLNRKNLEEKIASGGQ
                     VVQEQAAYRDLVNKALFGFRESESYKDLLKLLLELRSPKLSKDFKPSSIYEILTNALP
                     PLLEEELGSLSDLLEDMDQITDHLEELQDHLKELQKIEKVYDTYNRFLLKKHSAQVLE
                     LGDKYDHFTNQVSVYETKLAELEKQQQDIQQLLETSKQRLTTVEAELEILNRSEAMEK
                     QRELELLEDQVKGIDKRLIGMKERIESSQQRLIKMGQEIAATEERLKMLTLEQIETLS
                     RLEDSARIMEFREHDIYHGIWLRGIPQEGQWSKPWLQDLDTHRQKLAAAYQTAQEEGE
                     AARAAAEAELKWGEICKERASVEVEQEVQRENLEAIKETMRENLVQWQRNLEQIVING
                     EQLREILQALTEISAKNRFYEPVRRPALQAYEQKKQSFMEQALHWQQQRQSLLDERRS
                     LEKELEEWEQTREPEPRRTEGRSLSRQGRAKGTGAPLFAVCEFASSLDEKGQAQLEET
                     LEQAGLLDAWIFPGGQVTILDQEQGEEIWIEPEYVVQGETLASVLSPTPSQESGLNEE
                     DIRRALNCFGWLSSGKSSSEKRKASSIYLTGEGYYQLGPLAGVNSSKPRAEYIGKETR
                     LRTKQLMIARIEGEIKGLIKEIAEVDENIAALNQQRQVMEKEMATFPHDKDLQAQLDV
                     LLEWSYRLNEIMNQEQKVETWYKQRVGLWRDLQVRLVEQTVEWSGLKKERQLREAVEL
                     CGSYRSDVSELSSLWARYQETSKYMENQKQQHLDLQGMVEEDEEERLELEEQKGKHSI
                     QINQLLKLMAEMDIEEVHRQIKEGKAEKVSLNKAIEELYKEQTEQGKELGRVITELSN
                     NRVSLTDSSKNLDEEIKRWREETQLGLIPQWKEAFAFAVDDRLIRQVCKQIMKELSSL
                     FQNTKEEQINRNLYEEFNKSQANLRDYMLEIDNLDSGRLIITSKRDRLNPLPPSKLLD
                     ELTELENEQRILLTARDRELYEEIIIGSVGKAIRNRIHRARDWTARMDGLMKQRNTSS
                     GLKLSLKWIPLGQKTEKELDTQTLIELLMRDAERMDDEEFEKILTHFRTRILRAKQEA
                     QDEKESLRRYIYQMLDYRAWFEFKLEHRKGEQSNYTELTDSKFNVLSGGEKAMAMYIP
                     LFAAAYSRYSDAAPEAPKIISLDEAFAGVDDANMRDMFQLLTDMGFDYMMTSQVLWGC
                     YDTVPSLAIYEIYRPRDTDVITLFHYRWNGKTRSLIE"
     gene            772441..773862
                     /locus_tag="DSY_RS03575"
                     /old_locus_tag="DSY0664"
     CDS             772441..773862
                     /locus_tag="DSY_RS03575"
                     /old_locus_tag="DSY0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272224.1"
                     /db_xref="GI:752602837"
                     /translation="MELISRKTARQYYGDPLLGNLIDAVFKKYQGQNGVRGNAKICVS
                     SSEEAQRLQDYFGNRLKHLIRPGSEVEVPLKVFAEELQLGYRLSIPDLYEVLKGEMLL
                     TKLEQRQLKEEAWAQIFMQVRMELREKAEIDLDNEVFRAETFDWLKRLEGGEASGYHV
                     LRSAMNKGEDAVDALFCCLKGLWYLLVDKEKIKDKIGKNVKEIRIPIFAVHVTSDKDS
                     HGFDWTKTAGRLLWYALYDIDIQRIKAGKKMASEKLIVPEYMQKRQIYRNFGLKDDDI
                     SSFSHVFAPHFVSGTSPRTLNLREIQSYGKFPMYSALYVFENPAVLSHIIDELIHFLD
                     MNGLSLEQIPKKFPALLCTSGQPRSAALEFITKCLEANPNCLIRYSGDLDLPGVQMMQ
                     GIQGQFTFRFEAFRMDDKTYRNYSDANHLRLSFQDKTVLKRMGDELSKVMVELGVKIY
                     QEEFVKDLAEDVLETIRQEKEIE"
     gene            774249..775028
                     /locus_tag="DSY_RS03580"
                     /old_locus_tag="DSY0665"
     CDS             774249..775028
                     /locus_tag="DSY_RS03580"
                     /old_locus_tag="DSY0665"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272225.1"
                     /db_xref="GI:752602838"
                     /translation="MASKLSLEFLSWLLEQRNNDISGFVMLSGERVPEKFSKIIWPIL
                     DELRVDGVIKGLRKYGQMDKQQCDFSLTPTALDVMHQSISAHGTTHINFYGDIAHSQI
                     ATGNHNSFGAQSNVKTVNHLDYSNLYEKKTIGSIFRFVLFDVIALVANIATIIATYLS
                     LKSENKNVIVAAIQYDWRIYLIFFMIFVFVIMVQITWYLWLNKRWFNLIRQGKTIYKV
                     KSKKCPCCGAKMDYIYRNNAGCFSCSENPRDHSFDVDHTKL"
     gene            775099..775440
                     /locus_tag="DSY_RS03585"
     CDS             775099..775440
                     /locus_tag="DSY_RS03585"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272226.1"
                     /db_xref="GI:752602839"
                     /translation="MGGSNYDGGGGSPTINLGCGGIFEFLLITNDNQETIWQECKAGQ
                     EVYLELVEDELPRLEARRLSDDLILGLVPPSKIMLISCIKDGWEYQGRIEKISGSEYD
                     PKIYIKVRGIR"
     gene            <775872..>776114
                     /locus_tag="DSY_RS03590"
     CDS             <775872..>776114
                     /locus_tag="DSY_RS03590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013720143.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272814.1"
                     /db_xref="GI:752603427"
                     /translation="REWLCSCPGIGMKSASWFLRNIGINDDYAVFDVHVLRFLEKLGV
                     KVPQVVTEKAYIQLEMILREICKKIGVSLGKMDYLLW"
     gene            776159..777436
                     /locus_tag="DSY_RS03595"
                     /old_locus_tag="DSY0667"
     CDS             776159..777436
                     /locus_tag="DSY_RS03595"
                     /old_locus_tag="DSY0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010121307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272227.1"
                     /db_xref="GI:752602840"
                     /translation="MKLAIFGEIGVDWLVDRNGFIQSRWGGAGLYAAVAAARQEAGVE
                     LLTLIGPELNRNIKSIWEFLGVSFNKAQYHEKYSFPRYMVTGFSNYQTKVTRPMSQLK
                     FNHQYYPQISADVQGILIFPIGHTIPIELCREAFERGIPVFLDPKPNQESILDAREAL
                     PYTTFLLVNEQEILLLAETDNRSNAIDKLKDAGPEYIVVKNGIRGCSIFKKGILVEEI
                     PAFRSLVLCSLGSGDVFGGVLATTFLETQDLKFSADLASCVAANFIENFEVETVIPKK
                     AARIDVMQRERISWLSSNLQVYLAGPFFSDQELFWVNQVCDILESAGIRVLSPSRENG
                     VIGQYENWEQRKTIFEQDLVLLENADLVVAILDHDDPGTCFEMGYAYNKKIPIIGLKT
                     SISPLNNMITFGCNKICTSIEQLMSEVYSYGKK"
     gene            777423..>777758
                     /locus_tag="DSY_RS03600"
     CDS             777423..>777758
                     /locus_tag="DSY_RS03600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015591332.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272815.1"
                     /db_xref="GI:752603428"
                     /translation="MGKNKVVLLFSGGIDSTVLLFWLLSRNYEIFPLFINYGQKSYEG
                     ELEAINKILKDLNTKNNLLTLNMPELQLVGSGALVGEYPKNISSHNEWYASEFFPNRN
                     MILLSIAATY"
     gene            complement(778660..779220)
                     /locus_tag="DSY_RS03605"
                     /old_locus_tag="DSY0669"
     CDS             complement(778660..779220)
                     /locus_tag="DSY_RS03605"
                     /old_locus_tag="DSY0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459222.1"
                     /db_xref="GI:499778488"
                     /translation="MFYREDEFEEILPKVELVNFSLGYRLRDFDCGSEDYNVFLSHDA
                     QSYINQNISQVKLLINKQNGDIIGYIAYNADSFLLDPEEKAKEKLDIPFNSVPALKIG
                     KLAVDKNYKDLPYGSFLLWLSLGILEKINESGVGCRFITVDADITERPDTPDFYSKNG
                     FVLNERVNKKSRTQSISMRLDAFLDE"
     gene            complement(779220..779405)
                     /locus_tag="DSY_RS03610"
     CDS             complement(779220..779405)
                     /locus_tag="DSY_RS03610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_018306004.1"
                     /db_xref="GI:517117186"
                     /translation="MDEDKFLPAVKREEIFMASSIASTPILKGQDLVRLVKDINKPDK
                     NKDRRQKALKALMSISK"
     gene            779764..783456
                     /locus_tag="DSY_RS03615"
                     /old_locus_tag="DSY0670"
     CDS             779764..783456
                     /locus_tag="DSY_RS03615"
                     /old_locus_tag="DSY0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459223.1"
                     /db_xref="GI:499778489"
                     /translation="MVKIKMSLLKNLLSGISSIFSGSPYRIIISIENKKFLINVYKGS
                     RAIPFAQLLNKYPELSELSAWVTYQKDRTVIPLGNLAYIKKELSRLTSGEQKNKLEVS
                     IAQKIQRLQPIKMPAGFEICFGWNDLEKALTQKSRGEYWGEGSYVSESEYWSLPGFVE
                     NDDPWLKKNKIQGKEIFEFISHVFPEWKKRGLPVKCEIVLNPEPAFTMKINQIGKDTL
                     TGEILWRITPQRIIEIPDLKGYILADSFLYEGLSPATFSSNIPLQSGEFTLKDEEIAI
                     FQQEILPKIRKWTKGNLEELSKRHRVVENGGELILSVARGEINGIGYGEAVPYFVGGN
                     ERIKAEELSKEIQPGRKYLRLNSGWYPVARLKQLGIGPMGRLTDGTALSNYLKLSATE
                     VLRRGSERFDGPWQRLEFPELKLPVNDTPAKIVAKHLEFLTQWGIPGGFIGTFADYEV
                     ILLEMLTNLLQGTPQIRVLIVGKKALFSDMTEQWHAIVSAKYEGNKKDPELKNNAAGL
                     YMATPNALENHPPLSRAKWDLLMILEADALIKSSTSKLYNNLVSCKARLVLGLFTGTE
                     FFSHQQSFEALSSIFGIQDRATVWKYGVRNPYEEKITLPSAYRLRKRFETGKKTPEGL
                     AEFTLPNDLPNTAVPIPPRTENTIQVSSVKGNLEFALSIETSSLNSYGGYYNGGRFLQ
                     EAKQLVEHVEHRAKFIPFMSYWPTYSSMSMEQQKWYFYWRGQVRKGSYPDTDLSYIFV
                     HVYELINNVGVQNPQDGYQQLFNLWINYRERYPKLDHYLVDWLTDYVAMFGCNVDLLE
                     VYQHLDHKNADPDYLNIILTGYKKSGIGRLSLELINQIADYSIFRSKFYNESGQTLLV
                     EYIPKTIEKVNAFLLEKHHGGILDLFQPSQREKIQREPFRSAVYCYKVSQQITLETVP
                     YIKHKPLREFLTAVIKHTENKLREAKGYNGRLRGYVLEPEIKIWIDDFLASEIEGLEP
                     ATKPSLKIELDTSKVFQLIEDSDKVRDMLIIPGDEAQVEEEKEYQPVKGKNIAGSMER
                     PQGTPLHLLTYLESVHQLLKELGSRQLELLKVLAESLWELGDQKLSGLFPDLLIDSVV
                     DDINEVSLQYLGDLLIAVEGSQKIVADDFRDELEYLLPRLGKAKSLESEPPCQALDLP
                     EEWETFRTNISIFQHQALAAFSQEADLIARINKIAEECLMMPEMLIDSINEVALENIG
                     DIIINLESFPPAINEEYQEWIKKITA"
     gene            783475..784806
                     /locus_tag="DSY_RS03620"
                     /old_locus_tag="DSY0671"
     CDS             783475..784806
                     /locus_tag="DSY_RS03620"
                     /old_locus_tag="DSY0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin carboxylase"
                     /protein_id="WP_041272228.1"
                     /db_xref="GI:752602841"
                     /translation="MSQVKIPKRISTALIQSLSAGVVPRIGLEHIAVGRKEEIESLLG
                     DLENVGAGGASFRFIVGRYGSGKSFLMQTLRNYAMERNYVVADVDLSPERRFTGTKGQ
                     GLATYRELLTNLSIKTRPDGGALTSILEKWIGAIQMEVMKDTGLRPQDNGFGEAVELK
                     IFEAVNHMSGMVHGFDFANAVIAYWNGHRQADESQKAAALRWLRGEFATKTEAKAFLK
                     VQMIIDDESWYDYLKLMAAFVAHIGYRGLIVFIDEGVNLYKISNSVARHSNYEKLLTM
                     FNDTMQGKAQHLGILLGGTPQFVEDQRRGLYSYEALRSRLAESRFGQGGLRDLFGPII
                     RLQTLTHEEIFVLLKRLVEVHGQHYGYESRITDQEMLAFMQEVAGRMGADELLTPREV
                     VRDFMGLLNILLQNPQISFSEVLYGPDFKLKAADQDPEQISQDDEYAEFTL"
     gene            784803..786965
                     /locus_tag="DSY_RS03625"
                     /old_locus_tag="DSY0672"
     CDS             784803..786965
                     /locus_tag="DSY_RS03625"
                     /old_locus_tag="DSY0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_011459225.1"
                     /db_xref="GI:499778491"
                     /translation="MSGNPFYRLAPFIQEYIYKHQWTELRAVQVEACRVIFESESHLL
                     LAAGTASGKTEAAFLPVITLLHESPPLSISALYIGPLKALINDQFARLSDLLEEAHLP
                     VWHWHGDVSPSHKNKMLKNPQGILQITPESLESMLINRSTDILRLFADLRFIVIDEVH
                     AFMGTDRGSQILCQLERLTRMIGHQPRRIGLSATLGDYAIAEKWLSSGTEKRTITPKV
                     QVGQQKVRLAVEHFYLDEEKKMSLYDQYIFDQSKNRKCLIFTNNREQAEYTVATLRQL
                     AEGKRMPDVYHVHHGSISAPLREAAEKAMKESPEPCVTAATITLELGIDLGYLERIIQ
                     LETPFSVSSFVQRLGRSGRRGTPSEMWLVCKEDEEVNDLLPNQLPWSLLQAIAIIQLY
                     LEERWIEPVSPKHYPFSLLYHQTMSTLAAMGELVPAALAQRVLTLSPFKNISSEDFRR
                     LLLYLIEIDHIEQTEERGLLVGLTGEQVVRNFRFYSVFPDNEEFTVRDESKEIGSILS
                     PPPKGERFALAGRTWEVMEIELKRRTVYARPVKGKVRTTWNGGGGSIHSRILQRMKQV
                     LEEDIIYSYLQPGAVKRLCEARNLARAAGILKTNILPLGGNSYCLFPWLGTVAYRTLE
                     RCLRYRGADLYEIRNVGGLSPYFLTFSTKSGTTIEVDSLLKEVIAGTADTEQLMQEDE
                     APQLEKYDEFIPPSLLRKGFRYDYLDLNELRLAFDIKN"
     gene            787152..789719
                     /locus_tag="DSY_RS03630"
                     /old_locus_tag="DSY0673"
     CDS             787152..789719
                     /locus_tag="DSY_RS03630"
                     /old_locus_tag="DSY0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_011459226.1"
                     /db_xref="GI:499778492"
                     /translation="MNIKEMLQNFGGKITYHYIDSSRSGKYMKTPEILDTRLRLYTKF
                     KYPQGLYSHQVMCIISLLNGHHTALCTSTASGKSLGFCYPAMQEILNNSNARALFVYP
                     IKALANDQIAKLKSLATDLALKPDIVRKFDGDVKATDRVEALEKSRILVVTPDVLHTT
                     LLRLNDEPLYSRFFENLSLVILDECHTYSGVFGSNMAYVLSRLRQVCQKKGSNPRFMM
                     SSATVGNPQEHLRQLTGIEDITIIDERFNGSPQFEREFFMVQPTRYLEGYTLDLMGEL
                     IQQNTRFLVFGQSRQQIERLVESFRLKYPKYRSKVEPYRAGFTPTERQQIENSFRKGE
                     LVGLVATSALELGVDLPNLSVCIILGLPSTKSSFWQQSGRIGRSNEGVVIVLRTDSAF
                     DNYFFNNPEKLYNKPFEPLVINQNNEPLMIGHYACARAESGDFENPFLDHRIFGSKFS
                     GLSQRINEFDYTDEILYTKDPHFEINIRSLNDPTYQIVIGRDSQDPPIGTITYSQLMR
                     EAYPQAIFLQRGKRYRVTKISFTNKKVYVDARCPMYSSTRPKGEVRIKERFNGRILQK
                     HWGSGVTIRNTTLGILEKVSGYQIITGKEKEDVEYAQPLMRYFVTQGVIIHLKDISSL
                     SHSAVVGLTTALHNIYPVFYPCAKEDIASYAWAKAGEAGVFLYDNNAGGLGLTAAAFD
                     RFEELIKQAYENVVNCEYCLSHPQDNGCINCVVANRWYTTNVKSDRQAVLRLFEEIID
                     VLRRILPRSNQNGSENLPAKSQLIKEGHFGRTMISDGALVFTGKNQEGVILSSQHFQS
                     VGEEERLYELNVQGRIVKFMGRSLTLVQGNLEYWCTNCGQEGIERSEVVCPLCGSQL"
     gene            789749..792385
                     /locus_tag="DSY_RS03635"
                     /old_locus_tag="DSY0674"
     CDS             789749..792385
                     /locus_tag="DSY_RS03635"
                     /old_locus_tag="DSY0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_011459227.1"
                     /db_xref="GI:499778493"
                     /translation="MEKVFETHQLLEDLGLEVIHTESKEPRAARICQAENLTPIIQET
                     IKEILPLGLYRHQAKSIDSACAGENIVICTGTASGKTFAFAIPALQTLLKDPKARAIF
                     FYPTKALSGDQKSKLEELSSRFGLEDGVYSFDGDTPFNRRKEAIKKGRILLCTPDVLH
                     ATMLRLSNEKDYQEFFAHLTHVILDECHIYSGAFGSNMAYLMRRLRQVCRRLGNEPQF
                     LAASATSKDPKGHLEKLVGVPFQVLGEEEDGSPSGGRNFYIAISPNMPEEQAVIQLIA
                     RLIEDQKRFIVFSHTRKITEQVFMDLINLFPEVEGKVMPYRSGFEHGDRQRIEQALRK
                     GDLFGVISTSALELGVDLSEMEYCILLGIPSTAMSFWQRDGRVGRSPQSQGQVIIIPS
                     TNSVDDYYRHHSEKLLTRELEDLVIHLDNWQLILFHFACARAESGNHEHPNLDPEIFG
                     QDFAQLADKIEELDITDEILIAPEPHLVMGIRGIDDKTYEILSSGGEKRLGTISYSQI
                     LREAYPQAVYRHMGEAYRVEWLNTKHCTIRVKKEERNLATSPIGYIAVKERINNGTTF
                     RRIRWGNALEMLHTTMTVTTVTSGYRERRDGDWINQEKYPSPLQRRVISEGVWLKFGS
                     EFGMIKKNALNALAHAFSNIYSIWFPCDAAEVATHCVVNAKDKSSRLYIFDTTSGGLG
                     ITSGFFDHFLELLDPVRERLEYCDHCDSDPELFDKGCPSCIQIPRWFEDNEHLSKSLA
                     LELLSQIRTVLESNTPNLTVSEAYRGRQEGGLAAVSSLNIVDGEVAVEDLKRGIVILY
                     PGAIIALPSGQQGKILGWRIDHGQVVYETELSNGKTIGLRNTGNNIALIQGEEAILCL
                     DCGYETIDRSDVICPACGAVLR"
     gene            792571..792762
                     /locus_tag="DSY_RS03640"
     CDS             792571..792762
                     /locus_tag="DSY_RS03640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_018305998.1"
                     /db_xref="GI:517117180"
                     /translation="MTNEPEKWSSLEEIAEHLGVSKDTIRNWIKKDVIPHRRIGKQYK
                     FKISEVDAWVDSGKSAEIE"
     gene            792814..793419
                     /locus_tag="DSY_RS03645"
                     /old_locus_tag="DSY0675"
     CDS             792814..793419
                     /locus_tag="DSY_RS03645"
                     /old_locus_tag="DSY0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011459228.1"
                     /db_xref="GI:499778494"
                     /translation="MDVTMPYNGGLTAEQFLFYEMRIVSKQYLEGKTIDEIIDYIKRD
                     NLFQYPTERKISKLARACQRRIVALGNEKLVYELANAPVEVAKQINLYAMMSYNRLVR
                     EFMTDLIGEKYRQHDFSYTKKDINMFFSRLREQNDDIALWSEQTITKLKQVLTKCLIE
                     TEMLDNFRAHELNPVFISTELESGIRENNDLTALPAFNCFR"
     gene            793430..793987
                     /locus_tag="DSY_RS03650"
     CDS             793430..793987
                     /locus_tag="DSY_RS03650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018704562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytoplasmic protein"
                     /protein_id="WP_041272229.1"
                     /db_xref="GI:752602842"
                     /translation="MADIKQELDGIKARISDANFLANKGLSNEVGIHVFKYAPQHELI
                     VRDYIERLVNTPSDEFRIIERDMYKILLEILDEKRVLGTIPELEEKKGKDYLLAQLQK
                     IATQEAFLAKMKYEPHKRGDVLFLTGVGKVYPFMRSHKMLDSMQQAFSDIPIVMFYPG
                     EFNGQSLILFEKFHDGNYYRAFNLL"
     gene            794010..797528
                     /locus_tag="DSY_RS03655"
                     /old_locus_tag="DSY0676"
     CDS             794010..797528
                     /locus_tag="DSY_RS03655"
                     /old_locus_tag="DSY0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011459229.1"
                     /db_xref="GI:499778495"
                     /translation="MKIQNMFQKDINRDINGVIKVAQDDEQSLVQELGEYIITKELRR
                     HFNTFFDNYSKAIDHPTDKIGVWISGFFGSGKSHFLKMLSYLLSNAKVGDRTAVDFFK
                     DKFDDPMMYATVVRCTNIPTESILFNIDIEGPINKDKTAVLRVFAKVFYNHLGFYGED
                     LKIAKLERFVDKQGKTEAFRRAFEEVNSATWLESRSSYAFFEDDIVSVLQSVLGMSEI
                     AARNWFNGEENTDMSIKQLVEEIKSYVDGKGKDFRLLFCVDEVGQYIGDDGDLMINLQ
                     SIVEEVGSKCRGKVWVMVTSQEAIDSVVKISGDDFSKIQGRFNTRLSLSSASVDEVIK
                     KRILEKTEDADRLLRLVYDKEHAVLKNLFTFNNSVMDIKGYADSAEFSSTYPFVPYQF
                     IIIQKVLAEIRKHGNAGKHLSGGERSMLSGFQEAAQKVQGQDENTIVPFAQFYDTVHT
                     FLESPIRRVIDRSQTAADKHDGLEQRDVSVLKLLYLVRYIDDIKANIDNIAILMVDDI
                     RTDKINLRREIASSLERLVAQNYVARHGDTYSFLTDEEQDIAIDIRNTAVDSGTIVAS
                     IGQTIFSEIYPAKKYKYNKYDFPYDQYIDETLVGAATGGVRLRFVTVASDYYNAPEAK
                     LIMDSQANNEAIVLLSSAVQYFEELETAAKIRKYIKQKNVSQLSESIQDIIRKRQAQA
                     RILEESAKKQIEKAIVDGIFFVYGEKVDIKYGEARSKLDEALKQLIESVYSKLNLVNV
                     FRESDADILQVLNGEMEQVGFAGHGANNEFALNEVSQWLEERYISHVPVSMGDVQRRY
                     QAIPYGWREVDIAAIIARLIVSQKIEIRYGGAVVSKDDRNLVGYLRKKSEIDKANVSR
                     RIAPSEELMRKSITFLRNWLGQMGIPEDEDGLINFVKDTLEPKLAHYEKLIDEYNHDR
                     YPQKDVVTTARDLIRDILSQKRDNVALLTRLMARQDDLYDSSEDMEEVETFFKSQRVI
                     FDAARQLERDLQNEGEYFVTDADATEKIKEISSILEMAKPYARIKDLTDLMQGVKTAY
                     GMLLAQKKEEVLGIITQCMGDVHTLAGVKANAEVRKSDDRFVEYKKKVANATSLTVLD
                     AMITQLLNYKDQVCKRIETILHETPAPYGAGGEQPKPQKIAQIRRYDVFPVRRLTSRE
                     DVEQYLDGIRKKLYATLEANDGIQIN"
     gene            797544..801077
                     /locus_tag="DSY_RS03660"
                     /old_locus_tag="DSY0677"
     CDS             797544..801077
                     /locus_tag="DSY_RS03660"
                     /old_locus_tag="DSY0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II deoxyribonuclease"
                     /protein_id="WP_011459230.1"
                     /db_xref="GI:499778496"
                     /translation="MNKNAIQKYAIWARNELIEQVKQRAYQYGISEEGYGDKYATVIA
                     GRVLTAGERSQRQAFVGEIERYGYKQAVEEVAYTWFNRFVALRYMEVNDYLPTHVRVF
                     SDPSGNFKPEILTNVLHLDLPGLDKTKVSELLNGNATEELYRYLLLTQCNALNALLPE
                     MFEPMGAYTEMLLPNNILKPESVIGRLVKDIPEEDFRDAVQIIGWLYQYYNTEPKQAV
                     FDGLKKNIKITKENIPAATQLFTPDWIVRYMVENSLGRIFIGSRIQGLGISLTEAERI
                     AKEKEIANRFGWKYYIPEAEQTPEVRAQLLPNPYSLIPVEDLKILDPCMGSGHILVYA
                     FDVLMQIYTSEGYSERDAAKLILEKNLYGLEIDRRAFQLAYFALMMKARQYNRRIFTL
                     GVRPQVYEPTGYADGMEYGALVRVDKLEEMQKVTMGQLATDDNADTFAVKLNTWNFRR
                     LLAQKYDVVVTNPPYMGASGMGTKLSDFVKANFPDSKSDASTAFMEQTLYLCKPTGYM
                     AMINIPVWMFLSSYEKLRKKLMLQNTITNMLHFGRGIFGSDFGSTGFVIGRKHIVGYV
                     GSYRRLFEKQGAVDSVEQKEKWFFEGMGKFTATADNFAKVPSSPVAYWVSKNMLRAFE
                     TGKLLGSIADSKQGLATADNDRFLRLWFEVATNGVKFDAHNEDEALASGAKWFPYNKG
                     GEFRKWYGNNDYVVNWENNGAEIRDFTDGKGKLRSRPQNTQFYFRECFSWSLVSSGVA
                     AFRYKPSGHIFDVAGMSCFANKELYYLLALCNTKVVMKILEIVAPTINYQCGDIANIP
                     ILIADEAVEQINDKVQQNITVSQKDWDAFETSWNFKRHPLVEFRLAGAYAWGDNEPVR
                     RISFAYKAWEMLADGHFQALKANEEELNRIFINIYGLQDELTPEVEDKDVTVRRADLG
                     REIRSLISYAVGCMFGRYSLDEERLILAGQPYGERFAYASVPVAGGGPLYRVQGDCYL
                     RKSDSTLKVCTYAPDKDNIIPVCDDEYFDDDIAGRFVQFIKTVYGADTLEENLKFIAD
                     ALGGKGTPREVIRNYFLNDFYKDHCKIYRKRPIYWLFDSGKKNGFKALIYMHRYSQDL
                     LAKLRTDYIHEQQERYRTQLAHIAGALNTATGAERARLLKQQDKLSEQARELGVYEEK
                     VHHLADQNIPIDLDDGVKKNYEIFADVLAKI"
     gene            801092..802120
                     /locus_tag="DSY_RS03665"
                     /old_locus_tag="DSY0678"
     CDS             801092..802120
                     /locus_tag="DSY_RS03665"
                     /old_locus_tag="DSY0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_041272230.1"
                     /db_xref="GI:752602843"
                     /translation="MYNKPPYTITEKAADYLAKIVETVTRLEFGTDFKRDIKLHRENR
                     VRTIHSSLAIEGNSLSLGEVTAVLEGKMVAGKQTEIKEVKNAYEAYDKIMTFDPYAIG
                     DFLKAHQLMTEGLVEEAGKFRGGDVGVFDGDVAVHIGARPQFVPQLMEELFGWAKESE
                     LHPLLKSAILHYEIETIHPFADGNGRMGRLWQTLLLAKWNDIFAWIPMESVLYQNRPE
                     YYQAIENARQANDSGVFIEFTLSALYDIIAAQEKHQVRHEDKHQVQLSDTQIEMLKAL
                     KDRALSRKDIFATIGMSGDSRSFKRHIEPLLVVGFIEMTVPDKPNSRLQKYRLTDSGK
                     AFISHNGK"
     gene            802133..804745
                     /locus_tag="DSY_RS03670"
                     /old_locus_tag="DSY0679"
     CDS             802133..804745
                     /locus_tag="DSY_RS03670"
                     /old_locus_tag="DSY0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_011459232.1"
                     /db_xref="GI:499778498"
                     /translation="MLSETIKSRLAERFAAPLTEFHKRRIIFWYDEDGEFAEAVDQLA
                     LDGVTLVKLTGKNNFAVKKLLAEDDLTRDYLVYDPLTYEKDQRDDWLLDIKLHSEEFR
                     ADLISIQMEELLVEPTSAMRKTMKLYAKFLGNKDRKAKLRRIGKSYQTPLGLHIDIMA
                     VLCGLNGGTAQDVIIAVLSAGLDKENNAPLANIEKFGSIEAFWQLVQKYTGYVNGDAR
                     PLSDLAAHILISALSQTISNSALRGLERFITDSCKAYCYQLVHEWQHENHSLTPAPDS
                     LTLIDICRHIEGELRLADRFDKIEISLLLKTDAFPAINESILKRFYGEIGERVIKVDS
                     ILEAVENRRTSGWYNLIGNYLESLYYIAKMQEFYLAHIEGFHFVEPAKIWKLYTIDAY
                     QMDSHYRHFHYYFGNTLKAPNALLEDPLKKCSDVVEGLYHQWFLKELTLNWTNAIADD
                     LDSLGYVSEVNKQRDFYRRYVFPNVSKGNRVFVVISDALRFEVAAELSEVLSHTTKGK
                     ATLEAVQAVFPSITKFGMAALLPGKKLSVSDKMEVSIDGNLTGSTANRGSILSAANPD
                     SVVVTYKDLLQMKKTERRALVHGKEIIYIYHNTIDAFGDKFATETKVFEACDAAISEL
                     NAIVKIIVNDLSGINIFITADHGFLYTHKPLEESQKISRQNFNGEIYEIGRRYALVPP
                     ATSADYLLPVKMEREIGGIPLKGYAPQDTVRIKVQGGGENYVHGGISLQEMVVPVIVY
                     KGMRSGYKQYVEVQNPGLSLISESRKVSNLIFSLDFLQKQPVGEKVQACGYTLHFSDD
                     VGVPVSDTQTVIADRTSSNASERVFRVRFTLKPMQFNKSKIYRLVIANDTDMPEEIEF
                     RIDIAFADDFGFDL"
     gene            804761..806836
                     /locus_tag="DSY_RS03675"
                     /old_locus_tag="DSY0680"
     CDS             804761..806836
                     /locus_tag="DSY_RS03675"
                     /old_locus_tag="DSY0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Lon protease"
                     /protein_id="WP_011459233.1"
                     /db_xref="GI:499778499"
                     /translation="MDLEEASYTSETDDANEVIYRKLREHFDGKIVRKDLTKAIKEGA
                     NVPVYVLEFLLGQYCSSDDPKIIEDGVSNVKRILSENFVRPDEAQKVLSGLRERGSYT
                     VIDRITVSLNIKLDRYEADFSNLGVRNIPISSGYVSKYDRLLCGGIWCIVGLEYEYVE
                     EDKKSTPIRIVKLTPIQMPHIDMDEIKNGRRAFTKDEWITILLRSTGMEADRFSDREK
                     WLQLTRMLPLIENNFNLCELGPRSTGKSHLYKEISPNSILVSGGQTTVANLFYNMSSK
                     QVGLVGLWDCVAFDEVAGITFKDKDGVQIMKDYMASGSFARGKEEKAASASMAFVGNI
                     NQSVDVLLKTSHLFDPFPEVMAYDTAFLDRMHCYIPGWEIPKYRPESFTNDYGFITDY
                     LAEFMREMRKEPFGDVCDKYFRFGSNLNQRDVIAVRKIVSGFAKLLYPNGEFNKENIE
                     EILTFALEMRRRVKEQLKKIGGMEFYDVNFSYIDNESFEERYVSVPEQGGGKIIPEGL
                     TNPGNVYTISQGKSGMIGVYRLETQMLPGNGKFERTGLGTDRDAREATNTAFNFLKAS
                     ASHISGSISTTTKDYIINYQDLNGIGMTKFLTLPTVIALASCALGKPTLSNLAVLGEI
                     SISGTILKVEELASVLQVCLDSGAKKVLIPITSAAELGTVPADLIGAFSLIFYSTPQE
                     AVFKALGVE"
     gene            807454..808764
                     /locus_tag="DSY_RS03680"
                     /old_locus_tag="DSY0681"
     CDS             807454..808764
                     /locus_tag="DSY_RS03680"
                     /old_locus_tag="DSY0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018305987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459234.1"
                     /db_xref="GI:499778500"
                     /translation="MDINVWKTKNSKKRNYAHFDKKVCLRDIWSYINDPQNIKTHGFY
                     PFIHYQLIYKKFNKNNGISPKTRELCYSAHIDRYIFQYYGYKLNQLYNERVVNDGIND
                     SVIAYRDNLKKSNIHFAKKAIDFIRDTKSCFIVVGDFTNFFDNLDHKYLKKMLKELIG
                     GLPEDYYAVFKNITRYSTWDMEHILKLNGLPNNKKGIQELNQKDLALTLSQFKKYKSK
                     YQKPNTKGYGIPQGSAISAVLSNIYMLYFDNMINDYVKKHNGLYMRYSDDFIIILPEN
                     NKSLFVEQYGFLVKTINSVDRLNLQPDKTQVFQYDNNQILSCNEIVSPGVINGKDILD
                     YLGFSFDGNVVSIRDKTSSKYYYRMYRKLKTIEKSKGITKKGNKISNKNLYDKYSIRG
                     AFKEKGNFITYIKRAEEIFGKNESVNRVANNHMKQIRKRLDSIT"
     gene            808893..813695
                     /locus_tag="DSY_RS03685"
                     /old_locus_tag="DSY0682"
     CDS             808893..813695
                     /locus_tag="DSY_RS03685"
                     /old_locus_tag="DSY0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459235.1"
                     /db_xref="GI:499778501"
                     /translation="MKPITFIDTEIESKSKKILDIGSVKGDGSTFHSKSMADFIAFLR
                     GSEYLCGHNILNHDLKYLENTLHAAGLHTVKVIDTLHLSPLLFPNRPYHALLKDDKLQ
                     TEDANNPLNDSIKARDLFFDEVTAFQQADSTLKVIFYMLLKGQKEFSAFFYFIGYQGN
                     SLFLEKLIREKFQRKICAKADLAKFINKYSVELAYCLALLNATDRYSITPPWVLKNYP
                     AAERIMFLLRSNPCLEGCVYCNEALDIHQGLKRFFGFNAYRAYGGEPLQEKAVQAAVA
                     NKSLLAVFPTGGGKSITFQVPALMSGVNTKGLTVVISPLQSLMKDQVDNLERAGITEA
                     VTINGLLNPIERAKSYERVENGSASLLYISPESLRSKTIEGLLLGRNVVRFVIDEAHC
                     FSAWGQDFRVDYLYIGDFIKVLQEKKGLSEGIPVSCFTATAKQKVIEDIRSYFQEKLS
                     LDLEVFSANASRVNLRYEVFEKNEEEKYNALRDLLEGKKCPTIVYMTRTHAAYALAER
                     LSKDGHQAKPYHGKMDKQEKSANQDAFIQGQVQIMVATSAFGMGVDKKDVGMVIHYEI
                     SNSLENYIQEAGRAGRDEDISADCYVLFNDEDLSKHFILLNQTKLSIQEIQQVWKAIK
                     ELTRFRPRVSQSALEIARKAGWDDTVMDIETRVKTAITALEEAGYIRRGQNVPRIFAN
                     SILSRTVIEALEKIEQSRRMDERQRGQAVRIIKKLFSSKSGKHLTDEEAESRVDYISD
                     HLGIPKGEVIEVVNLLREEKVLADHKDLAAYIKKSENRNRSLNVLKTFCQIEKFLLMV
                     IENQEIVFHIKELNEQAEEKGCSEATPGKLRTILNFWTIKNWIRRQTAAHSRNHIAVM
                     ALEEKEILEAKLEQRYELAQFILEYLFAKTNSIPVEEGQKDEVLVEFSVLELKEEYEN
                     RSTLFRSQTSVKEIEDALYYLSKIEAIKIEGGFMITYQGLTIERLEQNNRKNYKTEDY
                     QKLEQFYQNKVQQVHIVGEYARKMIRDYQAALQFVDDYFRLNVSIFLNKYFPGSRQNE
                     IKRNITPAKFKQLFGELSPTQLKIINDRESQHIIVAAGPGSGKTRILVHKLASLLLME
                     DVKHEQLLMVTFSRAASNEFKKRLLNLIGNAANYVEIKTFHSYCFDLLGKVGTLEKSD
                     EIIQETIKRIKNGDVEPGRITKTVLVIDEAQDMDAHEFALINALMDRNEEMRVIAVGD
                     DDQNIYEFRGASSEYMVNLILEKRAKLYELVENYRSKSNLVDFSNQFAERIPLRLKDT
                     PIIAHQSDLGTIKLVRYHSNHLITPLVQDILSEELAGTTCVLTKSNEEALQITGLLVK
                     NGLQAKLIQSNDGFSLYNLLEVRFFLSRLGLAEGIFTISGEVWSGAKRKLKERFARSL
                     NYEICVNLIKEFEDAHPKLKYKSDLEIFIRESKLEDFLGGDSETIFVSTIHKAKGREF
                     DNVFLMLENFSLGTEEAVRQLYVAMTRVKRNLTIHYNGNYLDMITTEGLEQVDNSEDH
                     LPPRLLALQLTFKDIWLDFFRFPQHQWRIGQLTSGDELTFDEEGCRNSTGQLVLNFSQ
                     KFKNQLESIRQRGYIPGKARIRFIVYWLKEGTDQEVRVVLPELFFEKA"
     gene            813776..813997
                     /locus_tag="DSY_RS03690"
     CDS             813776..813997
                     /locus_tag="DSY_RS03690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272231.1"
                     /db_xref="GI:752602844"
                     /translation="MLSYKWDYFAQVFAYASLGLKMGMEIDSVAIYFVRYNQFVTIKL
                     NDPVLLPNFSERYLKVMIEIAKGGNTGVS"
     gene            814060..816723
                     /locus_tag="DSY_RS03695"
                     /old_locus_tag="DSY0683"
     CDS             814060..816723
                     /locus_tag="DSY_RS03695"
                     /old_locus_tag="DSY0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011459236.1"
                     /db_xref="GI:499778502"
                     /translation="MKEEFLSYIGRPDSLNGYSRSYKLVFYKCFFELMDGSGYASAHK
                     VSNQFREYYLKRKHAGKIPDKDVDARIANIETSSIEDIYTIILNNPFKYISERKYILQ
                     RKDADGKDQFYLAPQLVQELSQEELQDIRALVDTKLELYFSGIDEKSTINLHDLFDRI
                     LNEYVHSKSETFANHAMGKLFRQDVVEALYRATIDRDKYLVKGSVGQGNWATVPWVSI
                     LDPRVTTSATYGVYIVYLLSADGKTLYLTLNQGCTDLSNSVGKVEAIRQMRQVAQKVI
                     SSVDCGDFETSNSISLGNDLPSLAQMYEAGCICFKKYEQGRVPSEAVLRQDLSELLNI
                     YQQYVVLQNEEPTPSEPSFWKISHGNTVFTSEEKAFYEQKRLAVVAADTKKKGRSKVS
                     QSDDFMENMKAGDVFYLCYGNSVQYLCRLTSNELVPCPEKGQIWFGRPYEIIAKAIEQ
                     IPYSGKSYWWAPNNNSTCIRVPENDLFPFEQNILKPYFDISIEDLTGQMVVGGEEEMS
                     VKDTIGRIKNYIAAKGFSYNDGLIENFYLSLKAKPFVILAGISGTGKTRLVKLFAEAV
                     GSTSANGRYKLVPVRPDWSDSSDLFGHLDLNGKFVPGTIIDFVKEAEIDSAHPYFLCL
                     DEMNLARVEYYFSDVLSIIETRDFDSSGKIVSDPLVPDTYFGTDADSMGRYGKISLPE
                     NLYIIGTVNMDETTFPFSRKVLDRANTIEFSYVDLLPQLIGEEAENERAQDLPNAFLK
                     TKYLLLSQCVTETEFINELCVELQKINSILQYSNTHVGYRVRDEIIFYMLNNKNDELL
                     NRDDALDNEIMQKILPRIQGSSTSIKNMLCELFKHCAGDYEGYQTEDHNIGSKMYKAA
                     QRADCKYKQSAQKIAFMVRRYEEDGFTSYWL"
     gene            816698..819169
                     /locus_tag="DSY_RS03700"
                     /old_locus_tag="DSY0684"
     CDS             816698..819169
                     /locus_tag="DSY_RS03700"
                     /old_locus_tag="DSY0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459237.1"
                     /db_xref="GI:499778503"
                     /translation="MDSLHTGSNELIYIQTDKVSLIIKGRAAHPNFQEAKYSEKDSTF
                     KVFCHEEYELSLQGCAEPSVLSVNNSIYSGIYTIVPLFYEQQRYELIIEAMDGHTVAF
                     WHDNLNVRNKVTRASRHHEIWSGIINFGNEIGLSDLVIQVDGVNYLRIVIEVFPTKIN
                     YKDDYKSIVEGVTKEVYNIVFDLLKKTYLGYQQSDRVNSSPVEFFAVIRKIYMDFLKA
                     IDMILAQPHHALETTHEVLPNYKINRIDSKTIRWLEKHPEQVVVSNGRILAGRALAVK
                     KQVTYDTKENRLAKYILESTAKKLVSFRKNYLHLQREEDQAVIAQIDDMIRNINRRCN
                     TSFLAKISACEASSNMSLVFSMALGYRDLYKYYLMLLRGLSISGDVFNISIKDLALLY
                     EYWCFIKLNSLMKDRYELISQDIIKVQGNGLFVSLVKGRGSKVKYRNPHTGETIILSY
                     NPKKMDVPTVTQKPDNVLTLEKKGASVQYEYVFDAKYRINPALPGSDYYETISHHPGP
                     EVGDINTMHRYRDAIVYRSGVTPFERTMFGAYVLFPYGNEEEYRHHRFYQSIDKVNIG
                     GLPFLPSATKMVTEMLDELISDSPESAFERAPLPRGIEEKLTRTDWSVRDVLVGTLSN
                     TAQLKTCLQHQFYHIPVSRLDENSLPIRYVAIYQSIRLFGRDAGIRYYGEVTKCIPVK
                     RSEIHEIPKNSEDLYYRLEIKEWKELAKPIRPKEKGFFARLLTNIFLLQHSSELPELS
                     IRSEAEYRLYTELKRLANHTTINDEDNELGFKFNNELIMFENGSIDIYKDGKICSKYA
                     IEDFSRKPNAIFRRIFNDICSNEVN"
     gene            819255..819686
                     /locus_tag="DSY_RS03705"
                     /old_locus_tag="DSY0685"
     CDS             819255..819686
                     /locus_tag="DSY_RS03705"
                     /old_locus_tag="DSY0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005813311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005813311.1"
                     /db_xref="GI:492334330"
                     /translation="MLNKAIKIAVEAHAGQVDKGGEPYILHPLRVMLSPLLTGETERI
                     CAVLHDVVEDSQYTFADLRKAGFSEETVRVLDFLTRREGESYDEFISRVMRNKTACQI
                     RTADLLDNTNLKRIKAPTEEDMLRIKKYEKALWRIHILLSI"
     gene            complement(819734..819952)
                     /locus_tag="DSY_RS03710"
     CDS             complement(819734..819952)
                     /locus_tag="DSY_RS03710"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_035214203.1"
                     /db_xref="GI:737229870"
                     /translation="MSKMKSKSQPKYIGDFKSMVVGRPIPIGRVCKSLNSEYVYRKLL
                     YINGLNNGHKYKVMKASVRYFTSQKAKD"
     gene            820088..821719
                     /locus_tag="DSY_RS03715"
                     /old_locus_tag="DSY0686"
     CDS             820088..821719
                     /locus_tag="DSY_RS03715"
                     /old_locus_tag="DSY0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005813308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005813308.1"
                     /db_xref="GI:492334327"
                     /translation="MINMRFKVVDEIHEITRKDVIYLKYIHYDDYGYCTSFASYYYSN
                     ELIELGYLKIGHKNMSSLIDPGTSQNGYNSYSIKKLIPSGFFEELASTFFSLGENISY
                     YKKINEVFNDASDTFYRSIRDLAYDFQSFQDFYSRREPSLISSLMRSIHYANVEQFNR
                     IVNGEFELTDYNFVFTYQGQKIEINVIPNSLPPSNIHVLIGRNGVGKTWLLYHMVYSI
                     LNNMSLDMSNINSDKYKISEEFQSSIESNTFTGIISVSFSVFDDGFSSINFNESSAQE
                     ISNEELQRKSQRKDDFNKKFKYIGLVDKNQKNGRAKVKSVEDLADEFKVVIDKIKKSS
                     EKKKSYLEMCEQLNTDSMFNDNGFIDLLNRFFLDKEKSEEVIKNFKWLSSGHMIIMLS
                     LTLLCESIFEKTIVLIDEPETHLHPPLLSTYIRTLSYLLRKKNAVAIIATHSPIVVQE
                     VPSNCVTKIERIQRDMCFSRPDIESFASNTDSLTREIFGYEVIKTGFYKLLEEEIEES
                     FEETYKKFDERIGFLGQILIQRLTKKRGDVQDEEN"
     gene            821706..822530
                     /locus_tag="DSY_RS03720"
                     /old_locus_tag="DSY0687"
     CDS             821706..822530
                     /locus_tag="DSY_RS03720"
                     /old_locus_tag="DSY0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005813307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272232.1"
                     /db_xref="GI:752602845"
                     /translation="MKKINRPKIEQSEIFNAFNKLEYKDILEEKSINYERYFEYLMEL
                     HNFENKKIEEDPLYKPYMKKMYSERFSAKNYPGIYKYYLQIRQAAKYCPYCNFPTHQI
                     KQVDHYFPKAVFPSLSLSVNNLVPICRDCNNTKLEYYSLNKSEMLIHPYYDELANNSF
                     EFLRCNILEEEHIGFIFSIVKLEVMDEIMYRRITKHFEKLELDKLYSSDFEADFSVYI
                     EELKELHFECGESSVKAALERKLRAYRKLNIKPWLFAGYTSILNNGWFFDYYIKNL"
     gene            complement(823260..824090)
                     /locus_tag="DSY_RS03725"
                     /old_locus_tag="DSY0688"
     CDS             complement(823260..824090)
                     /locus_tag="DSY_RS03725"
                     /old_locus_tag="DSY0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005812285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_005812285.1"
                     /db_xref="GI:492330288"
                     /translation="MCQTLEVSRSGFYDWDGREPSSRQKEDEEILKVLKKKHTEAQGI
                     IGLDKLWEDVKEAGFQCGRNRVYRLQKANQLYSVRKKPFRIGLTDSNHSLPKAPNLLN
                     QNFQADTPNTVWVTDITQFKVGSQKVYLAAIKDLFHKAIVGWAVANHMRTELCLEALR
                     NALKRHRPAKGLIHHSDGGSQYGSAAYIQELEQHGIIRSMSSKGNCYDNASAETFFST
                     IKSERLHHRKYRDLTEARNDIFWYIESFYNRKRRHQALGHIAPEEFLKRYFQAKQTAA
                     "
     gene            824365..825963
                     /locus_tag="DSY_RS03730"
                     /old_locus_tag="DSY0689"
     CDS             824365..825963
                     /locus_tag="DSY_RS03730"
                     /old_locus_tag="DSY0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011459240.1"
                     /db_xref="GI:499778506"
                     /translation="MFARIKTAYNRDGSPRRYLQIVESRREEGKVRQKVLCNLGRVED
                     LQNGKLDDLIRSLAKFSDKLAVVDAAEDLFADWSKEYGPSMVFNRLWDNLGLHKILDG
                     LFSERELSIDVREAIFCMVLNRLTEPTSKLGVSDWKDSVYRPDFETLKLHHFYKAIDF
                     LDENKDTIEEQLFFHHTNLFTQQLDLVFFDTTSTYVEGDAGAFDLLEYGHSKDHRPDR
                     LQVMIGILMSRDGIPIAHHVFPGNTPDTDAFIEAVSDLKKRFNIQRVIVVGDRGMMGK
                     RTLELLEELQLQYILGVRMRNIKAGPDLANSPEPYAFIKDNLKVKEVVHQEKRYIVCL
                     NEEEAKRDQLVREQIEIKLRSKLEHGSIKDLIGNSEYKKYINVTAEAATINTDKLKQA
                     AVFDGLYILQTNTELPTEEVATAYRDLWQIERAFRNLKSTLDLRPVYHWKERRISGHI
                     MLCFLALVVQIKFQKLLESCGSEYGYTEVIRALRKVHAVKLKIKDQDHLVRTEIHGAA
                     AMAFKAVGLRIPERVQETHYDSHK"
     gene            826095..826361
                     /locus_tag="DSY_RS03735"
     CDS             826095..826361
                     /locus_tag="DSY_RS03735"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272233.1"
                     /db_xref="GI:752602846"
                     /translation="MIKRFGYNKDLFGEGAIFISNKYYIDTYSDSISAFELGKHNPIE
                     IAKISGNKYLSLSPDKSYIIIYNFDIEEPLFGSLRRINIYELLG"
     gene            826453..827697
                     /locus_tag="DSY_RS03740"
                     /old_locus_tag="DSY0690"
     CDS             826453..827697
                     /locus_tag="DSY_RS03740"
                     /old_locus_tag="DSY0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459241.1"
                     /db_xref="GI:499778507"
                     /translation="MKRVFIGFLCLLFGISGCSMTNTIDNSLPNKLHTASSLPKNYEA
                     NSIIWHEDDMLLYHSRDGLYAYQPSKGMTRKLLSEELVEREWLINDWNSGYYGSSPDR
                     SKYILLSSKRKTLEIREINTDNHILSLNSENILEAGWFDNENVFFTTMYSLYIVNIKS
                     GEQVQVTEDSTQIFAEAGKDSTYISWAKNVNKIGDKLYYNGVRSAPDYISSVIYCADR
                     SGEQKQIEKAILLKAVDNQRFIYLKQSKDEYEGTFLYNTLTGESTLIFKGDLRNTGGT
                     FLTNDSKIAFVTPKTDNVPHYGVIFDPVTLQYQRFEIPVQILSNTNKFSCIRNFMGAF
                     KKNGVYIFLFNGEYVSLESNKSGYTNYMYNSKTNSLTEIVGYEGKMGVDMKISPSGEY
                     IAVINYNLFDVIRSDSILNPQT"
     gene            827715..828305
                     /locus_tag="DSY_RS03745"
                     /old_locus_tag="DSY0691"
     CDS             827715..828305
                     /locus_tag="DSY_RS03745"
                     /old_locus_tag="DSY0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019851007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="accessory protein regulator B"
                     /protein_id="WP_005814818.1"
                     /db_xref="GI:492338680"
                     /translation="MFDLERIAHQMTMILLKDSPIEAVEKAKVEYGLALVLGLGIEFI
                     LTVGVSLFLGTAVYTALIMLSSLTLRIFTGGTHCSSFLRCQVFTLVLFIGSSLLIKNI
                     VWSFELNALIMASLTLGIIACILIGKHKRSSLVVWILFAILPVVIILVLKKPHWLIVF
                     ALSSSAGIFLQLLMVSRIGKVIVYKSDQAMQKLGIS"
     gene            829717..834219
                     /locus_tag="DSY_RS03750"
                     /old_locus_tag="DSY0692"
     CDS             829717..834219
                     /locus_tag="DSY_RS03750"
                     /old_locus_tag="DSY0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814813.1"
                     /db_xref="GI:492338673"
                     /translation="MADTVKQLRIFIASPGDCKLEREAVRRICKEDQTILAICRANRI
                     SLDVYGWEEICSNVGRPQSIINAAVEKFDPDWFVFILSHRFGSDAGLGMTGTEEEWNL
                     ARQLNEKGGGHPRVSIFFNQKSVLPHEQDSYQIEALQRFRDTIFKEYQALAGSFDGTK
                     DFEKKFQAYLTEILLNLDREHQDITIDRLKHELLAASNVLLDYQRTLADRQQIERSEF
                     TELLQRIEESEHSTTLVLGSPGSGKSSLLSTLVHHLKEKGISLLSIKADVLGTYINTA
                     DDLRKALNLSLDIRDAVAALAEKEKVVVIFDQLDAIAELLDIKSGRLNVLLNLIHNLS
                     GQKGVHIIASSREFEYRHDVRLNSINADKIALELPVWEKITPVLEQAGHETNSMSDAL
                     KELLRTPLHLKVFLDVAKPGAVFHSLHALLEKLWEQRVLAPYVPQDSHLLLTDLAKRM
                     AEEESLWLPLACADGHPEGRRFLEQNDILVRGQDNLTIGFRHQTYYDYTLTRVFAGGS
                     ISLADYVFQRQDGLFIRPTFLSCLQYLRTASPAEYHRQLKIFFETGLRPHLFSLLLEF
                     LGSQKNPDDMEAYLMLPLLNSDTEGPKVLGAVVGSPGWFNRLYGYEGLDRWMNKVVES
                     ASLCVPLLTSAAGFAGMDVIDLIKKYWFGDTTYDHLTLSVFLEFKDWDSQSVRLAEKL
                     VSRNDLWIVGTFVEKIAEVNPELASRVLLARLDGKLAKVVQEIEAKEEAETEFQEDEQ
                     YSMNFQSKNEPLEKLLENRMDFINFDLMAEGAPEAFLQWIWPWFVDVVSRVSLEEHDF
                     VLEYRSDTATFRGRLEREHEENIETGLLVAIKELAKNNIQAFLQFIHDNASTDLLGVH
                     CLLAQGLEEITASEPQQVLAYLVGDPRRLYLGDYDDFHKYTKRLITDVFPHLNQADRL
                     RLEAAVLAFDHYKRVVPEWDANDRRKRLIWSRQHRLRLLRAFPEEYLSLKTRQIKAEE
                     ERAFPKLTDYDSKILADWIGPRINADEMTKASDDELINLFNQLPDETQWDNPRRRTED
                     SSRGGGAVQQSREFKELAKNTPYRAVGMIPNFEPGRHESYAGAGLEGLAESDLPLADI
                     IRLVEYLDRKGFSSEKFREGAASALEKLAGRENGLPDGILTLLEKWLAEYPEPYWPDQ
                     NECQEKNKEEIKGSILSGRGLFYLPHGRGTILRAILAGYLKRRPSDCNNWARVIRSRL
                     GKEPHPAVWALTMMHMPVLFNGDPEGATQIYDAVIQTCPQVLEKQFTIYSIARVMRRC
                     QPIEILQKWLEKIIRCPSELNHQAYGEMLFLYHYYYQDSWSTDRIIRFLLETDNENVL
                     LGLAYGASHLWSNLKDKTMARDILCCLASHNDKSIQHAVTDVFRHNSDHFQLNEDIKK
                     VILAVCTNNSVLIGAATDLIELLNDYTGIEPEFVSKVCQELIRVGGVDIGNIRTSMAL
                     LAEPLTNITLTLHRHSEYREIGLQMFEELISLNIRETRAALDILDRNPTKPSTTPLWR
                     RRRRKR"
     gene            834831..836222
                     /locus_tag="DSY_RS03755"
                     /old_locus_tag="DSY0693"
     CDS             834831..836222
                     /locus_tag="DSY_RS03755"
                     /old_locus_tag="DSY0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814811.1"
                     /db_xref="GI:492338670"
                     /translation="MGGKEASRGFLYQGFASVLEALTDKSKWDKIFIEFPTSNDKVDI
                     ALEQQNKIVKCIQVKSTINTFSKADIVTWLGDLIKDIESPEYELFLIGQCDKSANTFI
                     KSIEKYYGKMLDKEAISSLNGFGTDLLDNKQIRFCILPFEIGVLEKIVRDSLHQYISY
                     SNQMITFDQISFIASATVNDQMISSTNGKGINRKDFDEELEKRILLVADNYSPERISI
                     GIKSFTRGSDKLEESTKSCLSLIDKFNDRDINDGYDWNQDIYNNLKEFLLENTNNKQA
                     YQLFLDTHSSIAFAAGRILDSKAGINIFPIQKTATNGTILWDVKLSSKKNYPDWDVFH
                     ERLNENQYDSALILNVTRNIYDEVIQYMDEKNLSIGRITSCTPSTNGATNFSIEDGTH
                     ATILANSVYNAVARRSIVERRATLHIFAAAPNAFMFFLGQNSIGFGKCILYEYDFEQR
                     SSCSYSPSINFIN"
     gene            836237..837346
                     /locus_tag="DSY_RS03760"
                     /old_locus_tag="DSY0694"
     CDS             836237..837346
                     /locus_tag="DSY_RS03760"
                     /old_locus_tag="DSY0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814808.1"
                     /db_xref="GI:492338666"
                     /translation="MSTVPSYFKDFLSNIRLTDNQVSDLKTGHTTLRKRLEEDEVLSK
                     IIISTFLQGSYRRSTAVKPKNGNKSDVDVIVVTNLDSEEYTPEEALNLFVPFLDKHYK
                     DKYRIQGRSIGISLSYVDLDIVPTSAPSESETGVLQDKAIISEYTIEDFQQKLLTKSF
                     DNALFESTYNVFCKSDEEPQWKSEPLLIPDREAEKWDKTHPLEQIRWTVEKNKNCNTH
                     YINVVKALKWWRKTQYPEIKQPKSYPLEHFIGDCCPDDIKNVAEGVVLTLENMVAQYP
                     DKPFLADRGVPEHDVFARITNEEYSDFYDTVCDAAKIAREAFDCEELYDSVCKWRELF
                     GNEFPSAPEPSKSNSSTGFTARSEKSTAVPVGRFA"
     gene            837348..839171
                     /locus_tag="DSY_RS03765"
     CDS             837348..839171
                     /locus_tag="DSY_RS03765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ThiF family protein"
                     /protein_id="WP_005814805.1"
                     /db_xref="GI:492338662"
                     /translation="MEVKQTLDKLKQARRALDSLSQVEVIDDWKFDDDLKIWFLHLGI
                     SIGYETSYFPQVSQWYIVAESEYPKGKVKVYPDVKNSIKVTLYHQSNNSKVEKNGLWR
                     KGELCLEVNTISDFHSEPYGVDERLLYHVKRAVNWLELAAKDKLALDNEPFELPEFTL
                     SNVLEVQFAFSEDVVTFMQWESTECRYGIAELDVYKKSKPFVYYVKTFKSMNGNVKHY
                     TQWGNHLSKTIISPPIKAPWILLNRIPVIDEWQAPETFGDLIDACNGQNIDIMGILKN
                     VVSEIRDGKRHLFLLGFPIPKVFGGELEIIFWKALYLPVVSYGIKTVKGFRTNQQGWW
                     LRDKNEVFTRKTKLDWLVSENWNQHEISQRGRMNDLLLRKKVLLVGAGCIGAAIAEML
                     VRAGVYNLTILDSDIFEIGNLSRHTLNLNHIGELKELSLCNYLNSLNPHANIEVISDK
                     LTNNENFEVNIDMDKYPIIIDCTGENRVLDIFQNADFKKNHVLASVSVGLGAKHLYIT
                     LMSGNTFNFDIFYELIFPYVQSEKDLFGEYNLPRNGIGCWHPTFPARSDDVWLAAAIS
                     VKVIENYIVTKSEKTLSLVYEQKESDGIFEGYVVVDKREDG"
     gene            839164..839640
                     /locus_tag="DSY_RS03770"
     CDS             839164..839640
                     /locus_tag="DSY_RS03770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814803.1"
                     /db_xref="GI:492338659"
                     /translation="MDNLFFQDKNQIYKVNLHKEAYNQIIYYCDRANPYEIGSVLIGN
                     YSLNQTTANILQITPPPKDSIQAKYNFHRGSSGLIKVLDTVWNQGQYYLGEWHYHPNM
                     SSFPSSIDKKQMMILSQDKRLKCPEPILIIIGGHKGNWNINVRLFANNKEIILYNL"
     gene            839701..840105
                     /locus_tag="DSY_RS03775"
                     /old_locus_tag="DSY0696"
     CDS             839701..840105
                     /locus_tag="DSY_RS03775"
                     /old_locus_tag="DSY0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814802.1"
                     /db_xref="GI:492338657"
                     /translation="MEYSDFYDTVCDATKIAIVYNSHRLQKDLQQVMVSKIYLAAKGT
                     LEGAASLLSPQGRREKPNSWMESRFRRAKPWSFKMKAVIMTKKVLDLIRKTRKYGFVP
                     KRDNVVVFGDMSCLNCLLHRNTYTALIERSSA"
     gene            complement(840301..840513)
                     /locus_tag="DSY_RS03780"
                     /old_locus_tag="DSY0697"
     CDS             complement(840301..840513)
                     /locus_tag="DSY_RS03780"
                     /old_locus_tag="DSY0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_026184197.1"
                     /db_xref="GI:648492446"
                     /translation="MYQRLRDLREDRDLTQQDLADLLKVSQATYSRYESGALDIPSTS
                     LIKLARFYKTSVDYLLGLTNDRKPSR"
     gene            840619..840825
                     /locus_tag="DSY_RS03785"
     CDS             840619..840825
                     /locus_tag="DSY_RS03785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942923.1"
                     /db_xref="GI:506423204"
                     /translation="MANYSEMYHILFNKITDIIEELQDIQRQTEEMYLQCQKHETIAL
                     QVYNINQSKHVGDTVKNTEKRPLR"
     gene            complement(840965..841180)
                     /locus_tag="DSY_RS03790"
     CDS             complement(840965..841180)
                     /locus_tag="DSY_RS03790"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272234.1"
                     /db_xref="GI:752602847"
                     /translation="MVCFFLPAHGALQLTKHVPKHDNVVAFGDKSDFRVFLIKSKTFL
                     VIITAFILNDHGFALRKHFKQRQGSGA"
     gene            841235..841837
                     /locus_tag="DSY_RS03795"
                     /old_locus_tag="DSY0699"
     CDS             841235..841837
                     /locus_tag="DSY_RS03795"
                     /old_locus_tag="DSY0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018306584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459245.1"
                     /db_xref="GI:499778511"
                     /translation="MNAMPFHPPTDYYCQELAPLDEEICSLLAKRKELSNQNPGFPDP
                     DLIAQWSKTFGLKEYWLSIVFAHLLSEERIHIPVEPVEFLKFIPVLRSVTVDKLSHTV
                     TYLKQYSNASIVYIETEVITSEPFGGHLGHAMFELSIAPEYLCTPNGGGGSGKTMQHS
                     FVVTPPLPDDVSEVEFHFRVKPLPEPEFQRVLLKEIAVTI"
     gene            complement(842039..842278)
                     /locus_tag="DSY_RS03800"
     CDS             complement(842039..842278)
                     /locus_tag="DSY_RS03800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014792511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041272235.1"
                     /db_xref="GI:752602848"
                     /translation="MAISTNKILRLSFSSAGGKTFTLSILNPREDLSQAEILSVMDRM
                     IEEDILMTTSGALTGVKDIKIVNTVVNDLFDPVQP"
     gene            complement(842315..842539)
                     /locus_tag="DSY_RS03805"
     CDS             complement(842315..842539)
                     /locus_tag="DSY_RS03805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005814794.1"
                     /db_xref="GI:492338642"
                     /translation="MAIVSEPLNSALVVVYQDGYTPAGVPVSRQKSISYVRPDASEEA
                     LYEIAQALFSLSLHPVLDVQLKKNFRLKEE"
     gene            complement(842778..843896)
                     /locus_tag="DSY_RS03810"
                     /old_locus_tag="DSY0701"
     CDS             complement(842778..843896)
                     /locus_tag="DSY_RS03810"
                     /old_locus_tag="DSY0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_035214384.1"
                     /db_xref="GI:737230051"
                     /translation="MKVAIIGAGMAGLSCAITLEKHGITPFIFEKRAGVGDRFVNAES
                     MFHILNRPVKNCVPYLREKFGIRLDPLTKVSQIEIHSKHEKGVISGDIGYLNIRGRHE
                     DSYDRQLRDQVSAPIEYHSEQEYETLCKGFDAVVLATGDAEYACRLGNFRADFTGSVR
                     GATVTGSFQADTPHVWFDCDVLPKGYGWVIPYSDQEANVVMFSPDYPSNIKRDHEEMW
                     NQFYGMVSQDLHQPFRITDQFSFKHYIVGICNQPKLENTYFTGNCFGAVSPGFGFGQF
                     TSILTGVYSAYDICGLGDYAELTKPLRANYENSLILRRFLENMTNEDFDFVAKNINMK
                     LISRFVNNLCDSEGRMDLLKDVTPLMKLFNRLQEGKNR"
     gene            complement(843899..845356)
                     /locus_tag="DSY_RS03815"
                     /old_locus_tag="DSY0702"
     CDS             complement(843899..845356)
                     /locus_tag="DSY_RS03815"
                     /old_locus_tag="DSY0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459247.1"
                     /db_xref="GI:499778513"
                     /translation="MTKSAIHPIDIDKISTRLSGISARVVPCTGGDAITVLFIRQLTD
                     RALLSECILKPLIARAAAGKTPPAEELLDRVLYVDHCALDDNPDAIDAYLLDGYTVLL
                     GPWGGRYIVSDIKKIESKSIDSPELQYTLRGARDCFIENLDTNLSLIRYRIKDPRLKI
                     AMLETGKRTRTSVAVVYIEDIANPGIVKDILQRIAKIRIDGIVESGELQKQILNSKWS
                     LFPQTGIVERSDMACGALLEGKVIILVEGSGLGLIAPKVFHEFLISCDDIYDNKYLAL
                     LTKGLRFIALFLSITLGALYIAIISFHHDTLPSEYILTLAAMRANVPFNAFTGIVQLE
                     IIVEIIRESLLRIPKKIGGAIGILGAIIIGQAAMASGMYSPLLLIIVSTELLASFMIP
                     DYTLMNPFRILKVLMILLSAVFGLIGFTLGLCLIVTVIVSSNSFGVAYAAPSAPFNRE
                     DFLGKLFPDKSISPKRPNFLKTTDQTRIESDERKQ"
     gene            complement(845360..846367)
                     /locus_tag="DSY_RS03820"
                     /old_locus_tag="DSY0703"
     CDS             complement(845360..846367)
                     /locus_tag="DSY_RS03820"
                     /old_locus_tag="DSY0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459248.1"
                     /db_xref="GI:499778514"
                     /translation="MIDYQDGEYHFYGEVADLGGQSRKGGAGGQGNLNFSIIKASGET
                     YTQARDDLNRKSSRPVYLGALKVLIFTDRLAFQDVEEYLNRSRTQRNTRKSLKIITSA
                     DEPEDLLKAELDNASSVGLAIDNIQDNLMKEGSSFFVDIGDLLEALAVKKVGFLIPAM
                     GVVDSHITLTGYTVFENGKKVGFIPQDQRRGVVFFLNPHGSFHYEVILNSNRYELDVT
                     LNNKKITTMYADEELMIQIQMGFKAVLNYASTAQPVTIGDREALQRLLEEAVLQDIVQ
                     ALDTSQKEYALDYLGIYRYFRAQHNSTFKTIDWKQAYSDAATEVTTEVTLVRSELPQE
                     P"
     gene            complement(846491..847555)
                     /locus_tag="DSY_RS03825"
                     /old_locus_tag="DSY0704"
     CDS             complement(846491..847555)
                     /locus_tag="DSY_RS03825"
                     /old_locus_tag="DSY0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005814787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore gernimation protein"
                     /protein_id="WP_041272236.1"
                     /db_xref="GI:752602849"
                     /translation="MFFIIIISTVGLSAVVMPKIMSEAAGTGAWLSLLIAAVFFVADV
                     LLIIHLGCLYRGKALAEYSELLVGKAVSRIFCSIYLIYFFIFLAFFVRSAASIIQAEI
                     LYKTPVWATMLLIMSISLYAASKGLTHLGRILEYLGLIVLVTGFILQIIAFTQGNPLN
                     NLPLIDPAEISRYIRAVPSAIFVFLGFEVITVIPLSRRNGSQALLTAGIAVLVACTFF
                     IVQLEGCYSILSIDDIVNYDYPVLTAIRRLDITALQFAKRLDLFFIMGWLTSIFCTTS
                     LLMFASAAYAKKLIPKLTGVTPMLAIGGAAYATGLLIPNAEDVLLVFNRFTTYTGLLP
                     AFVIPFVLWVAHLFRSRGST"
     gene            847942..848850
                     /locus_tag="DSY_RS03830"
                     /old_locus_tag="DSY0705"
     CDS             847942..848850
                     /locus_tag="DSY_RS03830"
                     /old_locus_tag="DSY0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459250.1"
                     /db_xref="GI:499778516"
                     /translation="MIDELTTGRTPVVIASEINTMKRQMEKILLVHAIEIGRRLKEVR
                     AMIPYGEWGDWLKVSVNYSQRTAQRLMALFDAYGEYLSLPPAGESSQNRAMLQGGEGL
                     QTKEGRTLPNLTFVQALTLLELPEEERAEFLMEMDVEGMSTRQLKQAVEQRQEARREA
                     EQAVTERDQARQESTALRDDLDKEKNKNARLAAERDSLKAEIHGLEKVKGELEQEIEN
                     KKASYDKLKERSGYKTIKKMEVSLNEAYGKAEANKIAFLYDSLFKTFKELAYEMTKFA
                     GKNPELHTIYKEKIQDFLHNALREKL"
     gene            849098..849736
                     /locus_tag="DSY_RS03835"
     CDS             849098..849736
                     /locus_tag="DSY_RS03835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942932.1"
                     /db_xref="GI:506423213"
                     /translation="MKVSEPEKIEWQGTILSVQPRTTVWRYRLDNRTHYHRGYNLFID
                     GKAKGMKASFSVAISEIQQKKLMFRIGDEAKGTAWTKMYDVSDYADYYRAGGLKITRK
                     AEHAETSPPPYLIEPPDLATYAQRGARMLSAASYRGKCFQCAWATMSAVEIEYNWGVS
                     KKYRFESFCYGPKSCKLYKMGKPRAVPYKGDGSTYDEGWMDDLCTENRGWDD"
     gene            complement(849744..851057)
                     /locus_tag="DSY_RS03840"
                     /old_locus_tag="DSY0707"
     CDS             complement(849744..851057)
                     /locus_tag="DSY_RS03840"
                     /old_locus_tag="DSY0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_041272237.1"
                     /db_xref="GI:752602850"
                     /translation="MKDKEVYKNLLIALDQMKSDAAEYLDKKLWKEITLPQTYEELLL
                     ALSKDELQDISRHYGFRNISSLKKKDLVHYLVQQLPCRITQELKLMDEHRYLFLKQFV
                     SEDNKVFQAVLADNYDHKLVNYWRKTGLVLSGSSQGQKVLFMPSELQDVFQTLEHDAA
                     LQSKLKQNTEWLGLTYGMLYYYGAMGHMTILSKLEELTGVRPDYQEFHTILLRGGEYY
                     DAPRRDSYGYWAHQNVPDVDALLKEQRARAGVDYYRFSKSKLLKAGAPDYFDDTPAFQ
                     RLHDYFSTHYQMTEKEAKDLAAECQHIVNQINEPSAIFDLLKTTIEFPNVESVQHLAD
                     VVMFFWNNTRQWALKGHSPAELGTGANPGLSSQPKNLHIPFDTDLPFATPAVRPAPSG
                     QTLGSSHSKSSNPTVIDLKTRQKIGRNDPCPCGSGKKFKHCCGGL"
     gene            851397..852839
                     /locus_tag="DSY_RS03845"
                     /old_locus_tag="DSY0708"
     CDS             851397..852839
                     /locus_tag="DSY_RS03845"
                     /old_locus_tag="DSY0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459253.1"
                     /db_xref="GI:499778519"
                     /translation="MKLFEILPESFFQLFTGKNRQVYAEALLLLYEQYQVNRFGVDYE
                     VMRDLLQELIETQESLGYSFEVEEGEEAPEADLFRTQVNSILRRLKVLGWLDVETRDN
                     FKQYILLPHYSSRILQVFKELCEERTVEFQRFAFVTYQLLTSEEAKRRPAFAMIEAEK
                     TTEQFTGELTLLANNMKFHAEQVAAKTSIQEVLDHHFDEYKTKIVDKSYHRLKTSDHV
                     SRYRHQILERVRTLLIDQEIFQEAVEDGIRSEFFATREEAEHKLRQALLSVEEVYREL
                     DEVFNRIDLRHNQYLRASFDRARYLSQHSQGVDQRLAEILDWLSERRSSSKDIGAKIL
                     GPEGLRFLTLSQLSEPSVFTPRKKRLPHQAEDIEVIQLSPELKAQLREESLSKMRRNI
                     TREKVRDYVLAHLGQRETMGIAELAPQNLEEFLYLTYVYLYGYDGGAGYTLEREYNRV
                     LEIGGYRFHDRQIRRLTAKKEGSHRVRATQ"
     gene            852820..853428
                     /locus_tag="DSY_RS03850"
     CDS             852820..853428
                     /locus_tag="DSY_RS03850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015942934.1"
                     /db_xref="GI:506423215"
                     /translation="MFEQLSEQDREKLRDLINRLLNVNFLVKELEREHYQNARKLRPY
                     LDEFFKFLNWDFQLDERHECIYVFSKEGAHRLRLSQEESIALLVLRLIYQEKRQGVLL
                     TAFPLTTKYEIRAKYETFRLPFPGKTRFLETIKLFTQYKLLQSLDDEVNLDECRFRLF
                     HTLLYALDADSIERIHERIRAYDLEIDEEELLYEMDETASAR"
     gene            853397..856876
                     /locus_tag="DSY_RS03855"
                     /old_locus_tag="DSY0710"
     CDS             853397..856876
                     /locus_tag="DSY_RS03855"
                     /old_locus_tag="DSY0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011459255.1"
                     /db_xref="GI:499778521"
                     /translation="MKWMKRLRLVNWHYFQDESLEFGRQTLISGRNSAGKSTIIDALQ
                     VLFIADQRQIRFNPAAHEEAKRSLLNYLRGKIGSDEKSFVRERDFTSYILGEFYDDKT
                     RKSFAIGAVMDVYSDNKIDDEFFIIPDLELAELEIQKGKRTYRNKEEFHRYALGIRPK
                     TQFFRGRQEYQKAFLNRMGQLERRFYRTFLRALSFKPIQDIREFVYQYILDERELQLN
                     IMKENFELHERYQRELKDLEERKTVLEKIARQHEQAIKYRDIAATQEYVIRGLKHLEI
                     TEKREDLEQAIASSQNELKSVKERAALTEEQHREAREQALEYYRQWSNHQLQKEKESL
                     EARIEDMQKTLADQKRRLEIWVAKVKGEIRLLEGLATAFAVDGEVWRQEDRRKLENVL
                     GALRTALDLAGRPNLEWAQEDQDVLGEEIRQSGLFLAALQMGFLQTQTRLEDRIREQE
                     AQQERLNQEIRGLEQKKRPYREEVLRLKALLEERLAGRSPVWIFCEEMEVLDEAEAWR
                     NAIEGYLHTQRFDLLVKPQAFSEALRIYEQEKWIHRLQGVGLVDTEKEERYLGKRESG
                     SLAALLQTDNPIIQARIDHLLGRVMQAADEQDLRRHHTAVTRTCMSYTNLVARQIQKE
                     RYEIPYIGSQAIVRQLEIKRRELRTVQDNLRQLQAELIIMKEWVSSLADRKTLYEGLA
                     QGLELPKMVEQQEYELLEVQIKLEELDLSEVERLKQEYEEWHRREGQLVEAMKELSGK
                     ITGLDLEIGRKQTDLYLLTRREQEAQELWDGWKAEYAPELWEKAAERWQEAQRQTQPA
                     STKLVNWEGSQKGNVTRKLQEFGRLRDLRQDYNIRYTYNGSLDGEDNASYQSLLDEVA
                     GVDIPDYQVKLAEALKQSEEEFKSDFVAKLREAIEMARHEFSQLNLALKNFPFHQDKY
                     HFEVRPSSHYKRFYDVIMDPDIVNRGSLFDSLADDKADTLHELFERLVRGEAGDQEEF
                     TDYRRYLDFDIAVTTETGRYYFSQVLKEKSGGETQTPFYIAVLASFYYLYNSGKTLRL
                     VVFDEAFNKMDEERIQTSLRLIKKMGLQLIAAVPDEKMQHMAPEVSTTLIVHRDGHHC
                     FIDMISREEMLDSLNGDEENAQDSQDDGVEGKGADTETDAGQEAESGVSADPAWMQIR
                     MQAQMQNQIQRQT"
     gene            856993..858246
                     /locus_tag="DSY_RS03860"
                     /old_locus_tag="DSY0711"
     CDS             856993..858246
                     /locus_tag="DSY_RS03860"
                     /old_locus_tag="DSY0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459256.1"
                     /db_xref="GI:499778522"
                     /translation="MEDKEVREYKKKILTLLLRKYQNSLSFQTGTPGKQRPQLTMAKS
                     ELAADYEDELDFRKREWIHAALKELSREGIIQVTWPKLKEHIQVHKVYLNFAGVERAY
                     QLLGETPLEDKLRRLKESLSPLAAHPWVWVRSWQRETCARLEERKSAGLDADNPQGYD
                     DLVKVLKALPELEDSTPKRVFSQSLFQDSKYFEKKLEGRLISLLRKIYPEELDQDEDY
                     LDQVGIVNNPKLTLLAGPLIIHPDRDLSHFSGGLGLSAQSVKELIIQDIPAQTILLIE
                     NLTTYHEVLQAPPILPAPVLAIYTGGFPHKSAQKLLEKVSGFLENRRQGQGLEIFHWG
                     DIDYGGIRIFEYLRRNFFPNLKPYRMDGVTYLEYESAGLPFGEDQAKKLAALLSDPGY
                     SDWHEVIGLLLSYRKRVEQEGIRVG"
     gene            858286..859944
                     /locus_tag="DSY_RS03865"
                     /old_locus_tag="DSY0712"
     CDS             858286..859944
                     /locus_tag="DSY_RS03865"
                     /old_locus_tag="DSY0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459257.1"
                     /db_xref="GI:499778523"
                     /translation="MNYHEFMEAVDKKLALMSEAEKSGWIHNMARTRSEHERAAFLNS
                     LMGKQEHFPVISEREWIEAWCRKIDNQEIYFECSYEEYGGDYWGSDDVYEYTDIFEIG
                     KDLLRAFKIAEGLLFQKDYSRAAALYDRLCRLSFPTLEDETEEWSELSLEELVSEGLV
                     SLNLKQIALNLLYARYQAAEGRERSAALYTYLAWDMCKNISIEELFTAGPEELKGLDV
                     FMEEWLDFLKDIPGDRAGDLLIEACLCRGGIVRLCDVAKEVCTRHPILYKYACDYLLN
                     GNKALECERVGLEALGMLPEQLIVRGKIAAITAKAAEQLEHPDILRQCWEAAFYSEPT
                     LNHYLQLFELPDHRNIADRAANYAKTLPERPSTAEGYNNRQMLVNHLSREHKAVIRFF
                     NREFAAIYEECKKNKTALGWSSDFKGLAVPLFVLLLSKNKEITKAGEKLINGIDYRLG
                     FEEEEGADFRELFLRWKEKAILTDEEYERYIEWLKKEVDIRTEAVVGGGHRKSYYKAA
                     ALVAFLGETLESNGMANGRRILIEHYTKMHPRKRAFKGEFEMLK"
     gene            860394..862481
                     /locus_tag="DSY_RS03870"
                     /old_locus_tag="DSY0713"
     CDS             860394..862481
                     /locus_tag="DSY_RS03870"
                     /old_locus_tag="DSY0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_015942936.1"
                     /db_xref="GI:506423217"
                     /translation="MQAQALSLLRKMIGRDAEFHQGQWEAIESVLRGKKTLLVQRTGW
                     GKSVVYFIGAKLLRERGLGPTIIVSPLLSLMRNQIENAVKIGISAETINSDNTDEWTE
                     IEEKLKRKAVDILLLSPERLGNKDFTERVLPSIEGGIGMLVVDEAHCISDWGHDFRPD
                     YRRIVRIIKQLPPNVPLIATTATANQRVVDDIKAQLGDELNSIRGPLTRESLQLQVIK
                     LADQAERLAWLHENINKMEGSGIIYCLTVADCNKVAKWLRGKGINALEYHADLSKDAK
                     EKRKLREERERKLLNNEVKALVATVALGMGFDKPDLGFVIHYQRPGSIVRYYQEIGRA
                     GRALDKAYAILLNGAEDDEIEEYFIQSAFPTPKEMNAVVNAIEKASLGMTKNKILKEL
                     NMSYGRVEKCLKTLEIEGIIYKEKSSYFRSPVSWLPDSTKSSAITKLRINELEDMRKF
                     VDTEDCYMRYISAKLDDPYLKNCGKCRNCLDTQFFSEVVSRDNVLEAIQFLKGEYLDI
                     EPRKQWPAGIKAEATKKIPEEEQNFTGKALCSYGDAGWGRVVAEDKYRNEYFSDELVD
                     ASLALLKNTLLKEDLGWVTSVPSLRRPLLVKDFAMRLAEKIGLPYIDAIRKTEDTPYQ
                     KKMENSYQQCSNALHGFSVIERVPESPVLLVDDIIDSGWTLTVCGILLRGERSGPVYP
                     FALAKASGLEGGE"
     gene            862481..863722
                     /locus_tag="DSY_RS03875"
                     /old_locus_tag="DSY0714"
     CDS             862481..863722
                     /locus_tag="DSY_RS03875"
                     /old_locus_tag="DSY0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA protecting protein DprA"
                     /protein_id="WP_015942937.1"
                     /db_xref="GI:506423218"
                     /translation="MNNMLSQDSLAMVLLCTTVGLSKDNTEIRPLTIKQWNQFLRRMF
                     NAEIKNPAALFEVGKEDLKKRLGLSDEESQRIQFLLSRAGQAVVELENLNNMGIFVTT
                     RAEKSYPQRLKSVLKKDSPPVLFYSGDIELTQMEGIGIVGSRNIDPKGLEFTKELGSK
                     SAKQGLTVISGGAKGVDEVAQNEALRQGGKVISILADSLAQKIKHKEAREAIMEQRLL
                     LLTSFHPRAPFTVYNAMQRNKYIYALSHIAVVVSSDYSKGGTWAGATENLRNKWVPLF
                     VRKDDIVPEGNEKLLKMGANPLSAKDLFSESFNANRLSSLADQYYEQGSLFSVSNLLE
                     KETDYQVSNDSGESDHEERIDLFPVIWPYLESALQKARTKEELCTMLHIHGNQMKIWL
                     ERALAEQKIKKTRKPAGYIVQ"
     gene            complement(863956..864705)
                     /locus_tag="DSY_RS03880"
                     /old_locus_tag="DSY0715"
     CDS             complement(863956..864705)
                     /locus_tag="DSY_RS03880"
                     /old_locus_tag="DSY0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-binding protein"
                     /protein_id="WP_011459260.1"
                     /db_xref="GI:499778526"
                     /translation="MIRKIIKIDEQSCDGCGLCITACHEGALVLVNGKASLLRDDYCD
                     GLGNCLPACPQDAISFEEREAVEFDEEAVKKHLEGHHQHDDNEHHEHQGHTLACGCPG
                     NHAELLSRPESTYKPETQQENKSQLKQWPVQIKLAPPNAPYFDNANLLIAADCTAYAY
                     GNFHNEFMRNRVTLIGCPKLDSVDYSEKLTAILQQNSLKSLTLVRMEVPCCGGLESAV
                     KTALKNSGQVIPWQVVTITTNGRILENQIHN"
     gene            864939..865556
                     /locus_tag="DSY_RS03885"
                     /old_locus_tag="DSY0716"
     CDS             864939..865556
                     /locus_tag="DSY_RS03885"
                     /old_locus_tag="DSY0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015942939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459261.1"
                     /db_xref="GI:499778527"
                     /translation="MGLLREIFGPSQHEVWEALCQEIGADFIDGGFFKGTKVVAEIKE
                     WVITLDTYTVSTGKTSTTYTRMRAPYLNKDGFKFRIYRKGIFSNIGKLLGLQDIEVGY
                     PEFDDQFIIKGNDSDKLISLFSNSRIRKLIEIQPDISLEVKDDEGWFGSEFPEGVDEL
                     YFQVPGIIKDMDRLKTLYFLFAEVLNQLCLIDSAYEDSPDATAQL"
     gene            865605..866186
                     /locus_tag="DSY_RS03890"
                     /old_locus_tag="DSY0717"
     CDS             865605..866186
                     /locus_tag="DSY_RS03890"
                     /old_locus_tag="DSY0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459262.1"
                     /db_xref="GI:499778528"
                     /translation="MRLWTIQDKAAYDDLCEKGVLHCDAALAGWLKDDLFRKSYDWLV
                     GEMKGRVGEPPQGVEYPVWAWYLLLGKNVKPDLRRVEFRNYVGEHYVIEAEIPDEKIL
                     LSDEEYWHLVLNDSYFSDAPEDDDEAEELADKWFAGLPAQEQEQVKRESWKKVFDKAC
                     CPWTFVQATFWELRKEQIVSVRKFYGKAKPIEL"
     gene            866302..871197
                     /locus_tag="DSY_RS03895"
                     /old_locus_tag="DSY0718"
     CDS             866302..871197
                     /locus_tag="DSY_RS03895"
                     /old_locus_tag="DSY0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011459263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011459263.1"
                     /db_xref="GI:499778529"
                     /translation="MTKIRRILSKTERYLKVTNTAGLTEKGGKNVKPITFIDTEIEPR
                     SKKILDIGGIKGDGSTFHSASVPDFTAFLRGSEYLGGHNIFHHDLKYLDNTLQAAGLH
                     TAKVIDTLWLSPLLFPARPYHALLKDDKLQTEEANNPLNDAIKARDLFFDEVTAFQQA
                     DPLLKVIFHSLLKGQKEFSAFFHYMGYQGSSLFPEKLIRDKFQGRICAQADLTGLIAH
                     YPVELAYCLALLNTNDRYAITPPWVLKHYPSTERIMYLLRNNPCLEGCVYCHEALDIH
                     KGLKRFFGFDSYRTYGGEPLQEKAVQAAVDNKSLLAVFPTGGGKSITFQIPALISGAA
                     AKGLTVVISPLQSLMKDQVDNLERAGITEAVTINGLLDPIERAKSYERVENGSASLLY
                     ISPESLRSKTIESLLLNRNVVRFVIDEAHCFSAWGQDFRVDYLYIGEFIRSLQEKKNL
                     SEGIPVSCFTATAKPKVIEDIRGYFKEKLDLDLELFSANASRVNLRYEVFAKSEDEKY
                     NALRDLLEGKPCPTIVYVTRTHTAENLAQRLNQDGYQAGAYHGKMDKQEKSTNQDAFI
                     QGQVRIMVATSAFGMGVDKKDVGMVIHYEISNSLENYIQEAGRAGRDETLSADCYVLF
                     NDEDLGKHFVLLNQTKLSIQEIQQVWKAIKELTRFRPRVSQSALEIARKAGWDDGIMD
                     IETRVRTAVTALEEAGYIKRGQNVPRIFANSILSRNVMEAIGKIESSPRMNEKQKGQA
                     QRIIKKLFSSKSRKQLPGEEAESRVDYISDHLGIPKEEVIAAVNLLREEKILADHQDL
                     AAFLKKTEHRNRSLNILKTFYQLEKFLLTVIENQERIFHIKELNEQAQEMGCPEATPN
                     KLRTLLNVWTIQNWIKRQTTGSSRNHLSLLALEEKEVLEAKLLKRYELAQFILDHLFA
                     KSSTALTGEEARKEEVLVEFSVLELKEAFAERFTLFRSQTSVKEIEDALFYLSRIEAV
                     KIEGGFMITYQGLTIERLEQNNRKNYKAEDYRQLEQFYENKVQQVHIVGEYARKMIRD
                     YQAALQFVDDYFRMNFSLFLNKYFKGSRQNEIKRTITPAKFQQLFGELSPTQLDIIND
                     RTSRHIVVAAGPGSGKTRILVHKLAALLLMEDVKTEQLLMVTFSRAAAHEFKKRLLKL
                     IGNTAHYVEIKTFHSYCFDLLGKVGTVEKSAEIIQEAIKRIKNREVEPGRITKTVLVI
                     DEA