GenomeNet

Database: RefSeq
Entry: NC_008576
LinkDB: NC_008576
Original site: NC_008576 
LOCUS       NC_008576            4719581 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Magnetococcus marinus MC-1 chromosome, complete genome.
ACCESSION   NC_008576
VERSION     NC_008576.1  GI:117923318
DBLINK      Project: 57833
            BioProject: PRJNA57833
KEYWORDS    RefSeq.
SOURCE      Magnetococcus marinus MC-1
  ORGANISM  Magnetococcus marinus MC-1
            Bacteria; Proteobacteria; Alphaproteobacteria; Magnetococcales;
            Magnetococcaceae; Magnetococcus.
REFERENCE   1  (bases 1 to 4719581)
  AUTHORS   Bazylinski,D.A., Williams,T.J., Lefevre,C.T., Berg,R.J.,
            Zhang,C.L., Bowser,S.S., Dean,A.J. and Beveridge,T.J.
  TITLE     Magnetococcus marinus gen. nov., sp. nov., a marine, magnetotactic
            bacterium that represents a novel lineage (Magnetococcaceae fam.
            nov.; Magnetococcales ord. nov.) at the base of the
            Alphaproteobacteria
  JOURNAL   Int. J. Syst. Evol. Microbiol. (2012) In press
   PUBMED   22581902
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 4719581)
  AUTHORS   Schubbe,S., Williams,T.J., Xie,G., Kiss,H.E., Brettin,T.S.,
            Martinez,D., Ross,C.A., Schuler,D., Cox,B.L., Nealson,K.H. and
            Bazylinski,D.A.
  TITLE     Complete genome sequence of the chemolithoautotrophic marine
            magnetotactic coccus strain MC-1
  JOURNAL   Appl. Environ. Microbiol. 75 (14), 4835-4852 (2009)
   PUBMED   19465526
REFERENCE   3  (bases 1 to 4719581)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Kiss,H., Goodwin,L.A., Brettin,T., Bruce,D., Han,C., Tapia,R.,
            Gilna,P., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Mikhailova,N. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Magnetococcus sp. MC-1
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 4719581)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2006) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 4719581)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Kiss,H., Goodwin,L.A., Brettin,T., Bruce,D., Han,C., Tapia,R.,
            Gilna,P., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Mikhailova,N. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (20-SEP-2006) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000471.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 2351493
            Source DNA and bacteria available from Dennis Bazylinski
            (dbazylin@iastate.edu)
            Contacts: Dennis Bazylinski (dbazylin@iastate.edu)
                      Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4719581
                     /organism="Magnetococcus marinus MC-1"
                     /mol_type="genomic DNA"
                     /strain="MC-1"
                     /db_xref="taxon:156889"
     gene            181..1524
                     /locus_tag="Mmc1_0001"
                     /db_xref="GeneID:4480628"
     CDS             181..1524
                     /locus_tag="Mmc1_0001"
                     /note="KEGG: pca:Pcar_0001 chromosomal replication
                     initiator protein DnaA;
                     TIGRFAM: chromosomal replication initiator protein DnaA;
                     PFAM: Chromosomal replication initiator, DnaA C-terminal
                     domain; Chromosomal replication initiator, DnaA;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_863936.1"
                     /db_xref="GI:117923319"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="GeneID:4480628"
                     /translation="MQDFWSKAMDAVAEQVSVQVFEAWIRPLKAGGEVGDGQFQVYAA
                     NDFSADWVKKRYGGLLEEILSEQLGEPVTLLFAADPALEKPVASKTQTVTPVQSGGET
                     GDQENFHSGLDPRYTFDSFVVGGCNQFVHAAAARVAEAPAAAYNPLFIHGGVGLGKTH
                     VMQAIGNRVLEIDPDKRVLYISSENFMTQLINSLRFKRVFDFKENFRSVDVLLVDDIQ
                     FIAGKKATQEEFFHTFNALYEAKKQIVMTADSFPHEIEHLEERLRSRFGMGLVADMQP
                     PDLETRVAILQKKAGSEGLRLADEVAFFLADAVQTNVRELEGALIRVSAYASLTGKPI
                     TMALVKESLKDIVRGQDRAVTVEQIQKTVANYYKVKVTDLCSNSRSRIYSHPRQIAMY
                     LCKQLTQHSYPEIGHRFGGRDHTTVLYAVSQVDKKQGSTPALADELASLKSMLQK"
     misc_feature    181..1521
                     /locus_tag="Mmc1_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    184..378
                     /locus_tag="Mmc1_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    613..990
                     /locus_tag="Mmc1_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    634..657
                     /locus_tag="Mmc1_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(637..660,823..825,922..924)
                     /locus_tag="Mmc1_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    811..828
                     /locus_tag="Mmc1_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    961..963
                     /locus_tag="Mmc1_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1246..1515
                     /locus_tag="Mmc1_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1315..1317,1339..1344,1363..1365,1381..1389,
                     1414..1428,1435..1437,1444..1449)
                     /locus_tag="Mmc1_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1570..2700
                     /locus_tag="Mmc1_0002"
                     /db_xref="GeneID:4480629"
     CDS             1570..2700
                     /locus_tag="Mmc1_0002"
                     /EC_number="2.7.7.7"
                     /note="KEGG: gsu:GSU0001 DNA polymerase III beta subunit;
                     TIGRFAM: DNA polymerase III subunit beta;
                     PFAM: DNA polymerase III beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_863937.1"
                     /db_xref="GI:117923320"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:4480629"
                     /translation="MEFHVSREPFLKALQRLQSVVEKRNTMPELGNALLEASAEGLTL
                     TATDLEVSMKSHCPAEVESSGAIAVSARKLFEIVRELPQDSLRLRSEAGERLVLTCGR
                     ARFTLVGIRADIFPPFPETTQGQSFTLSGPRLAEMIAKTHFAMSQDETRYTLNGILLH
                     LVSAADAELAGENGLVRIVATDTHRLAMAEMALDIPVEESAELIIPRKGVQEIRKLVE
                     EDDEAVELGLDENFIRVSKPGIVLTSKLVSGRFPNYQRVIPTDNPHLLELEKEPLFGV
                     VKRMMVLSHEKSRGIRMALSSDHIKVSAQNPEQEAAEEEMPCSFAGKDMTVGFNARYL
                     QEIVSVANGDTVRMKLRDEESPVLVEEHSATGYLYVLMPMRV"
     misc_feature    1570..2697
                     /locus_tag="Mmc1_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1570..2694
                     /locus_tag="Mmc1_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1639..1641,1783..1785,1804..1806,2191..2193)
                     /locus_tag="Mmc1_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1786..1788,1795..1797,1873..1875,1879..1881,
                     2413..2415,2506..2511)
                     /locus_tag="Mmc1_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2110..2112,2116..2127,2557..2559,2683..2694)
                     /locus_tag="Mmc1_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2110..2112,2116..2121,2338..2340,2443..2445,
                     2482..2487,2566..2568,2683..2694)
                     /locus_tag="Mmc1_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2711..3859
                     /locus_tag="Mmc1_0003"
                     /db_xref="GeneID:4480630"
     CDS             2711..3859
                     /locus_tag="Mmc1_0003"
                     /note="TIGRFAM: DNA replication and repair protein RecF;
                     PFAM: SMC domain protein;
                     KEGG: gsu:GSU0002 RecF protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_863938.1"
                     /db_xref="GI:117923321"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="GeneID:4480630"
                     /translation="MQLDRLTLRDFRNITEAELRFGPGLNLITGPNGHGKSNLLEAIG
                     LLATGRSFRRAPAAALRRYGQPWFHLRGETTARDLGHRLEFFGQAGRQAVKINGKSAS
                     AASALGQALAAVIVTPDTLRLVQDGPGVRRGFVDWVAFTCGRQQGALSHAVVAGDYQK
                     ALKARNRLLKLPRVEAGEWLAWESQLATLGAKMARNRYQVLQRLQPHLDRMLEDLGMA
                     QRLTITLSCQLDRHGTHWAEDESAAASLYRRLLAENRASERRSGGTAIGPHRDDLVLR
                     LDGHALAQFGSQGQQKRAALALKLAEAQLLQEQLGEWPLFVLDDPAAELDTDGMSRLM
                     GLLARCGGQIFVASCRAQTIPWSGLAPQRFYVDQGVFALTEEIPLESL"
     misc_feature    2711..3817
                     /locus_tag="Mmc1_0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    2717..3724
                     /locus_tag="Mmc1_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    2798..2821
                     /locus_tag="Mmc1_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(2807..2812,2816..2824,3062..3064,3665..3670)
                     /locus_tag="Mmc1_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    3053..3064
                     /locus_tag="Mmc1_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    3566..3595
                     /locus_tag="Mmc1_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    3653..3670
                     /locus_tag="Mmc1_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    3677..3688
                     /locus_tag="Mmc1_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     gene            3859..5223
                     /locus_tag="Mmc1_0004"
                     /db_xref="GeneID:4480631"
     CDS             3859..5223
                     /locus_tag="Mmc1_0004"
                     /note="KEGG: psp:PSPPH_1028 ATP binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_863939.1"
                     /db_xref="GI:117923322"
                     /db_xref="GeneID:4480631"
                     /translation="MKLNTLTLSNFRCFESLEITFDDYLTVLVAQNGGGKTAILDAIG
                     VALGPYLGAFDEAVGSHFSPEDVRTKPSHTQPSMESLYPLTLVAHGVAEGQEIHWERA
                     LKGKKSKTTVAGAKNLVLVAKNQQVRIRQGISVDLPLLAYYGTGRLWRNIRVTTSTKQ
                     GWGSRTLGYTNALSPASSFNSFERWFQDTDRAHYDYQLEHSDGPTNYGGANAFLASPE
                     RDNPFGQALDAVRGAVDLALESVQWGTLRYSGTHRRIVVSHPAHGILPVHLLSDGIRN
                     MIGLVADMAYRAVRLNPHLGVEAAQRVEGVVLIDEVDMHLHPAWQQVVLTDLRKAFPK
                     VQFVVTTHSPQVLTTVKRENIRVLEIENGRGTARPPLTQTLGRDNRETIEDVMQVDAR
                     PPIEPTTQLKHYLDMVGQGNGDTIEALNLRAILEQIYGKDYTKLRVADCAIHKYRAMR
                     AQSK"
     misc_feature    3859..5136
                     /locus_tag="Mmc1_0004"
                     /note="Predicted ATP-binding protein involved in virulence
                     [General function prediction only]; Region: COG3950"
                     /db_xref="CDD:226459"
     misc_feature    3874..>4302
                     /locus_tag="Mmc1_0004"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    3946..3969
                     /locus_tag="Mmc1_0004"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(3955..3960,3964..3972)
                     /locus_tag="Mmc1_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    <4756..4899
                     /locus_tag="Mmc1_0004"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     gene            5220..5909
                     /locus_tag="Mmc1_0005"
                     /db_xref="GeneID:4480632"
     CDS             5220..5909
                     /locus_tag="Mmc1_0005"
                     /note="KEGG: psp:PSPPH_1029 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863940.1"
                     /db_xref="GI:117923323"
                     /db_xref="InterPro:IPR013467"
                     /db_xref="GeneID:4480632"
                     /translation="MRHVKHTASLTKLDRAKTKDPCPTDPAKAWRGFKHKDDVAKQLK
                     LLQDGLCAYCQVSLDTELGYHIDHIQPKGPNPKQTFVWHNLVLSCIASGSQGAVSGKL
                     SCGHAKGNQALPKDMDPTHPDCESLFTYTLSGKVEPNPDRPPEQVEDIKKAIELLNLN
                     NKRLVRERAEMLHEGYLCLKDLNGSAVAHFLDLELGKTNGKHRAFITARKLHFQDWPH
                     VEPIDNTLEER"
     misc_feature    5298..5723
                     /locus_tag="Mmc1_0005"
                     /note="TIGR02646 family protein; Region: TIGR02646"
                     /db_xref="CDD:131694"
     misc_feature    5352..5486
                     /locus_tag="Mmc1_0005"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(5412..5414,5418..5426,5430..5432,5469..5474,
                     5484..5486)
                     /locus_tag="Mmc1_0005"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            5916..8354
                     /locus_tag="Mmc1_0006"
                     /db_xref="GeneID:4480633"
     CDS             5916..8354
                     /locus_tag="Mmc1_0006"
                     /EC_number="5.99.1.3"
                     /note="KEGG: vvy:VV0014 DNA gyrase subunit B;
                     TIGRFAM: DNA gyrase subunit beta;
                     PFAM: DNA gyrase subunit B domain protein; ATP-binding
                     region, ATPase domain protein domain protein; TOPRIM
                     domain protein; DNA topoisomerase, type IIA, subunit B,
                     region 2 domain protein;
                     SMART: DNA topoisomerase II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_863941.1"
                     /db_xref="GI:117923324"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="GeneID:4480633"
                     /translation="MTTENAPEAQHDHSTYDSTNIKVLKGLDAVRKRPGMYIGDTDDG
                     TGLHHMVFEVVDNAIDEALAGHCDRVEVILHTDGSCSVSDNGRGIPTDMHKEEGRSAA
                     EVIMTVLHAGGKFDDNSYKISGGLHGVGVSVVNALSETLELTIKRGGKVCHQTYHLGE
                     PTAPLAVIGDTPDSGTTVRFKPSPLIFHNVLEFSFDTLSQRLRELSFLNDGVRIFIHD
                     ERDDKSHNFFYEGGIRSFVEYLNKARTPLMPPIHFRDERNGITAEVALQWNDSYQENV
                     YCFTNNIPQRDGGTHLAGFRGALTRTINNYASANNLLKKEKVTISGDDCREGLTAVIS
                     VKVPDPKFSSQTKDKLVSSEVRPVVESVIGESLGTFFEEHPAEAKAIIAKSVEAANAR
                     EAARKARELTRRKSALEISSLPGKLADCQERDPAKCELYLVEGDSAGGSAKQARDRKH
                     QAVLPLKGKILNVEKARFDKMISSQEVGTLITALGTGIGREEYNIEKLRYHHIIIMTD
                     ADVDGAHIRTLLLTFFYRQMPEIVKRGHLYIAQPPLYRVSKGKQEQYLKDDDALNQLL
                     MNYGLHGVEGRNGSKVLDEAALSVLVRDAARYRKMLDRLGRHHDALALDIAASALHID
                     EAILKDSAAAGALIAPFTEMLQARGGEEERLQVSLLHDPETSSWVILVERAVHGMLQF
                     TRLNLAMVHSAEYKAMLAIAKRYQEEMGDEGQLVKNEKSSPAGRVADFLQLVLDEGRR
                     GLTIQRYKGLGEMNPDQLWETTMDPSVRTLLQVRVDDEVGANEVFTTLMGDVVEPRRD
                     FIQENALNVTNLDV"
     misc_feature    5955..8351
                     /locus_tag="Mmc1_0006"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    6054..6461
                     /locus_tag="Mmc1_0006"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(6072..6074,6084..6086,6093..6095,6159..6161,
                     6165..6167,6171..6173,6177..6182,6297..6308,6417..6419,
                     6423..6425,6438..6443,6447..6449)
                     /locus_tag="Mmc1_0006"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    6084..6086
                     /locus_tag="Mmc1_0006"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(6171..6173,6177..6179,6297..6299,6303..6305)
                     /locus_tag="Mmc1_0006"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    6606..7073
                     /locus_tag="Mmc1_0006"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    6756..6758
                     /locus_tag="Mmc1_0006"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(6930..6932,6939..6944,6948..6950)
                     /locus_tag="Mmc1_0006"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(6948..6950,6954..6956)
                     /locus_tag="Mmc1_0006"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    7197..7541
                     /locus_tag="Mmc1_0006"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(7215..7220,7227..7229,7437..7439,7443..7445,
                     7449..7451)
                     /locus_tag="Mmc1_0006"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(7215..7217,7437..7439)
                     /locus_tag="Mmc1_0006"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    8124..8318
                     /locus_tag="Mmc1_0006"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(8555..9178)
                     /locus_tag="Mmc1_0007"
                     /db_xref="GeneID:4480634"
     CDS             complement(8555..9178)
                     /locus_tag="Mmc1_0007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863942.1"
                     /db_xref="GI:117923325"
                     /db_xref="GeneID:4480634"
                     /translation="MMSKKERKEKIAQAFEKRMAQLDRIKNAVLNQHLEQKALAFMSK
                     TVVAKLHQTRVDLYAAERFKLLTRVIKDESKAQRQKRAQEQFRMRCKAFDAQNLWSEP
                     DPLEAQQRAEVEQTLQRKAEKRLILKRRMLAPLVPAIIFFIATASIWATGELRELGNT
                     LKKSPFQFEMWEEDHPIMGEVVRFIYEEKSKNREKWNNVNQFVKNLK"
     gene            complement(9638..10243)
                     /locus_tag="Mmc1_0008"
                     /db_xref="GeneID:4480635"
     CDS             complement(9638..10243)
                     /locus_tag="Mmc1_0008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863943.1"
                     /db_xref="GI:117923326"
                     /db_xref="GeneID:4480635"
                     /translation="MRHLAFAALLLLLAAPLQAAQPSEHAPAMVKMARQAVKDAKSAL
                     LQTNHDAMTFATDVEALHARINHLEMRYTELLKEVTTKRAAFTLLEEELRAADLTLKD
                     MEKPMREAKEQYRKAQLMSLEYPEVSTEKERKAYYDVQKLVSQQTKGQLQGLAVLKNR
                     LTLAYESLESAEQALERTRHEAEQLRSQLAEANGVIRPVAD"
     misc_feature    complement(<9668..10135)
                     /locus_tag="Mmc1_0008"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     gene            10453..10722
                     /locus_tag="Mmc1_0009"
                     /db_xref="GeneID:4480636"
     CDS             10453..10722
                     /locus_tag="Mmc1_0009"
                     /note="TIGRFAM: flagellar biosynthetic protein FliQ;
                     PFAM: export protein FliQ, family 3;
                     KEGG: yps:YPTB1692 flagellar biosynthetic protein FliQ"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliQ"
                     /protein_id="YP_863944.1"
                     /db_xref="GI:117923327"
                     /db_xref="InterPro:IPR002191"
                     /db_xref="InterPro:IPR006305"
                     /db_xref="GeneID:4480636"
                     /translation="MTADTVQNLVVEALRLALLISAPMLLTALVVGITISLLQAVTQI
                     QEMTLTFIPKILATFLALMLTLPWMIQKLTDYFRHLFDTIPTLIS"
     misc_feature    10453..10716
                     /locus_tag="Mmc1_0009"
                     /note="flagellar biosynthetic protein FliQ; Region: fliQ;
                     TIGR01402"
                     /db_xref="CDD:130469"
     gene            10733..11533
                     /locus_tag="Mmc1_0010"
                     /db_xref="GeneID:4480637"
     CDS             10733..11533
                     /locus_tag="Mmc1_0010"
                     /note="TIGRFAM: flagellar biosynthetic protein FliR;
                     PFAM: type III secretion system inner membrane R protein;
                     KEGG: cvi:CV3124 flagellar biosynthetic protein FliR"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliR"
                     /protein_id="YP_863945.1"
                     /db_xref="GI:117923328"
                     /db_xref="InterPro:IPR002010"
                     /db_xref="InterPro:IPR006303"
                     /db_xref="GeneID:4480637"
                     /translation="MDPAAMMDFFGFTIGEVERMVLIMSRLSGLFLAAPFFSRNVGPK
                     RIRVILLLWITIVIYPIVPPWPGEGNGEVIRMVFTGVVEFSMGIMIGMIAHWVLVSVQ
                     IAGTMIGFEMGLSMAMVMDPTSGVQEGVLANLLYLFGLMLFLLLNGHHWLLEGLARSF
                     VSMPLGSPLPHGEPMITIVLQGIVHMFELALLLAAPVVAAAKLLYLGMGLINRASPQI
                     QVFFLAMPVAQLMGFLIMGLTLSIFGQRLTREMELFINLAFRVVGLTP"
     misc_feature    10781..11518
                     /locus_tag="Mmc1_0010"
                     /note="flagellar biosynthetic protein FliR; Region: fliR;
                     TIGR01400"
                     /db_xref="CDD:130467"
     gene            11564..12631
                     /locus_tag="Mmc1_0011"
                     /db_xref="GeneID:4480638"
     CDS             11564..12631
                     /locus_tag="Mmc1_0011"
                     /note="TIGRFAM: flagellar biosynthetic protein FlhB;
                     PFAM: type III secretion exporter;
                     KEGG: sat:SYN_02832 flagellar biosynthesis pathway
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FlhB"
                     /protein_id="YP_863946.1"
                     /db_xref="GI:117923329"
                     /db_xref="InterPro:IPR006135"
                     /db_xref="InterPro:IPR006136"
                     /db_xref="GeneID:4480638"
                     /translation="MADEDKDSKTEEPTSKRLSDSRNKGQVVSSKEVPTALLMLAALA
                     VFLVQGNELWQALQRKMHFFLSGQISDDITPTGVSLIFNEIIRAVVMDLAPFFALFLV
                     VAIISGLIQHGWLITFEPLMPKFSKVNPLQGLKRLFSVRSLVEAFKSIVKIFVISFAV
                     YLAMRNNIDQILGLADTTITEFTTLMFKDSLEILWRVTLAFLLIAVLDFIYQKFDYIK
                     GLRMSKQEIKDEMKQMEGDPLLKGRIRQIQRELAQSRMMQEVPKADVIITNPTHYACA
                     LQYTPGQMSAPKLVAKGKGLIAARIRELADENNIPRVENPPLARTLYRDVELEQFIPP
                     ELFKAVAEVLAYVFSLKNRRS"
     misc_feature    11585..12625
                     /locus_tag="Mmc1_0011"
                     /note="flagellar biosynthetic protein FlhB; Region: flhB;
                     TIGR00328"
                     /db_xref="CDD:129428"
     gene            12800..13252
                     /locus_tag="Mmc1_0012"
                     /db_xref="GeneID:4480639"
     CDS             12800..13252
                     /locus_tag="Mmc1_0012"
                     /note="PFAM: regulatory protein RecX;
                     KEGG: sde:Sde_1289 RecX protein"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein RecX"
                     /protein_id="YP_863947.1"
                     /db_xref="GI:117923330"
                     /db_xref="InterPro:IPR003783"
                     /db_xref="GeneID:4480639"
                     /translation="MTEIELYEQALRWLGRREYGEMELRNRLRTLPEVSLELVNKVVE
                     RLLAMDYLSDVRFAEALVRDRTRRGQGSLRIRHELQQKGVPALIIESSLAELAPNDTA
                     QENAHRALVKRFGPTPPEDLKARKKRHDFLTRRGFDGQTIRMVLEALG"
     misc_feature    12800..13237
                     /locus_tag="Mmc1_0012"
                     /note="recombination regulator RecX; Reviewed; Region:
                     recX; PRK00117"
                     /db_xref="CDD:234646"
     gene            13357..15993
                     /locus_tag="Mmc1_0013"
                     /db_xref="GeneID:4480640"
     CDS             13357..15993
                     /locus_tag="Mmc1_0013"
                     /EC_number="6.1.1.7"
                     /note="KEGG: nha:Nham_1621 alanyl-tRNA synthetase;
                     TIGRFAM: alanyl-tRNA synthetase;
                     PFAM: alanyl-tRNA synthetase, class IIc; phosphoesterase,
                     DHHA1; threonyl/alanyl tRNA synthetase, SAD"
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="YP_863948.1"
                     /db_xref="GI:117923331"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="GeneID:4480640"
                     /translation="MNGNEIRKRFVAFFQQHGHTHVESSSLVPRNDPTLLFTNAGMVQ
                     FKSLFLGEERRDYSRAVSAQKCVRAGGKHNDLENVGRTARHHTFFEMLGNFSFGDYFK
                     EEAIRLGWRFVTEDLGIDAQRLLVTVYSEDDEAYAIWTQQIGLPADKVIRIPTTDNFW
                     SMGDTGPCGPCSEIFYDYGDTVAGGPPGSEDEDGDRFVEIWNLVFMQYDRSSDGTLTP
                     LPKPSIDTGAGLERLASVLQGKTNNYDTDLFQPLIKAAAALAGVDDTTCSAEQLVSLR
                     VIADHIRSVSFLIADGVLPSNEGRGYVLRRIMRRGMRHGRLLGLEQPFMHKLVETLGA
                     LMGDTYPELTAQRKTLAMVIETEEKRFAATLGTGLKHLEEAVAGLRMGDVLDGKTLFT
                     LYDTFGFPLDLTADILRDREIGVDQEGFSACMKEQRERARAAWSGSGEASLGALYHPL
                     LERVGASEFLGYVHESASASVVALIKNGAEVESLTAGDEGSVVCNQTPFYGESGGQVG
                     DRGVIQLANGARFTVTDTQKPLPDLIVHHGKMVTGTVHLGDHAELQVDGATRQAIRLH
                     HSATHLMHHALRAVLGEHVKQAGSHVSAERLRLDFSHFQGMSEEELRAVEDRVNGAIL
                     SNVSQETAVMTPQEAVAAGAMALFGEKYGDEVRVVRIGDSMELCGGTHVSRSGDMGIF
                     HILSESAVAAGVRRLEAVCGGRARAIFRGDQEALKAAAALLKTQPNKLAEGIERLLGK
                     QKELEKSLEKLQSAQAGGMVEALLEQAVEVGGIKLLAVEVKGVDGKALREMVDQVKDK
                     LGSGVILLALGGDKVSLVAGVTKDLAGKRVKAGDLMAFAAAMVGGKGGGRPDMAQGGG
                     TEVAAIPTMLTAIPGWLQEQLG"
     misc_feature    13357..15987
                     /locus_tag="Mmc1_0013"
                     /note="alanyl-tRNA synthetase; Reviewed; Region: alaS;
                     PRK00252"
                     /db_xref="CDD:234701"
     misc_feature    13366..14076
                     /locus_tag="Mmc1_0013"
                     /note="Alanyl-tRNA synthetase (AlaRS) class II core
                     catalytic domain. AlaRS is a homodimer. It is responsible
                     for the attachment of alanine to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: AlaRS_core;
                     cd00673"
                     /db_xref="CDD:238360"
     misc_feature    13417..13431
                     /locus_tag="Mmc1_0013"
                     /note="motif 1; other site"
                     /db_xref="CDD:238360"
     misc_feature    order(13498..13500,13504..13506,13558..13560,13621..13623,
                     13627..13629,13633..13641,13951..13956,13966..13968,
                     14023..14028,14038..14043,14050..14052)
                     /locus_tag="Mmc1_0013"
                     /note="active site"
                     /db_xref="CDD:238360"
     misc_feature    13555..13563
                     /locus_tag="Mmc1_0013"
                     /note="motif 2; other site"
                     /db_xref="CDD:238360"
     misc_feature    14035..14052
                     /locus_tag="Mmc1_0013"
                     /note="motif 3; other site"
                     /db_xref="CDD:238360"
     misc_feature    15322..15447
                     /locus_tag="Mmc1_0013"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; smart00863"
                     /db_xref="CDD:197931"
     misc_feature    15763..15963
                     /locus_tag="Mmc1_0013"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            complement(16227..17009)
                     /locus_tag="Mmc1_0014"
                     /db_xref="GeneID:4480641"
     CDS             complement(16227..17009)
                     /locus_tag="Mmc1_0014"
                     /EC_number="2.7.4.7"
                     /note="KEGG: ccr:CC3223 phosphomethylpyrimidine kinase;
                     TIGRFAM: phosphomethylpyrimidine kinase;
                     PFAM: phosphomethylpyrimidine kinase type-1"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine kinase"
                     /protein_id="YP_863949.1"
                     /db_xref="GI:117923332"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="GeneID:4480641"
                     /translation="MLPCVLTIAGSDPCAGAGLQADLKTITALGGYGATVVTAITVQN
                     SVKVSQVHPVEGSLVAAQMRAVLSDLPIKAIKLGMLGNRGVVEAVLSVLDHYPEIPVV
                     ADTVLRGSAGGALLADEDVAHFVQHLLPRCHLITPNLDEAQRLTGLEGGVGVADLESL
                     AYRLMGLGCGGVVLTGGHLVGNKVVDTLVCKGGIKRWIGEKIASKEGFHGTGCTLASA
                     VALGVAKGLDDFEAVEEGIAYVRQTIRRSIKLGSGQRFLGHG"
     misc_feature    complement(16269..17000)
                     /locus_tag="Mmc1_0014"
                     /note="4-amino-5-hydroxymethyl-2-methyl-pyrimidine
                     phosphate kinase (HMPP-kinase) catalyzes two consecutive
                     phosphorylation steps in the thiamine phosphate
                     biosynthesis pathway, leading to the synthesis of vitamin
                     B1. The first step is the phosphorylation of...; Region:
                     HMPP_kinase; cd01169"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(16812..16817,16827..16829,16836..16838,
                     16845..16850,16854..16856,16860..16865,16878..16892,
                     16899..16901,16905..16922,16929..16931,16938..16943,
                     16950..16952,16962..16964,16968..16973,16977..16979,
                     16998..17000))
                     /locus_tag="Mmc1_0014"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(16371..16373,16773..16775,16881..16883,
                     16944..16946,16980..16982))
                     /locus_tag="Mmc1_0014"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(16374..16376,16380..16382,16485..16487,
                     16587..16589,16698..16700))
                     /locus_tag="Mmc1_0014"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238574"
     gene            complement(17290..18675)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /db_xref="GeneID:4480642"
     CDS             complement(17290..18675)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATP-binding subunit HslU"
                     /protein_id="YP_863950.1"
                     /db_xref="GI:117923333"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="GeneID:4480642"
                     /translation="MSEFTPREIVSELDRYIIGQNMAKRAVAIALRNRWRRQRLSAEM
                     REEVYPKNILMIGPTGVGKTEIARRLAKLARAPFIKVEATKFTEVGYVGRDVESIVRD
                     LVEMGITMVTEEAKVKVQFQAEDQAEERLLDILLPLPSTGQGEGSAHFGLFGQMEGSS
                     VKPEPTAQQKESRQKMRKMLREGKLDDREIDIDLKEQRRVPMMEVITPQGMEGINLQD
                     MLGGLMGGRTKTRRVKVGEAMKLLTEEEAGKLVDQDTVQQVAIERVEQSGIVFLDELD
                     KVCARGSETRGGDVSREGVQRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFQLAKPS
                     DLLPELQGRLPIRVELESLGKGEFVRILTEPENALTRQYAALMGVENIELVFTDEGIE
                     ALAEIATRVNETAENIGARRLHTVMEKLLDELSFSAPDRGGERVVIDAAYVNRQLSDL
                     AADEDLSRFIL"
     misc_feature    complement(17293..18675)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     misc_feature    complement(<18367..18624)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(18484..18507)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(18481..18504)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(17635..18066)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="AAA domain (Cdc48 subfamily); Region: AAA_2;
                     pfam07724"
                     /db_xref="CDD:254386"
     misc_feature    complement(17356..17619)
                     /gene="hslU"
                     /locus_tag="Mmc1_0015"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            18810..20273
                     /locus_tag="Mmc1_0016"
                     /db_xref="GeneID:4480643"
     CDS             18810..20273
                     /locus_tag="Mmc1_0016"
                     /note="KEGG: dsy:DSY0277 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863951.1"
                     /db_xref="GI:117923334"
                     /db_xref="GeneID:4480643"
                     /translation="MNQHNREQATVPTPMIDEIKTQSFGVFGVDNAIVDFLQEIGFQA
                     IFNRRGWSKRTGKDLPTLIMLLILHPLLKVPSIHLFCRDHFLSVFAVGKDTFYRLLQR
                     QFPWRNAHWALIKKLLPQWRTLDLGPGYLVADTTVKEKRGDRIEGVCWHHDHNTGRSV
                     AGFEAAHLVWVNKQGTLPLDAALRFSKRPLISNLLHILSYRFDCRSHLGRRYREAAKM
                     SKLDQTVDMVARAIQAGIPAQYFLADAWYSSVKFVKKILDLGVVPLIRWKRNNTKFLF
                     QGERLTSAELYTRFAKGKIRKAKGSKRFKGTFLDAEHPEIGLIRLFFVRLIDPKTGSK
                     EWAVFLTTDRSMGLSNMIEHYANRWGIEVFYKESKQHLGFLNESVRSFEAVIACLHLA
                     AMRHAVLSSMVAIKGSQRDQLAHNLAALTYARKLWHTFRAIFNDALGRTSILENHQKN
                     EVIELFEQEVEAWLSKALMLDPLGSQRQILAETNCET"
     misc_feature    19089..19658
                     /locus_tag="Mmc1_0016"
                     /note="DDE superfamily endonuclease; Region: DDE_5;
                     cl17874"
                     /db_xref="CDD:266901"
     misc_feature    <19527..19991
                     /locus_tag="Mmc1_0016"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(20282..20818)
                     /locus_tag="Mmc1_0017"
                     /db_xref="GeneID:4480644"
     CDS             complement(20282..20818)
                     /locus_tag="Mmc1_0017"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease peptidase subunit"
                     /protein_id="YP_863952.1"
                     /db_xref="GI:117923335"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="GeneID:4480644"
                     /translation="MFKGTTILSVRRGNHVVMGGDGQVSIGNTVAKSNARKVRLMSDG
                     KVLAGFAGSTADAFTLFERFEGKLSKHGGNLTRAAVEMAKDWRTDRVLRRLEAMLAVA
                     DEHCSLLISGNGDVLEPEEGVIAIGSGGPYALSAARALLRHTSLNPRQIVESSLEVAA
                     EICVFTNNNLTIEELGGE"
     misc_feature    complement(20294..20806)
                     /locus_tag="Mmc1_0017"
                     /note="Protease HslV and the ATPase/chaperone HslU are
                     part of an ATP-dependent proteolytic system that is the
                     prokaryotic homolog of the proteasome. HslV is a dimer of
                     hexamers (a dodecamer) that forms a central proteolytic
                     chamber with active sites on the...; Region:
                     protease_HslV; cd01913"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(20435..20437,20708..20710,20750..20752,
                     20756..20758,20804..20806))
                     /locus_tag="Mmc1_0017"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(20327..20329,20333..20338,20345..20347,
                     20357..20359,20390..20392,20414..20416,20423..20428,
                     20465..20467,20477..20479,20558..20560,20729..20737))
                     /locus_tag="Mmc1_0017"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     gene            20962..21195
                     /locus_tag="Mmc1_0018"
                     /db_xref="GeneID:4480704"
     CDS             20962..21195
                     /locus_tag="Mmc1_0018"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863953.1"
                     /db_xref="GI:117923336"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="GeneID:4480704"
                     /translation="MTDQEMKDRILALLTPKNIEDGTRVMAYTMFYRKLFGRQPNSEN
                     EQRVQRMLDALVAEGKISRYPDIGVAEPPYVLS"
     gene            21209..21952
                     /locus_tag="Mmc1_0019"
                     /db_xref="GeneID:4480705"
     CDS             21209..21952
                     /locus_tag="Mmc1_0019"
                     /EC_number="2.3.2.8"
                     /note="Conjugates Arg from its aminoacyl-tRNA to the
                     N-termini of proteins containing an N-terminal aspartate
                     or glutamate"
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA-protein transferase"
                     /protein_id="YP_863954.1"
                     /db_xref="GI:117923337"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="GeneID:4480705"
                     /translation="MTGMSRIDATAQRLDLLLTPPHACSYLDNHEAAILFVEPSLPMS
                     APLYEHLMERGFRRSSEHVYRPYCAQCDACVSVRIPVERFKMSRNMRRIWKRNEDLTV
                     ASATPTHREEWFELYRRYLASRHAGGPMDDPQPSQFMEFLNASWSHTRFVEFRLNGRL
                     IMVAVVDDQPKSLSAVYTFFDPNEKARSLGTYAILWQTEAAKQAAQPWVYLGYWIKQS
                     PKMRYKSRFTPLEGYRDRRWRDLTPSELA"
     misc_feature    21239..21943
                     /locus_tag="Mmc1_0019"
                     /note="arginyl-tRNA-protein transferase; Provisional;
                     Region: PRK01305"
                     /db_xref="CDD:234939"
     misc_feature    21260..21484
                     /locus_tag="Mmc1_0019"
                     /note="Arginine-tRNA-protein transferase, N terminus;
                     Region: ATE_N; pfam04376"
                     /db_xref="CDD:252552"
     misc_feature    21539..21922
                     /locus_tag="Mmc1_0019"
                     /note="Arginine-tRNA-protein transferase, C terminus;
                     Region: ATE_C; pfam04377"
                     /db_xref="CDD:252553"
     gene            complement(22046..22708)
                     /locus_tag="Mmc1_0020"
                     /db_xref="GeneID:4480706"
     CDS             complement(22046..22708)
                     /locus_tag="Mmc1_0020"
                     /EC_number="2.7.1.24"
                     /note="KEGG: bsu:BG13824 dephospho-CoA kinase;
                     TIGRFAM: dephospho-CoA kinase;
                     PFAM: Dephospho-CoA kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="YP_863955.1"
                     /db_xref="GI:117923338"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="GeneID:4480706"
                     /translation="MYLLGLTGSIGSGKSTVAAMLVERGARLLDSDRFAREALEPGTE
                     QWHAVVARFGQDIMEEGEGDIRALDRRKLGQIVFADELARKDLESIVHPYVWRMQSKL
                     LAKWAEEEPNTVVVIDIPLLFETNGEGRCDMAVVVGCGDQQWARLENRRGMSDDMKRR
                     IIAQQMPEEEKIKRGDWVIWNTGTLDETEKQIGQLWNMVSLGAKNGVGEAWPDGWHKY
                     GY"
     misc_feature    complement(22109..22708)
                     /locus_tag="Mmc1_0020"
                     /note="Dephospho-CoA kinase [Coenzyme metabolism]; Region:
                     CoaE; COG0237"
                     /db_xref="CDD:223315"
     misc_feature    complement(22148..22702)
                     /locus_tag="Mmc1_0020"
                     /note="Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24)
                     catalyzes the phosphorylation of dephosphocoenzyme A
                     (dCoA) to yield CoA, which is the final step in CoA
                     biosynthesis; Region: DPCK; cd02022"
                     /db_xref="CDD:238980"
     misc_feature    complement(order(22214..22216,22346..22351,22433..22435,
                     22613..22615,22688..22690))
                     /locus_tag="Mmc1_0020"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238980"
     misc_feature    complement(order(22166..22168,22271..22273,22667..22672,
                     22679..22687))
                     /locus_tag="Mmc1_0020"
                     /note="ATP-binding [chemical binding]; other site"
                     /db_xref="CDD:238980"
     gene            complement(22710..23507)
                     /locus_tag="Mmc1_0021"
                     /db_xref="GeneID:4480707"
     CDS             complement(22710..23507)
                     /locus_tag="Mmc1_0021"
                     /EC_number="3.4.23.43"
                     /note="PFAM: peptidase A24A, prepilin type IV; peptidase
                     A24A domain protein;
                     KEGG: gme:Gmet_0959 peptidase A24A-like"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 prepilin peptidase 1"
                     /protein_id="YP_863956.1"
                     /db_xref="GI:117923339"
                     /db_xref="InterPro:IPR000045"
                     /db_xref="InterPro:IPR010627"
                     /db_xref="GeneID:4480707"
                     /translation="MPPTAWLDLGTALVIGLVFGSFLNVCVHRIPLKESVVNPPSHCP
                     FCKKNIVWYHNIPIFSWLWLKARCAYCHHPIHWRYPLMELLGGVVVVMAIARFGSNAE
                     GWLLALFGLALLLLSAIDMEKRILPNIITYPLLVVGVVCSALPMLGSPFPSMGDALLG
                     MVVGAGGLLVLIEVWYRVTGRVAMGLGDVKLVGVLSAWLGWQALYFIIFGSALLGVVV
                     GGGWLIWGGKEKQTPIPFGPFLALSAWIYLFLDESFKQGYLLWMVRS"
     misc_feature    complement(22758..23471)
                     /locus_tag="Mmc1_0021"
                     /note="Type II secretory pathway, prepilin signal
                     peptidase PulO and related peptidases [Cell motility and
                     secretion / Posttranslational modification, protein
                     turnover, chaperones / Intracellular trafficking and
                     secretion]; Region: PulO; COG1989"
                     /db_xref="CDD:224900"
     misc_feature    complement(23214..23468)
                     /locus_tag="Mmc1_0021"
                     /note="Bacterial Peptidase A24 N-terminal domain; Region:
                     DiS_P_DiS; pfam06750"
                     /db_xref="CDD:253893"
     misc_feature    complement(22851..23153)
                     /locus_tag="Mmc1_0021"
                     /note="Type IV leader peptidase family; Region:
                     Peptidase_A24; pfam01478"
                     /db_xref="CDD:250649"
     gene            complement(23815..24675)
                     /locus_tag="Mmc1_0022"
                     /db_xref="GeneID:4480708"
     CDS             complement(23815..24675)
                     /locus_tag="Mmc1_0022"
                     /EC_number="1.1.1.25"
                     /note="KEGG: gsu:GSU1490 shikimate 5-dehydrogenase;
                     TIGRFAM: shikimate 5-dehydrogenase;
                     PFAM: shikimate/quinate 5-dehydrogenase; shikimate
                     dehydrogenase substrate binding, N-terminal domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="YP_863957.1"
                     /db_xref="GI:117923340"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR011342"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="GeneID:4480708"
                     /translation="MLSKALNINGETGLLAVIGDPVSHSLSPKMHNLALRHCQLNYCY
                     VALPVKPHNLVRAVQGFAAMGMRGFNATIPHKENLLPLMHTLSEEASHIGAVNTVVID
                     DDGKMTGHNTDAYGFITGLKEAWRSDLSGLTAIMLGSGGAARAILYGLIQAKAARVII
                     ANRTIERAQALIEAMQPYAPNTQLMVAPTQADQLPLESCDLLINTTSMGLKGETIPYI
                     DLARLPHHAFVSDIVYGAHPTPLLRATAQHQLGGQDGLPMLIHQGAKAFELWTGHSMP
                     VELVEHTLRQ"
     misc_feature    complement(23818..24654)
                     /locus_tag="Mmc1_0022"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
                     PRK00258"
                     /db_xref="CDD:234703"
     misc_feature    complement(24379..24627)
                     /locus_tag="Mmc1_0022"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    complement(23860..24342)
                     /locus_tag="Mmc1_0022"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(23890..23892,23899..23901,23974..23976,
                     24337..24339))
                     /locus_tag="Mmc1_0022"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(23899..23904,23911..23913,23980..23982,
                     24055..24063,24187..24192,24250..24252,24259..24261))
                     /locus_tag="Mmc1_0022"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            complement(24687..25445)
                     /locus_tag="Mmc1_0023"
                     /db_xref="GeneID:4480709"
     CDS             complement(24687..25445)
                     /locus_tag="Mmc1_0023"
                     /note="PFAM: protein of unknown function DUF34;
                     KEGG: ppu:PP1302 conserved hypothetical protein TIGR00486"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863958.1"
                     /db_xref="GI:117923341"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="GeneID:4480709"
                     /translation="MANLTEIETHLRNILQCDRIDDYCPNGVQVRGGHNITRVVSGVT
                     ACMALFEAAVAVNAQLIITHHGLFWNKDPRVVEGMLKHRLKLLLEHDITLMGFHLPLD
                     MHPELGNNAQILNRLQLIAGEPFGVYKGSALSKMGHWEQSLSLDQVQQKLQKLFGGEP
                     LVLPYGPPNIRKVAVCSGGAPELIHEAVTAGADLFLTGEASEPVYHVAREMGIHFVAA
                     GHHRTEMFGVQAVGERLAQTFSLEHTFIDIPNPI"
     misc_feature    complement(24693..25445)
                     /locus_tag="Mmc1_0023"
                     /note="NIF3 (NGG1p interacting factor 3); Region: NIF3;
                     cl15371"
                     /db_xref="CDD:265677"
     gene            25568..26701
                     /locus_tag="Mmc1_0024"
                     /db_xref="GeneID:4480710"
     CDS             25568..26701
                     /locus_tag="Mmc1_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863959.1"
                     /db_xref="GI:117923342"
                     /db_xref="GeneID:4480710"
                     /translation="MTMPRDMFRIDPDPNIQRVLEADSYWQAREKILDTLIKHTLIDS
                     YNKFRKAREPYPFISRSSLRPGSVVSSKEYKLHNSALVVLLADVMPASLRKHFRCRLA
                     NRVIKKNIAGVAPDLPGLNEYDTAWRDVHHEGFIKLMRMMLPLDFALLVQPSDEDDRY
                     QLTNFHVKIERLLDMALRTMGHHLNYLERGLYEQGETFIDQLERKFFEYFNYYHNAAG
                     RRGASALAAQVLAMEQQEATIFSTSQQDRRLTLLTTYNDSHDLKIEQYVLLSLEPDEY
                     KTLKQWGKDVALDIRNHYLIHPQKSTQPVVVMRLVYQHTEAAQPNADGTLRELNVRER
                     WIRLTEETIIPLHGGAQAFIGYPVAYKKDTAEVDGKSCPLPVK"
     gene            27100..28170
                     /locus_tag="Mmc1_0025"
                     /db_xref="GeneID:4480711"
     CDS             27100..28170
                     /locus_tag="Mmc1_0025"
                     /EC_number="4.1.1.37"
                     /note="KEGG: tcx:Tcr_0123 uroporphyrinogen decarboxylase;
                     TIGRFAM: uroporphyrinogen decarboxylase;
                     PFAM: uroporphyrinogen decarboxylase (URO-D)"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_863960.1"
                     /db_xref="GI:117923343"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="GeneID:4480711"
                     /translation="MKSKHRFIQACFRQPVDRTPIWLMRQAGRYLPEYRKTRAQAGDF
                     MALCKNTELATEVTMQPIRRYGLDAAILFSDILVIPEAMGMDVRFATGEGPLLDPPVR
                     VHGDIEKLIHTDPEDSLDYVMRAVASIRKALNEEIPLIGFSGSPWTLATYMVEGGSSK
                     TFGLVKGMLYDAPESMHLLLDKLADMVAAYLNAQIRHGAQAVQIFDTWGGVLSQPTFR
                     EFSLRSMKAVVDRLDRTNSAGERIPVILFAKGCNAMVEDIAQSGCDVVGLDWTSEIGP
                     LRERIGHKVALQGNMDPALLYASPERIAQGAREVLQAFGPHPGHIFNLGHGMAPDMSP
                     DHVEALVRAVKEEGLKIHQGVA"
     misc_feature    27121..28137
                     /locus_tag="Mmc1_0025"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    order(27169..27186,27199..27201,27211..27213,27229..27231,
                     27310..27330,27364..27366,27379..27381,27523..27525,
                     27553..27555,27571..27573,27712..27714,27718..27723,
                     27838..27840,28075..28077)
                     /locus_tag="Mmc1_0025"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(27172..27174,27184..27186,27322..27324,27553..27555,
                     27718..27720,28075..28077)
                     /locus_tag="Mmc1_0025"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            28170..29576
                     /locus_tag="Mmc1_0026"
                     /db_xref="GeneID:4480712"
     CDS             28170..29576
                     /locus_tag="Mmc1_0026"
                     /EC_number="1.3.99.22"
                     /note="KEGG: tcx:Tcr_0501 oxygen-independent
                     coproporphyrinogen III oxidase;
                     TIGRFAM: oxygen-independent coproporphyrinogen III
                     oxidase;
                     PFAM: radical SAM protein; HemN domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_863961.1"
                     /db_xref="GI:117923344"
                     /db_xref="InterPro:IPR004558"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /db_xref="GeneID:4480712"
                     /translation="MHAPISQVWQFDLELINRYNKSGPRYTSYPTAPHFREDFGPDAF
                     RQAVARSQQKDPGKPLSLYFHIPFCDTVCYYCACNKVITPDRARGARYLEYLLQEVAR
                     MGALFDRKREVVQLHLGGGTPTYLDNGQLQRLWDAVNAHFTLVEDARGEYSFEADPRE
                     LPVGAVAGLRKMGMNRISIGVQDLDPVVQKAVNRIQPLDLTKRVVDEARDSGYASVNV
                     DLIYGLPFQSEAGFRETLRATIEDLDPDRLAVFNYAHLPQYFKPQRRINEADLPSPDT
                     KLKILEMAAQMLVEAGYVYIGMDHFAKPDDELAVAQRQGVLHRNFQGYTTHAECDLVS
                     MGSTSISQIGNTFAQNIKELEPYYERIERGELAIFKGLELTEDDMLRQDVIMRMICDF
                     QLDREQISKKHHIDFDQYFSVEQEDIKRMVEEGLIEDDGRLIRCTPGGRLLIRNICMT
                     FDWYLRNAEQKKTFSRTI"
     misc_feature    28188..29573
                     /locus_tag="Mmc1_0026"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09249"
                     /db_xref="CDD:236430"
     misc_feature    28374..28946
                     /locus_tag="Mmc1_0026"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(28374..28376,28380..28382,28386..28388,28392..28400,
                     28524..28526,28530..28535,28608..28616,28707..28709,
                     28830..28832,28923..28928)
                     /locus_tag="Mmc1_0026"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    29289..29495
                     /locus_tag="Mmc1_0026"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            29839..31230
                     /locus_tag="Mmc1_0027"
                     /db_xref="GeneID:4480713"
     CDS             29839..31230
                     /locus_tag="Mmc1_0027"
                     /EC_number="1.3.3.4"
                     /note="KEGG: csa:Csal_0796 protoporphyrinogen oxidase;
                     TIGRFAM: protoporphyrinogen oxidase;
                     PFAM: amine oxidase; FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_863962.1"
                     /db_xref="GI:117923345"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:4480713"
                     /translation="MTKNPILIIGGGISGLSTAWFLHKKGEKVILLESRDRVGGNIRT
                     SRNPEGYLIEHGPNSTLQKPGDEEDALGRIITDMALESELQEANPLAARRFVMKGGQL
                     HVLPTSPPGFIKTPLFSLSAKLRLCLEPFIGKSEQEESIAQFVIRRLGQEFLDYAIEP
                     FVSGVYAGDPKQLSVRAAVAKIYALEAKYGSLIKGAIALGKIRKAAGMPRGRMISFET
                     GMETLPATIANRLPHQSIHTNAQVTALCQHGAAWQVSWQQGGQHGGEPHSIIASQVVL
                     ATPASVSAQLLRPLSPQAADLLESIRYAPVDSVALGYAKQDINHSLDGFGFLIPRKEQ
                     VTTLGGLFSTTLFPGRAPQDKALLTCFIGGMTNPSITQWSEEKVVTQVDQDMMAALGI
                     QHGAEYVHLTRYTHAIAQYEQGHLQRVGDIDRALAGYKGLHLRANWRDGVSVSDCVLN
                     GEKSAQKILAGVS"
     misc_feature    29884..>30009
                     /locus_tag="Mmc1_0027"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    29890..31215
                     /locus_tag="Mmc1_0027"
                     /note="protoporphyrinogen oxidase; Region: PLN02576"
                     /db_xref="CDD:215314"
     misc_feature    <30487..31224
                     /locus_tag="Mmc1_0027"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            31230..31943
                     /locus_tag="Mmc1_0028"
                     /db_xref="GeneID:4480714"
     CDS             31230..31943
                     /locus_tag="Mmc1_0028"
                     /EC_number="2.7.7.7"
                     /note="KEGG: rru:Rru_A3611 DNA polymerase III epsilon
                     subunit;
                     TIGRFAM: DNA polymerase III subunit epsilon;
                     PFAM: exonuclease, RNase T and DNA polymerase III;
                     SMART: exonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="YP_863963.1"
                     /db_xref="GI:117923346"
                     /db_xref="InterPro:IPR006054"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR006309"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="GeneID:4480714"
                     /translation="MERLIVLDTETTGFDPKEGHRIIEIGCVELVNMRKGDERQWYVN
                     PEREIPADATKVHGITDADVANSPKFKEIYHEFLAFIGEDSLVIHNAEFDMRFLNAEL
                     TRLNKRLVMPMERAIDTIPLARRKFPGSTVNLDALCKRLGVDNSGRTFHGALLDAHLL
                     AEVYVELMGGNQFSLEMAADESGRIAQPSDSPKDGAPGPGLMMAPRDWQVSEESTQAH
                     EAFLQLLDRESGGAVWNKN"
     misc_feature    31236..31916
                     /locus_tag="Mmc1_0028"
                     /note="DNA polymerase III, epsilon subunit,
                     Proteobacterial; Region: dnaQ_proteo; TIGR01406"
                     /db_xref="CDD:130473"
     misc_feature    31239..31733
                     /locus_tag="Mmc1_0028"
                     /note="DEDDh 3'-5' exonuclease domain of the epsilon
                     subunit of Escherichia coli DNA polymerase III and similar
                     proteins; Region: DNA_pol_III_epsilon_Ecoli_like; cd06131"
                     /db_xref="CDD:99835"
     misc_feature    order(31251..31262,31266..31271,31383..31388,31395..31400,
                     31494..31499,31503..31511,31626..31631,31671..31673,
                     31680..31682,31695..31697)
                     /locus_tag="Mmc1_0028"
                     /note="active site"
                     /db_xref="CDD:99835"
     misc_feature    order(31251..31262,31266..31271,31383..31388,31395..31400,
                     31494..31499,31503..31508,31626..31631,31671..31673,
                     31680..31682,31695..31697)
                     /locus_tag="Mmc1_0028"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99835"
     misc_feature    order(31251..31253,31257..31259,31509..31511,31680..31682,
                     31695..31697)
                     /locus_tag="Mmc1_0028"
                     /note="catalytic site [active]"
                     /db_xref="CDD:99835"
     gene            32014..32565
                     /locus_tag="Mmc1_0029"
                     /db_xref="GeneID:4480715"
     CDS             32014..32565
                     /locus_tag="Mmc1_0029"
                     /note="KEGG: vvy:VVA0641 cytochrome C553"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C553"
                     /protein_id="YP_863964.1"
                     /db_xref="GI:117923347"
                     /db_xref="InterPro:IPR008169"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4480715"
                     /translation="MLLRLCVVAVLMIPSPSYGGSLLEPCLPCHKKSGEPVKTDVTPL
                     IGSQNTFYLTEVLKDYATGKRPTEVAAHRQIPPHQQAAYAAHFAQQRWVSPWQPVEQK
                     RAERGKSLVKGCERCHREGGRVQFDENPRLAGQRMAYLRLRLHQFRTAGKIPPQPEKM
                     RNFIGELNDEQIEDVVHFYANNR"
     misc_feature    <32089..32352
                     /locus_tag="Mmc1_0029"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     misc_feature    32323..32553
                     /locus_tag="Mmc1_0029"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            32681..33313
                     /locus_tag="Mmc1_0030"
                     /db_xref="GeneID:4480716"
     CDS             32681..33313
                     /locus_tag="Mmc1_0030"
                     /note="KEGG: bbr:BB0776 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863965.1"
                     /db_xref="GI:117923348"
                     /db_xref="GeneID:4480716"
                     /translation="MFLRWCCHRHDKMLGITLIEMLLGLLIIGGLLGIVMVGIELQHN
                     AQNKKIARVFIGGWVQAYDLYHERTGRVPGDPSNTGRTHVPLEAAFETQFSGIVMQLP
                     QGDGEGGINSYRYNDEQGYIHHLRLAFESISTASEAIGVGLVGNVMRLEGVSPTLFAT
                     LEALLDESLSRTQGTLRCRSILEMDQQDPMRQRNKSQANHSFVCWYKMRY"
     gene            33413..34600
                     /locus_tag="Mmc1_0031"
                     /db_xref="GeneID:4480717"
     CDS             33413..34600
                     /locus_tag="Mmc1_0031"
                     /EC_number="2.3.1.47"
                     /note="KEGG: bbr:BB3333  8-amino-7-oxononanoate synthase;
                     TIGRFAM: 8-amino-7-oxononanoate synthase;
                     PFAM: aminotransferase, class I and II"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_863966.1"
                     /db_xref="GI:117923349"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004723"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:4480717"
                     /translation="MEQPHLAYRAFCQSREAAGQWRQLHAVQPLPRGRVLRDGVELIN
                     FSSNNYMGLADHPLLKQRAMAWTEQWGTGAQASRLVCGDLEPFARIEARLVAGKGCEA
                     ALVLNAGYQANSSVIPALLDKRVLGGEPLVFSDRLNHASMHHGVQLAGVRQLRYRHGD
                     LDHLERLLKRHAGEKVAKFILSETVFSMDGDRIDVGGLIALKQRYGAFLYLDEAHATG
                     VLGPDGFGLAAAYPGQVDLVMGTFSKGLGGFGAYVTCSHALRAYLINRAGGFIYSTAL
                     PPGVLGAMDAALELLPQMGEVRARVLAGAQRVRAALRAAGLDTGNSSTPIIPVMVGDE
                     QRTLALSEGLRAEGLLGIAIRPPTVPEGTSRLRLSLSAAHSDEDWSLLAAAVPRCLRE
                     ING"
     misc_feature    33449..34582
                     /locus_tag="Mmc1_0031"
                     /note="8-amino-7-oxononanoate synthase; Reviewed; Region:
                     PRK05958"
                     /db_xref="CDD:235655"
     misc_feature    33485..34573
                     /locus_tag="Mmc1_0031"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    order(33737..33742,33749..33751,33959..33961,34046..34048,
                     34055..34057,34133..34135,34142..34144)
                     /locus_tag="Mmc1_0031"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    34142..34144
                     /locus_tag="Mmc1_0031"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            34673..35371
                     /locus_tag="Mmc1_0032"
                     /db_xref="GeneID:4480718"
     CDS             34673..35371
                     /locus_tag="Mmc1_0032"
                     /note="KEGG: gox:GOX0721 biotin synthesis protein BioH"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="YP_863967.1"
                     /db_xref="GI:117923350"
                     /db_xref="GeneID:4480718"
                     /translation="MRTVLMVHGWGLAPGLWRPMLGHMGPVELLRADLGFFHPHGQVT
                     VPLPEGDWLGVGHSMGGLWLLQALLGEAETPQMAALARCKERCRGLVFINGFSRFHQG
                     ADFPHGVGARVIGRMRKQLTVDAMQVLRDFGSRSGLPVMGLPPGVKPHVARLDEGLAA
                     ISRWDGRAILQGWSHPFLAIASREDAIVSAAMSEQMFGGSALQWIEGGSHLLPLTHGQ
                     QMAAALQQSLESWL"
     misc_feature    34682..35347
                     /locus_tag="Mmc1_0032"
                     /note="pimelyl-[acyl-carrier protein] methyl ester
                     esterase; Region: bioH; TIGR01738"
                     /db_xref="CDD:130799"
     gene            35368..36180
                     /locus_tag="Mmc1_0033"
                     /db_xref="GeneID:4480719"
     CDS             35368..36180
                     /locus_tag="Mmc1_0033"
                     /note="TIGRFAM: biotin biosynthesis protein BioC;
                     PFAM: methyltransferase type 11; methyltransferase type
                     12;
                     KEGG: bpa:BPP1773  biotin synthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin biosynthesis protein BioC"
                     /protein_id="YP_863968.1"
                     /db_xref="GI:117923351"
                     /db_xref="InterPro:IPR011814"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:4480719"
                     /translation="MNLPNRGEGNRNGRVGKNFGRALNYHRKALVQQHVADELAERLV
                     DFPLPERPRVLEIGCGTGFLSRHLMRQWPGGSFLFTDISAPMLVRCQSHLSDLPGQRQ
                     FMVMDGEHCAVRGPFDLVVSSMAMQWFGDLPGALQGLSSLLKTNGMLAFATLGDETFR
                     EWRGVCAQYGSPFGRPDYPDVAQLQEMWPSGGEGDVEEDHIPVAHSSGHGFLRALREV
                     GAHQPSGQHRPVSAALMRRMLQATRGGQHGFTVTYHVLYGFYTRSFDDRPIH"
     misc_feature    35419..36153
                     /locus_tag="Mmc1_0033"
                     /note="biotin biosynthesis protein BioC; Region: BioC;
                     TIGR02072"
                     /db_xref="CDD:233708"
     misc_feature    35464..>35571
                     /locus_tag="Mmc1_0033"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     misc_feature    35524..35820
                     /locus_tag="Mmc1_0033"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(35536..35556,35608..35613,35683..35691,35734..35736)
                     /locus_tag="Mmc1_0033"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            36233..37198
                     /locus_tag="Mmc1_0034"
                     /db_xref="GeneID:4480720"
     CDS             36233..37198
                     /locus_tag="Mmc1_0034"
                     /EC_number="2.8.1.6"
                     /note="KEGG: lic:LIC11777 biotin synthase;
                     TIGRFAM: biotin synthase;
                     PFAM: radical SAM protein; biotin and thiamin synthesis
                     associated;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="YP_863969.1"
                     /db_xref="GI:117923352"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="GeneID:4480720"
                     /translation="MAEAALAGQLPDAQSGLRLLTDPGIELLPLLQAAFRVRFHHFGR
                     GVRIHILNNVQNGYCSEDCNYCAQAKNSKAPIEKYSIKSDEEILEGARKAYESGAYRY
                     CMVSSGRSPHAERIDHMSKLIREIKSRWPVEVCLSAGFLDANKARELKEAGLDRYNHN
                     LNTADGYYGSICTTHSYGDRLNTLQEARRAGLEVCSGIIIGMGEKPEEIVEVATTLRS
                     LQARSIPVNFYVHVEGAQLGAVDQLTPAYALRALALFRFFNPDAEVRAAGGRESNLRG
                     MESMALYPANSLFAEGYLNTTGHMAEKTVKMVEDAGFFVEKIEEE"
     misc_feature    36290..37174
                     /locus_tag="Mmc1_0034"
                     /note="biotin synthase; Region: bioB; TIGR00433"
                     /db_xref="CDD:232973"
     misc_feature    36407..36982
                     /locus_tag="Mmc1_0034"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(36407..36409,36413..36415,36419..36421,36425..36433,
                     36545..36547,36551..36556,36635..36643,36710..36712,
                     36827..36829,36914..36919)
                     /locus_tag="Mmc1_0034"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    36905..37171
                     /locus_tag="Mmc1_0034"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; pfam06968"
                     /db_xref="CDD:253996"
     gene            37226..37870
                     /locus_tag="Mmc1_0035"
                     /db_xref="GeneID:4480721"
     CDS             37226..37870
                     /locus_tag="Mmc1_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863970.1"
                     /db_xref="GI:117923353"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4480721"
                     /translation="MLSPRDRFWSAALSLLLLAGCSDSSPPKNDWEPFVESYLEEKQR
                     QAELPADYYLTPERWNPLLDYLGWSQVKADTSKEHELVIREGGIDMGPEEELNAGHLE
                     GGGLLEDLKRKIHAGREALGIVDETMGDNPELLDALRDGGVREALKGVDHGYLEQKKQ
                     ELMGLAESAGVDADYQPSELDRQVLKGFGKKLGLSDKRMENLEDQAENYRDKRP"
     gene            37867..38487
                     /locus_tag="Mmc1_0036"
                     /db_xref="GeneID:4482604"
     CDS             37867..38487
                     /locus_tag="Mmc1_0036"
                     /EC_number="6.3.3.3"
                     /note="TIGRFAM: dethiobiotin synthase;
                     KEGG: syf:Synpcc7942_0030 dethiobiotin synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthase"
                     /protein_id="YP_863971.1"
                     /db_xref="GI:117923354"
                     /db_xref="InterPro:IPR004472"
                     /db_xref="GeneID:4482604"
                     /translation="MILTPPARGVFVTGTDTHVGKSVASAWLLHQWQASYWKPIQSGL
                     EGATDSQVVTELAQLDSSRLFAERFRLQAPLSPHASAAAQGIAIHLEDFQLPPCEAPL
                     VVEGAGGVLVPINQQHTMLDLMVWLGLPVIVVTRTGLGTLNHTLLTLQALEGRGLQVL
                     GLIACGEANPSNFAALRHFGQRPLLAHIPPLEPLTPERLAAVGWAE"
     misc_feature    37888..38460
                     /locus_tag="Mmc1_0036"
                     /note="AAA domain; Region: AAA_26; pfam13500"
                     /db_xref="CDD:257820"
     misc_feature    37891..38469
                     /locus_tag="Mmc1_0036"
                     /note="dithiobiotin synthetase; Reviewed; Region: bioD;
                     PRK00090"
                     /db_xref="CDD:234625"
     gene            38622..39935
                     /locus_tag="Mmc1_0037"
                     /db_xref="GeneID:4482605"
     CDS             38622..39935
                     /locus_tag="Mmc1_0037"
                     /EC_number="2.6.1.62"
                     /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase;
                     PFAM: aminotransferase class-III;
                     KEGG: mag:amb2763
                     adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="YP_863972.1"
                     /db_xref="GI:117923355"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="GeneID:4482605"
                     /translation="MTPSADLIQWDKRHCWHPFTQAQTAPDPIPMASARGATLTSVDG
                     RTFIDLNASWWVTTHGHAHPAIAAAIAQQAQTLEQVIFAGFTHAPAVNLATRLSETLG
                     GDLDRVFFSDDGSTAVEVALKMAAQYHINQGTPRHRFVAFRGGYHGDTVGAMSMGQGS
                     GFFDAFQAMLFHVDLLDYPATWLGDPTPELREALVLSQLDDYLATHGPQCGALLMEPL
                     VQGAAGMRMARAGFVQQVMERCRAAGVLVILDEVMTGFGRTGTLFAFQQCGDYPDIIC
                     LSKGLTAGFMPMSVTVVREPIYQAFMGEGFERALAHGHSFTANPLGCVAALASLELFE
                     QEGSLARIGQIAALHQQRLEPLQKHAKAVRPRVCGSIGAIDLRVADGGYGAEIGPKLK
                     AFFIEKGLLMRPLGNTVYLLPPYCVSDAQLHQGWDAIEEALDTLL"
     misc_feature    38637..39932
                     /locus_tag="Mmc1_0037"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    38640..39920
                     /locus_tag="Mmc1_0037"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(38958..38966,39057..39062,39066..39068,39267..39269,
                     39369..39371,39375..39380,39456..39458)
                     /locus_tag="Mmc1_0037"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(38961..38966,39057..39062,39267..39269,39369..39371,
                     39378..39380,39456..39458)
                     /locus_tag="Mmc1_0037"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    39456..39458
                     /locus_tag="Mmc1_0037"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(39950..41704)
                     /locus_tag="Mmc1_0038"
                     /db_xref="GeneID:4482606"
     CDS             complement(39950..41704)
                     /locus_tag="Mmc1_0038"
                     /note="PFAM: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863973.1"
                     /db_xref="GI:117923356"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="GeneID:4482606"
                     /translation="MKPQHGLKGGRPQRRGQGPAMLLAAALMWGSAQAQEAPPQVQDV
                     IPQGSAIAPPDAIESSALTGFESIGRPFPLTPNAVRRMLEQGQAQLALMLSEQALNRG
                     SGAPVTALRWRELKARAHMALGQQSQALEVLESLPTDTIDHTPELVLMMAQAQLANGQ
                     FQEARGRFSRFLVENPGHPHAYIAQRGIGICELKLGALDRARLQLGLYRERPDRPEPD
                     PEWILAMAELSLAQGGWEMARHGLKQLPEETRRSQPARAIFYRAVRMQVAEAAQTEFT
                     PKLLIDLESALAHNPGETEAQELRILHAKLFHQWATTPIKREKKPTATVQRLMQRRCL
                     LRTLLNAPQGLEQALFLTQLLELEQEAPLGLTAAGGLLTPEGLGLTPLTPPVRAVLAE
                     TLLQQQRLAEAVALLGSQRERDGDLIRLQLLAMDTSMSDVTLESLLEELSPSGTNGEP
                     MVLPSPLLEPIAKALLAYTRHGREAQAELLLAQLQTREDDPAVIRLLAYQKGLMLESL
                     GDLEEALLHYAGMSFPAEKIAPAADRLLPESPKEATARLLIQLGKTSEADKLLGKTET
                     PSNSPKGGTPTPAGVVKP"
     misc_feature    complement(<41159..>41410)
                     /locus_tag="Mmc1_0038"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     misc_feature    complement(40973..>41230)
                     /locus_tag="Mmc1_0038"
                     /note="type IV pilus biogenesis/stability protein PilW;
                     Region: type_IV_pilW; TIGR02521"
                     /db_xref="CDD:131573"
     gene            complement(41900..42769)
                     /locus_tag="Mmc1_0039"
                     /db_xref="GeneID:4482607"
     CDS             complement(41900..42769)
                     /locus_tag="Mmc1_0039"
                     /EC_number="6.3.2.1"
                     /note="KEGG: tma:TM1077 pantoate--beta-alanine ligase;
                     TIGRFAM: pantoate--beta-alanine ligase;
                     PFAM: Pantoate-beta-alanine ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate synthetase"
                     /protein_id="YP_863974.1"
                     /db_xref="GI:117923357"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="GeneID:4482607"
                     /translation="MESLQDRAALLAWRKRQGHQNIGFVPTMGCLHEGHLTLLREARQ
                     RCEQVVVSIFVNPTQFGPNEDFDLYPRTFEADWALLEAEGCDALFHPTVAAIYPPENP
                     NLTHVTLPALAGMLCGAVRPGHFDGVATVVTLLLNLVRPTSAFFGLKDYQQFTVLRSM
                     VQDLAMPVEVIGIPTVREPDGLAMSSRNRYLDAPARAQAVALSQGLNRAYHAYQEGLH
                     DATALAHLVEQTLRQAGIARIDYVAVRDALTLQPWQGKGAPVVLIAAHVGAARLIDNL
                     VLGAQPIPSVTQE"
     misc_feature    complement(41942..42769)
                     /locus_tag="Mmc1_0039"
                     /note="Pantoate-beta-alanine ligase; Region: PanC;
                     cd00560"
                     /db_xref="CDD:185673"
     misc_feature    complement(order(42209..42220,42242..42250,42311..42313,
                     42320..42325,42329..42334,42374..42379,42386..42388,
                     42563..42565,42593..42595,42602..42604,42656..42658,
                     42665..42670,42674..42676,42683..42694))
                     /locus_tag="Mmc1_0039"
                     /note="active site"
                     /db_xref="CDD:185673"
     misc_feature    complement(order(42218..42223,42242..42247,42311..42313,
                     42320..42325,42329..42334,42374..42379,42593..42595,
                     42656..42658,42665..42667,42674..42676,42686..42694))
                     /locus_tag="Mmc1_0039"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:185673"
     misc_feature    complement(order(42311..42313,42365..42367,42374..42379,
                     42593..42595,42602..42604,42686..42688,42692..42694))
                     /locus_tag="Mmc1_0039"
                     /note="pantoate-binding site; other site"
                     /db_xref="CDD:185673"
     misc_feature    complement(42665..42676)
                     /locus_tag="Mmc1_0039"
                     /note="HXXH motif; other site"
                     /db_xref="CDD:185673"
     gene            complement(42778..43584)
                     /locus_tag="Mmc1_0040"
                     /db_xref="GeneID:4482608"
     CDS             complement(42778..43584)
                     /locus_tag="Mmc1_0040"
                     /EC_number="2.1.2.11"
                     /note="KEGG: sat:SYN_02773 3-methyl-2-oxobutanoate
                     hydroxymethyltransferase;
                     TIGRFAM: 3-methyl-2-oxobutanoate hydroxymethyltransferase;
                     PFAM: Ketopantoate hydroxymethyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="YP_863975.1"
                     /db_xref="GI:117923358"
                     /db_xref="InterPro:IPR003700"
                     /db_xref="GeneID:4482608"
                     /translation="MKKRVRVPDLVRMKQQGEPIVALTAYDYTLARLVDAADVDLVLV
                     GDSLGMVVQGHETTLPVTLDEMIYHTRAVARGCQRALVVLDMPFGSTQNGPERTFEQA
                     ARAMKESGAAAIKLEGGQAMAATVAYLTERAIPVIGHLGLTPQSVHAFGGFKIQGRDQ
                     AAAQRIADDALALQQAGAGAIILEGIPAALAQQVSQSLTIPTIGIGAGVGCDGQVLVI
                     YDMLGLYGDLAPKFVKRYLDGVPVIGGAIGAYVQEVRNRQFPTPDHSFEK"
     misc_feature    complement(42805..43566)
                     /locus_tag="Mmc1_0040"
                     /note="Ketopantoate hydroxymethyltransferase (KPHMT) is
                     the first enzyme in the pantothenate biosynthesis pathway.
                     Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes
                     the first committed step in the biosynthesis of
                     pantothenate (vitamin B5), which is a...; Region:
                     KPHMT-like; cd06557"
                     /db_xref="CDD:119342"
     misc_feature    complement(order(42853..42867,42874..42876,42916..42921,
                     42928..42930,43048..43050,43132..43143,43147..43152,
                     43180..43197,43249..43251,43264..43269,43276..43278,
                     43288..43290,43318..43323,43360..43362,43369..43371,
                     43378..43383,43390..43392,43405..43410,43420..43437,
                     43441..43443,43486..43488,43495..43506,43561..43566))
                     /locus_tag="Mmc1_0040"
                     /note="oligomerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:119342"
     misc_feature    complement(order(42934..42936,42940..42942,43033..43035,
                     43153..43155,43168..43170,43240..43242,43330..43332,
                     43444..43452,43456..43458,43513..43515))
                     /locus_tag="Mmc1_0040"
                     /note="active site"
                     /db_xref="CDD:119342"
     misc_feature    complement(order(43240..43242,43330..43332,43447..43449))
                     /locus_tag="Mmc1_0040"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119342"
     gene            complement(43642..44085)
                     /locus_tag="Mmc1_0041"
                     /db_xref="GeneID:4482609"
     CDS             complement(43642..44085)
                     /locus_tag="Mmc1_0041"
                     /note="TIGRFAM:
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     pyrophosphokinase;
                     PFAM: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase,
                     HPPK;
                     KEGG: tel:tll0178
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e
                     pyrophosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="YP_863976.1"
                     /db_xref="GI:117923359"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="GeneID:4482609"
                     /translation="MRNCQQALLMLDKQPHVTVTACSSWYRTEPLGPQQPDYINGAAT
                     LTTTLSPLALLALLLDVEQQMGRDRHREQRWGPRALDLDLLFYADLLLDHPQLILPHP
                     QLHLRRFVLQPLGEIIPTKRHPKLGKTVDTLLSEVEDRGQVERLS"
     misc_feature    complement(43735..44073)
                     /locus_tag="Mmc1_0041"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK). Folate derivatives are essential cofactors in the
                     biosynthesis of purines, pyrimidines, and amino acids as
                     well as formyl-tRNA. Mammalian cells are able to utilize
                     pre-formed folates after...; Region: HPPK; cd00483"
                     /db_xref="CDD:238269"
     misc_feature    complement(order(43759..43761,43765..43767,43780..43785,
                     43792..43794,43834..43839,43843..43845,43852..43854,
                     43861..43863,43879..43881,43885..43887,43900..43902,
                     43909..43911,43921..43923,43966..43968,43972..43974,
                     43993..43995,43999..44004))
                     /locus_tag="Mmc1_0041"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    complement(order(43765..43767,43780..43785,43792..43794,
                     43834..43839,43852..43854,43879..43881,43885..43887,
                     43900..43902,43909..43911,43921..43923))
                     /locus_tag="Mmc1_0041"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            complement(44151..45026)
                     /locus_tag="Mmc1_0042"
                     /db_xref="GeneID:4482610"
     CDS             complement(44151..45026)
                     /locus_tag="Mmc1_0042"
                     /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
                     VanY/endolysins;
                     KEGG: dde:Dde_0064 D-alanyl-D-alanine carboxypeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M15B and M15C, D,D-carboxypeptidase
                     VanY/endolysins"
                     /protein_id="YP_863977.1"
                     /db_xref="GI:117923360"
                     /db_xref="InterPro:IPR003709"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:4482610"
                     /translation="MMQRRQFLQAMAVGVFGGAGMVATEAHAIEKAVPMPKKTEAYLR
                     ASMDQAEIEEAVRRIRNFNTAHKDDIFLSPAQFATLKKVNIRFTRLENLVGHANFHLL
                     GFDEAINLAKNFSSVESFSKAELDFLEELFFRDAGAYGFNGYKPFTRLTEEIPKREVS
                     KLPFTGNYLYRGTPVQTYNKILRDVGDKVILTSGVRSVIKQFRLFLHKAEESQGNLSM
                     ASRSLAPPGYSFHGIGDFDVGQVGFGYLNFTEHFATTEVFKRLRDLGYVNLRYPRDNL
                     LGVRFEPWHIKVLSV"
     misc_feature    complement(44781..>44996)
                     /locus_tag="Mmc1_0042"
                     /note="Biopterin-dependent aromatic amino acid
                     hydroxylase; a family of non-heme, iron(II)-dependent
                     enzymes that includes prokaryotic and eukaryotic
                     phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine
                     hydroxylase (TyrOH) and eukaryotic tryptophan...; Region:
                     arom_aa_hydroxylase; cl01244"
                     /db_xref="CDD:260850"
     misc_feature    complement(44169..44480)
                     /locus_tag="Mmc1_0042"
                     /note="D-alanyl-D-alanine carboxypeptidase; Region: VanY;
                     pfam02557"
                     /db_xref="CDD:251373"
     gene            45368..46315
                     /locus_tag="Mmc1_0043"
                     /db_xref="GeneID:4482611"
     CDS             45368..46315
                     /locus_tag="Mmc1_0043"
                     /note="KEGG: tcx:Tcr_1751 peptidase M14, carboxypeptidase
                     A"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M14, carboxypeptidase A"
                     /protein_id="YP_863978.1"
                     /db_xref="GI:117923361"
                     /db_xref="GeneID:4482611"
                     /translation="MTHAQHWWALPLALVFFLGCPPVQAGDTGALSPLLSMEQTCQRI
                     GNKLGSVSVQDCLSQELRPTGGYSVGGIPILVKEYPPLGQRLPRGRILVLGGIHGDEY
                     SSVSITFRWLEKLNLYHSGLFHWRVAPLTNPDGLLQENSVRMNAHGVDLNRNFGTPDW
                     ADKALEYWEKDTLRDPRRYPGPAPLSEPESRWIAQEIESFKPDVIVSIHAPYGLLDFD
                     GPPKNPPKRLGSLYLSPLGTYPGSLGRYAGMYKKIPIITIELKYAGIMPSNSEIRNIW
                     MDLVRWLSRNVNPATRQVGVDHDPDQDTNHAIPREASHS"
     misc_feature    45638..46216
                     /locus_tag="Mmc1_0043"
                     /note="Peptidase M14-like domain of Escherichia coli
                     Murein Peptide Amidase A and related proteins; Region:
                     M14_MpaA_like; cd06904"
                     /db_xref="CDD:133114"
     misc_feature    order(45659..45661,45668..45670,45794..45796,45821..45826,
                     45992..45997,46010..46012,46142..46144)
                     /locus_tag="Mmc1_0043"
                     /note="putative active site [active]"
                     /db_xref="CDD:133114"
     misc_feature    order(45659..45661,45668..45670,45992..45994)
                     /locus_tag="Mmc1_0043"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:133114"
     gene            46312..47529
                     /locus_tag="Mmc1_0044"
                     /db_xref="GeneID:4482612"
     CDS             46312..47529
                     /locus_tag="Mmc1_0044"
                     /note="catalyzes the formation of succinyldiaminopimelate
                     from N-succinyl-2-amino-6-ketopimelate"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate transaminase"
                     /protein_id="YP_863979.1"
                     /db_xref="GI:117923362"
                     /db_xref="InterPro:IPR001176"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:4482612"
                     /translation="MNPEMARLNPYPFEKLAVLFEGITPNGALSPLNISIGEPKHPTP
                     AFVTQRMMEALQDGDMAKYPTTRGERALRESMAAWLTRRFELQAGSVDPDRHVLSANG
                     TREAIFSVALAVVDRAKGGVVLTPNPFYQIYEGACFMAGVEPVHIDATEETHLRPPFT
                     QLDAELLARTQMVYLCSPSNPTGAVHPLEELQELIRLADTYDFVICADECYSEIWYDA
                     PPPGLLQACAAMGRHDFARCLVFHSLSKRSNMPGARTGFIAGDAQLLDHYFKLRTYTG
                     CATPPFIQKAAIAAWDDEQHVEENRRAYRAKLEESMAILSPVLPVTRPEASFYLWLKV
                     PGGGALFARTLYEKYNVVVLPGGYLGRQGAHGNPADGYIRIALVATLEQNREAMHRIA
                     QCAQEMIGQSQAV"
     misc_feature    46312..47502
                     /locus_tag="Mmc1_0044"
                     /note="succinyldiaminopimelate transaminase; Provisional;
                     Region: PRK09147"
                     /db_xref="CDD:236393"
     misc_feature    46405..47490
                     /locus_tag="Mmc1_0044"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(46615..46623,46699..46701,46849..46851,46942..46944,
                     47038..47040,47044..47049,47071..47073)
                     /locus_tag="Mmc1_0044"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(46624..46626,46729..46731,46921..46923,47065..47073,
                     47158..47160,47167..47169)
                     /locus_tag="Mmc1_0044"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    47047..47049
                     /locus_tag="Mmc1_0044"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            47652..48503
                     /locus_tag="Mmc1_0045"
                     /db_xref="GeneID:4482613"
     CDS             47652..48503
                     /locus_tag="Mmc1_0045"
                     /EC_number="2.3.1.117"
                     /note="TIGRFAM:
                     2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase;
                     KEGG: mag:amb3873 tetrahydrodipicolinate
                     N-succinyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="YP_863980.1"
                     /db_xref="GI:117923363"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005664"
                     /db_xref="GeneID:4482613"
                     /translation="MSDLQAIIEKAWDERDGINSSTAGEVRRAVLETIEAIDAGTLRV
                     AEKNPDHPEAEHGWVVNQWAKKAVLLYFKLHDNQVMGDEGATYFDKVPLKFAGWDEAR
                     FKQAGFRAVPPATARKGVYIAPGVVLMPSYCNIGAYVDSGTMVDTWATVGSCAQIGKN
                     VHISGGAGIGGVLEPLQANPVIIEDNCFIGARAEVAEGVIVGEGSVLSMGVYLGKSTK
                     IVDRASGEIHMGYVPPYSVVVSGTMPGKPMPNGQPGPNLYCAVIVKTVDAQTRSKTGI
                     NELLREF"
     misc_feature    47652..48494
                     /locus_tag="Mmc1_0045"
                     /note="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase; Provisional; Region: dapD;
                     PRK11830"
                     /db_xref="CDD:236996"
     misc_feature    47655..47873
                     /locus_tag="Mmc1_0045"
                     /note="Tetrahydrodipicolinate N-succinyltransferase
                     N-terminal; Region: THDPS_N_2; pfam14805"
                     /db_xref="CDD:258942"
     misc_feature    47970..48383
                     /locus_tag="Mmc1_0045"
                     /note="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP)
                     N-succinyltransferase (also called THP
                     succinyltransferase): THDP N-succinyltransferase catalyzes
                     the conversion of tetrahydrodipicolinate and succinyl-CoA
                     to N-succinyltetrahydrodipicolinate and CoA; Region:
                     LbH_THP_succinylT; cd03350"
                     /db_xref="CDD:100041"
     misc_feature    order(47976..47981,47988..47993,48039..48041,48045..48047,
                     48093..48101,48147..48149,48225..48227,48231..48233,
                     48285..48287,48366..48377,48381..48383)
                     /locus_tag="Mmc1_0045"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100041"
     misc_feature    order(47976..47978,48000..48002,48036..48038,48051..48053,
                     48087..48089,48108..48110,48135..48137,48141..48143,
                     48162..48164,48168..48173,48180..48182,48219..48227,
                     48240..48242,48273..48278)
                     /locus_tag="Mmc1_0045"
                     /note="active site"
                     /db_xref="CDD:100041"
     misc_feature    order(47976..47978,48000..48002,48036..48038,48051..48053,
                     48087..48089,48108..48110,48168..48170)
                     /locus_tag="Mmc1_0045"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100041"
     misc_feature    order(48141..48146,48162..48164,48180..48182,48219..48227,
                     48240..48242,48273..48278)
                     /locus_tag="Mmc1_0045"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100041"
     gene            48503..49666
                     /locus_tag="Mmc1_0046"
                     /db_xref="GeneID:4482614"
     CDS             48503..49666
                     /locus_tag="Mmc1_0046"
                     /EC_number="3.5.1.18"
                     /note="dapE-encoded N-succinyl-L,L-diaminopimelic acid
                     desuccinylase (DapE), catalyzes the hydrolysis of
                     N-succinyl-L,Ldiaminopimelate L,L-SDAP to
                     L,L-diaminopimelate and succinate. It is a metalloprotease
                     containing dinuclear active sites. Its structure is
                     similar to the carboxypeptidase G2 from Pseudomonas sp.
                     strain RS-16 and the aminopeptidase from Aeromonas
                     proteolytica."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="YP_863981.1"
                     /db_xref="GI:117923364"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR005941"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="GeneID:4482614"
                     /translation="MTVYSPEMVDPVALARALIQAPSVTPMDHGCQDLLIRHLEDLGF
                     TVHRLRFGHVENFYARLGSKGRNFTFAGHTDVVGAGDTSRWSSDPFAATLEEGYITGR
                     GAVDMKGGLACMVAATARFLAARPHFAQQHSLSFLITGDEEGDALDGTLKVLQWLESQ
                     QEKMDYCLVGEPTSAAQLGDCIKNGRRGSVNGRLTIRGVQGHVAYPHLVDNPIHRAAP
                     VLAAISSMTFDQGDRFFQPTSLQFTAVQSGGSATNVVPGELTAGFNIRFSAMHTPESL
                     EARIRQVLDGAEVDYDLQMMTSGLPFITEGGPLVEAVKATVAQVTGLEPQLSTGGGTS
                     DARFISRHCVQTVEFGLVGSTMHKVDERVPVADLEVLTEVYRRLLERLYPPQG"
     misc_feature    48524..49648
                     /locus_tag="Mmc1_0046"
                     /note="succinyl-diaminopimelate desuccinylase; Reviewed;
                     Region: PRK13009"
                     /db_xref="CDD:237265"
     misc_feature    48536..49639
                     /locus_tag="Mmc1_0046"
                     /note="M20 Peptidase proteobacterial DapE encoded
                     N-succinyl-L,L-diaminopimelic acid desuccinylase; Region:
                     M20_DapE_proteobac; cd03891"
                     /db_xref="CDD:193511"
     misc_feature    order(48719..48721,48818..48820,48926..48931,49013..49015,
                     49571..49573)
                     /locus_tag="Mmc1_0046"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193511"
     misc_feature    order(49073..49075,49106..49117,49133..49135,49139..49144,
                     49151..49156,49160..49165,49172..49174,49217..49219,
                     49223..49246,49265..49270,49292..49294,49298..49300,
                     49493..49495)
                     /locus_tag="Mmc1_0046"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193511"
     gene            complement(49806..50117)
                     /locus_tag="Mmc1_0047"
                     /db_xref="GeneID:4482615"
     CDS             complement(49806..50117)
                     /locus_tag="Mmc1_0047"
                     /note="KEGG: mca:MCA0256 ferredoxin 2Fe-2S"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin 2Fe-2S"
                     /protein_id="YP_863982.1"
                     /db_xref="GI:117923365"
                     /db_xref="GeneID:4482615"
                     /translation="MKPKHHVFVCMNRRPEGHPRGSCQASGSQGTFEAFNTELEKRGM
                     YEQVFVTGTFCMGPCDRGPVAVVYPEGVWYGNVKPEDVSEIFDKHFVDGGEPVERLRI
                     M"
     misc_feature    complement(49851..50105)
                     /locus_tag="Mmc1_0047"
                     /note="Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd)
                     family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like
                     Fds) and proteins containing domains similar to TRX-like
                     Fd including formate dehydrogenases, NAD-reducing
                     hydrogenases and the subunit E of NADH:...; Region:
                     TRX_Fd_family; cd02980"
                     /db_xref="CDD:239278"
     misc_feature    complement(order(49956..49964,50094..50096,50100..50102))
                     /locus_tag="Mmc1_0047"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239278"
     misc_feature    complement(order(49941..49943,49953..49955,50049..50051,
                     50088..50090))
                     /locus_tag="Mmc1_0047"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239278"
     gene            50570..50905
                     /locus_tag="Mmc1_0048"
                     /db_xref="GeneID:4482616"
     CDS             50570..50905
                     /locus_tag="Mmc1_0048"
                     /note="PFAM: DsrC family protein;
                     KEGG: tbd:Tbd_2480  sulfite reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="DsrC family protein"
                     /protein_id="YP_863983.1"
                     /db_xref="GI:117923366"
                     /db_xref="InterPro:IPR007453"
                     /db_xref="GeneID:4482616"
                     /translation="MSSFELNGTTYETDEDGYLVDLGQWNEDVANYLAKEEGIDMTES
                     HWEVVHFLREYYEEYKIAPMIRILTKAIGKKLGKDKGNTKYLYDLYPGGPAKQACKVA
                     GLPKPTGCV"
     misc_feature    50579..50902
                     /locus_tag="Mmc1_0048"
                     /note="DsrC like protein; Region: DsrC; pfam04358"
                     /db_xref="CDD:146805"
     gene            51232..51933
                     /locus_tag="Mmc1_0049"
                     /db_xref="GeneID:4482617"
     CDS             51232..51933
                     /locus_tag="Mmc1_0049"
                     /note="PFAM: nitrate reductase, subunit gamma;
                     KEGG: mag:amb3373 nitrate reductase subunit gamma"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit gamma"
                     /protein_id="YP_863984.1"
                     /db_xref="GI:117923367"
                     /db_xref="InterPro:IPR003816"
                     /db_xref="GeneID:4482617"
                     /translation="MLMILAYLALGIFVVGILARIVKYARTPAPLKIPTTPAPLTKQG
                     VAWRLFTEVAFFNSLFKGDKWTWMGGYLFHVALALVTLRHLRYFVEDIPEVAGHFQIV
                     GIVAGIAMVGGLGFLFLRRLMVDRFRHISSKADYLILLLLMAIGGSGLLMTFAIHPDV
                     VEIKAAMMGWLGMQGFETPSDVVFLLHFLLVLALMIIFPFSKLMHMVGIFFSPTRNQT
                     DTPREAKHVNPWSKY"
     misc_feature    51241..51855
                     /locus_tag="Mmc1_0049"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; cl00959"
                     /db_xref="CDD:260721"
     gene            52041..53543
                     /locus_tag="Mmc1_0050"
                     /db_xref="GeneID:4482618"
     CDS             52041..53543
                     /locus_tag="Mmc1_0050"
                     /note="KEGG: mag:amb3374 Fe-S oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="YP_863985.1"
                     /db_xref="GI:117923368"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="GeneID:4482618"
                     /translation="MADDIHVPEIGDDIVTPAPVVGTMSHLKPIPAQAKHMEPLDFPG
                     ERVENWQQAGIEKFGDLLSKYRSLQVFMDICVKCGSCTDKCHYYLGTQDPNNMPVQRA
                     ELMREVYRRYFTPGGKLFPSLVKASDFNEETLEKWFTYFHQCSQCRRCSVFCPYGIDT
                     AEVTMAARELMDSIGVGHKYSAEIVGKVHDLGNNLGIPKPALKGTLDFLEDDILETTG
                     HEVRLPLDQKGAEVLLVPPSADFFSAPHVDSLMGYAKVFHQAGISYTISSVASEAANF
                     GMFIGNFDQMQKIAKRISDQARELGVKRIVVGECGHAWRVAYAFWNTLNGPFDYLDPR
                     YPVPQHICEFTNDLYNRGALTMDRSANDDKIITFHDSCNVARASRMGPNPGGQFEIPR
                     ALIRASANRFVDMDPDTIHEKTFCCGGGGGLLTDELMDLRIKGVMPRVTALKKVMEED
                     NVNFLALICAICKAQFTKVLPYYGIPMDTVGGVHQLVSNAIQLGAKKGIV"
     misc_feature    52257..>53264
                     /locus_tag="Mmc1_0050"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    52263..52517
                     /locus_tag="Mmc1_0050"
                     /note="4Fe-4S dicluster domain; Region: Fer4_17;
                     pfam13534"
                     /db_xref="CDD:257853"
     gene            53544..54275
                     /locus_tag="Mmc1_0051"
                     /db_xref="GeneID:4482619"
     CDS             53544..54275
                     /locus_tag="Mmc1_0051"
                     /EC_number="2.7.7.56"
                     /note="KEGG: bpm:BURPS1710b_3051 ribonuclease PH;
                     TIGRFAM: ribonuclease PH;
                     PFAM: 3' exoribonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="YP_863986.1"
                     /db_xref="GI:117923369"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR002381"
                     /db_xref="GeneID:4482619"
                     /translation="MNSSLRISGRRPDEMRAVTITRHYTKHAEGSCLIAFGDTQVLCT
                     ATVEESQPRWMRNEDRGWVTAEYGMLPRSTNVRMGREAAKGKQSGRTLEIQRLIGRAM
                     RAVVDLQALGKRTIWLDCDVIQADGGTRTASITGAFVAMHDAVTGLLKAGLIRHNPLR
                     DHVAAVSCGMVAGMPALDLDYQEDSRCDTDMNFVMTGAGGFVEIQGTAEGVPFTRPEF
                     ESMAALADQGIKALVQAQKLALLKG"
     misc_feature    53559..54263
                     /locus_tag="Mmc1_0051"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    53583..54263
                     /locus_tag="Mmc1_0051"
                     /note="Ribonuclease PH; Region: RNase_PH_bact; cd11362"
                     /db_xref="CDD:206767"
     misc_feature    order(53613..53627,53655..53657,53661..53663,53667..53669,
                     53673..53675,53679..53681,53739..53741,53745..53747,
                     53751..53768,53772..53774,53781..53786,53808..53813,
                     53817..53822,53829..53831,53841..53843,53850..53852,
                     53892..53894,53898..53900,53904..53906,53910..53918,
                     54141..54155,54159..54161,54165..54182,54186..54188,
                     54195..54200,54207..54212,54219..54221)
                     /locus_tag="Mmc1_0051"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(53748..53750,53811..53813,53916..53933,54093..54095,
                     54111..54113)
                     /locus_tag="Mmc1_0051"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            54428..55600
                     /locus_tag="Mmc1_0052"
                     /db_xref="GeneID:4482620"
     CDS             54428..55600
                     /locus_tag="Mmc1_0052"
                     /EC_number="1.3.99.22"
                     /note="KEGG: pol:Bpro_1341  oxygen-independent
                     coproporphyrinogen III oxidase;
                     TIGRFAM:  oxygen-independent coproporphyrinogen III
                     oxidase;
                     PFAM: radical SAM protein; HemN domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_863987.1"
                     /db_xref="GI:117923370"
                     /db_xref="InterPro:IPR004559"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010723"
                     /db_xref="GeneID:4482620"
                     /translation="MTIFPLSLYLHIPYCVHKCPYCDFHSRVEVQVPQERYVDALLME
                     LGMWRRRFSQDARPLQSIFLGGGTPSLFDPPQIGRLMAGIGAIWPLESGCEVTMEGNP
                     ESLTQGRLAGYGEAGITRMSVGVQALDEGRLRQLQRPHDRAQALQGLGWLAQAGFSSW
                     SADFIFATPGHTVAGWLEELAEVLAFAPPHLSCYGLTVEPGTPFFQRQQGGEALVADE
                     ERQLALLEATYERLTAAGLPSYEISNFARAGHGCRHNVNYWRFGDYLGVGVAAHGKWS
                     DADGVVWRSANLADAARYMACVEAGRSPWVRDQRLTPQEAGNEALVMGLRMGEGMSKA
                     TYQWVRGVSLQQSVGDGLAWFERQGMLAQSATHVWLTPRGLRLADGVMAELMEVEP"
     misc_feature    54440..55597
                     /locus_tag="Mmc1_0052"
                     /note="Coproporphyrinogen III oxidase and related Fe-S
                     oxidoreductases [Coenzyme metabolism]; Region: HemN;
                     COG0635"
                     /db_xref="CDD:223708"
     misc_feature    54470..55108
                     /locus_tag="Mmc1_0052"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(54470..54472,54476..54478,54482..54484,54488..54496,
                     54620..54622,54626..54631,54722..54730,54797..54799,
                     54929..54931,55025..55030)
                     /locus_tag="Mmc1_0052"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    55358..55552
                     /locus_tag="Mmc1_0052"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            55693..57591
                     /locus_tag="Mmc1_0053"
                     /db_xref="GeneID:4482374"
     CDS             55693..57591
                     /locus_tag="Mmc1_0053"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: gka:GK3116 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family protein"
                     /protein_id="YP_863988.1"
                     /db_xref="GI:117923371"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:4482374"
                     /translation="MFCSAIINYYVLRHHGAFGIIPSMYIRRTQTRNTATGESYYTHR
                     LVQSLRVGTKVRQVTLLNLGRHFAIGQNHWPTLCSRIDQLLSPQKTLISLDCPSQVER
                     EAQRIVAQLLTRQPEAIPSAKETETGLSPEDVQTVLVDSLEMSRPRSVGVEQVGLWAM
                     GKAGFTELLADVGLTGPQRAAAIGAIIGRMAAPGSERALHRWLSAQSGLGELLDVDFE
                     TMSLMQFYRVSDLLIRNREAIENRLFSKINDLFNLPGTVTLYDLTNTYFEGEAEGNSK
                     AQRGRSKEKRCDSPLLTLGLVLDGSGFVRRSQIFPGNVSEGSTLEGMLKGLNAPNGTL
                     VVMDRGVATEANLVWLRDKGYRYLVVSRERERQFDFNGAACIETAAKEQIHIQKVLSD
                     DGQEVRLYCHSQRRAEKEKGISRRFAERFEAGLTKLSEGLSKPRTTKNIDKLWERIGR
                     LKEKNRGIGQHYHIEIIPDDSGLQAQAIHWKQKPLDGTSLTHPGVYCLRSNETGWDEE
                     RLWRTYITLTDLESVFRSLKSELGLRPLFHRKEERSDGHLFITVLTYQIVQIIRQQLA
                     EKGIHGRWSTLRDILSSQCRITASFRRPDGHSLQVRKATRPEPEQQKIFQALGIHANP
                     GGVKKMVV"
     misc_feature    56119..57399
                     /locus_tag="Mmc1_0053"
                     /note="Transposase [DNA replication, recombination, and
                     repair]; Region: COG5421"
                     /db_xref="CDD:227708"
     gene            57757..59304
                     /locus_tag="Mmc1_0054"
                     /db_xref="GeneID:4482375"
     CDS             57757..59304
                     /locus_tag="Mmc1_0054"
                     /note="PFAM: chemotaxis sensory transducer; Cache, type 2
                     domain protein;
                     KEGG: rme:Rmet_5641 methyl-accepting chemotaxis sensory
                     transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_863989.1"
                     /db_xref="GI:117923372"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="InterPro:IPR013163"
                     /db_xref="GeneID:4482375"
                     /translation="MLQRLRVRSLRFTVLAMAGLVVVVVVVFGLFAVAQLGTQQTMER
                     QQGLKVLAAGLHGQLERIYTLERLGAYHRDEAQLLAREAVLAMALGEGRGLWLMDMKL
                     HMVVDSSRPTWVGKDLGRVVDAQGKPFFRDLVGVVRGAGEGGVVYRWGEGAQERLVYV
                     KGFKPWGWVIGVEVGLGDITVWGGGSGLVVGLGVLLLLVLWMIGSMGHLLRRQLGGEP
                     EHVQRICRGVAKGDWGAVGGYIGESQGLGVVGELQRMQRRLMGVMARLQGGIEGVGGY
                     GERLAQGCDALMGRTDEQVSTLHETVAAMGAMTHTIAQNSQHAQGAEGIARRAYEGAQ
                     SGGVAVQEAVEVMHHIAQKIGIIEEIARQTNLLALNAAIEAARAGEQGKGFAVVAAEV
                     RKLAERSQLAAAEIGTLSGRTVGVVERAGGLIAALVPQIQQTADLVAEIARTSEEQSQ
                     GVGQVNEAVQQMEGGIDHNVVLLQQVSEMVTGLMGQVEQMERDLGVKHRGGRFGPQAL
                     GCKPYLP"
     misc_feature    57883..58146
                     /locus_tag="Mmc1_0054"
                     /note="Cache is an extracellular domain that is predicted
                     to have a role in small-molecule recognition in a wide
                     range of proteins; Region: Cache_2; smart01049"
                     /db_xref="CDD:214995"
     misc_feature    58588..59244
                     /locus_tag="Mmc1_0054"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    58630..59199
                     /locus_tag="Mmc1_0054"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(58654..58659,58666..58671,58678..58680,58687..58692,
                     58696..58701,58708..58710,58717..58722,58729..58731,
                     58738..58743,58750..58755,58762..58764,58771..58776,
                     58780..58785,58795..58797,58801..58806,58813..58818,
                     58825..58827,58834..58836,58843..58848,58855..58857,
                     58867..58869,58876..58878,58897..58899,58909..58911,
                     58918..58920,58927..58932,58939..58941,58948..58953,
                     58960..58965,58969..58974,58981..58983,59002..59007,
                     59014..59016,59023..59028,59035..59037,59044..59049,
                     59053..59058,59065..59070,59077..59079,59086..59091,
                     59098..59100,59107..59112,59116..59121,59128..59133,
                     59137..59142,59149..59151,59179..59184,59191..59193)
                     /locus_tag="Mmc1_0054"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    58843..58944
                     /locus_tag="Mmc1_0054"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            59521..60642
                     /locus_tag="Mmc1_0055"
                     /db_xref="GeneID:4482376"
     CDS             59521..60642
                     /locus_tag="Mmc1_0055"
                     /EC_number="1.4.1.1"
                     /note="KEGG: dde:Dde_1553 alanine dehydrogenase;
                     TIGRFAM: alanine dehydrogenase;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
                     NAD-binding; shikimate/quinate 5-dehydrogenase; alanine
                     dehydrogenase/PNT domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine dehydrogenase"
                     /protein_id="YP_863990.1"
                     /db_xref="GI:117923373"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR008141"
                     /db_xref="InterPro:IPR008143"
                     /db_xref="GeneID:4482376"
                     /translation="MIVGVVKEIRNQENRVALTPDGVETLIQHGHAVWVEQQAGLGSG
                     FADHHYTERGAQLCPTAAQVWQSAQLMLKVKEPQIQEYPLLQPEQMLFTYFHFAASQS
                     LTQAVIDAKCVAIAYETVENRAGHLPLLTPMSEVAGRMAIQESAKYLERAQGGRGILL
                     GGVPGVAPATVVVIGAGVVGTEAARMAAGLGAHVKVLDINLERLRAIADMLPANVTTL
                     AATPGTIREALQTADVVVGAVLLKGARAPKLISRALLKQMQPGAVIVDTAIDQGGIFE
                     TSRATTHENPVFIEEGIIHYCVTNMPGAVPITATRALTNATLPYVVKLADMGWQAACR
                     DDAGLAMGLNIVQGQVVCQAVAQTFNLPHTPRATQLGVA"
     misc_feature    59521..60615
                     /locus_tag="Mmc1_0055"
                     /note="Alanine dehydrogenase [Amino acid transport and
                     metabolism]; Region: Ald; COG0686"
                     /db_xref="CDD:223758"
     misc_feature    59521..60597
                     /locus_tag="Mmc1_0055"
                     /note="Alanine dehydrogenase NAD-binding and catalytic
                     domains; Region: L-AlaDH; cd05305"
                     /db_xref="CDD:240630"
     misc_feature    order(59554..59556,59560..59562,59578..59583,59644..59646,
                     59650..59652,59923..59928,59935..59940,59947..59949,
                     59956..59964,59968..59970,59986..60018,60022..60024,
                     60061..60063,60073..60078,60085..60090,60097..60099,
                     60121..60123,60130..60135,60142..60156,60160..60162,
                     60166..60177,60367..60369,60430..60444,60451..60456,
                     60463..60465,60472..60477)
                     /locus_tag="Mmc1_0055"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240630"
     misc_feature    order(59563..59565,59743..59745,59800..59802,60418..60420)
                     /locus_tag="Mmc1_0055"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240630"
     misc_feature    order(59806..59808,60328..60330)
                     /locus_tag="Mmc1_0055"
                     /note="putative active site [active]"
                     /db_xref="CDD:240630"
     misc_feature    order(59908..59910,59917..59922,59929..59931,60040..60045,
                     60049..60057,60109..60117,60127..60129,60178..60180,
                     60232..60240,60265..60267,60319..60321,60328..60333,
                     60412..60426)
                     /locus_tag="Mmc1_0055"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240630"
     gene            complement(60705..62090)
                     /locus_tag="Mmc1_0056"
                     /db_xref="GeneID:4482377"
     CDS             complement(60705..62090)
                     /locus_tag="Mmc1_0056"
                     /note="PFAM: peptidase M48, Ste24p;
                     KEGG: eli:ELI_12635  Zn-dependent protease"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48, Ste24p"
                     /protein_id="YP_863991.1"
                     /db_xref="GI:117923374"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:4482377"
                     /translation="MFKHLLNHPLLGLFMLLNALVLPYSAHAEKSISLITDPEVMALM
                     DAMGKPLVEAAGLNATRVKFFVILDNNINAFALPNHYVVFHSGLLLKAKHYDEIAGVM
                     AHELGHLKAGHHIKMKADARTALAKQVVGAALGIAAGMAGSGEGASALIMGGSAAARQ
                     GMLDSTRVKEQQADRLAVEYMVASSLDPNGVSRFFKTLYQLQRMNPVPPAYLSTHPLG
                     LERLQAGQDLIDRLQNQMGPFPIQEHPEWQQRLQRVQAKLEAAASDDPRAFLHQQQLK
                     LRRLLPGSSEHFAARYGSALAMRYAGQLGKAEQALRQLLKEQPNDPYLLRELGLALLD
                     WGRPEQAIPLLRQAVAGAEAYPDMHYRLAVALHEVGQLDEAANILYRLTSKPIELLDP
                     LYLLGVIEGKRGNLSMSHIALARYEHRRLDTKRALWHYKQALKLLSEQDPLRRRIDLE
                     IKAVKEEKEQE"
     misc_feature    complement(61419..61958)
                     /locus_tag="Mmc1_0056"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     misc_feature    complement(60966..61190)
                     /locus_tag="Mmc1_0056"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(60966..60968,61002..61004,61047..61049,
                     61056..61058,61068..61070,61104..61106,61149..61151,
                     61158..61160,61170..61172))
                     /locus_tag="Mmc1_0056"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(60984..60989,60996..61001,61008..61013,
                     61089..61094,61101..61106,61110..61115))
                     /locus_tag="Mmc1_0056"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            62251..62706
                     /locus_tag="Mmc1_0057"
                     /db_xref="GeneID:4482378"
     CDS             62251..62706
                     /locus_tag="Mmc1_0057"
                     /note="TIGRFAM: flagellar export protein FliJ"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar export protein FliJ"
                     /protein_id="YP_863992.1"
                     /db_xref="GI:117923375"
                     /db_xref="InterPro:IPR012823"
                     /db_xref="GeneID:4482378"
                     /translation="MAVNRFSRLVELRRLREEAQGGEYAKVLADLNALQQQVVDLDQE
                     TEQARVDALEMVGNAASILSGEMLTGFFEGQKIRRKRLLTQISRTKPVVEAAKQRWLE
                     ARKGLRQAEILEEKTSQQLQKEALKVENRMLDMAGVVRHIRQRDKENML"
     misc_feature    62257..62679
                     /locus_tag="Mmc1_0057"
                     /note="flagellar export protein FliJ; Region:
                     flagell_FliJ; TIGR02473"
                     /db_xref="CDD:131526"
     gene            62706..63218
                     /locus_tag="Mmc1_0058"
                     /db_xref="GeneID:4482379"
     CDS             62706..63218
                     /locus_tag="Mmc1_0058"
                     /note="KEGG: bba:Bd3399 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863993.1"
                     /db_xref="GI:117923376"
                     /db_xref="GeneID:4482379"
                     /translation="MNGMKKIVAVAVLAMAFMIQPVGAAQDQNGSPRDPVDLLKTLEI
                     RQNELETRAKVLDLKEQELKRMGEEVERRLKALTALREQVRQDILEEKQIDSNNIARL
                     ARIYSSMKPKVAAGQLKDLERETAVKVLKVLKEKVAAKIFDKMDPQDALPLADAIGMS
                     LQKRRMLRVQ"
     misc_feature    <62829..63155
                     /locus_tag="Mmc1_0058"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3334"
                     /db_xref="CDD:225871"
     gene            63688..64506
                     /locus_tag="Mmc1_0059"
                     /db_xref="GeneID:4482380"
     CDS             63688..64506
                     /locus_tag="Mmc1_0059"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pha:PSHAa0781 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_863994.1"
                     /db_xref="GI:117923377"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482380"
                     /translation="MPLYINTNVASLNAQRKLTKSSDDLSTTFARLSSGLRINSARDD
                     AAGLAITNRMTSQIRGLNQAVRNANDGISVAQVAEGALDETTNALQRIRELAVQSANA
                     IYNSSDRLNLDKEVDQMLAEIQRISDDTQFNKLNVLDGTYVGQKFQVGAFSGQTITLS
                     INSASLGLLGVTNLTISTQAGAEAALALVDNALDSISDVRANLGAIQSRFSAVIGNLS
                     NVVENMSAARSRIQDADIAAETANLTKTSILQQAGTAVLAQANQQPQLALQLLG"
     misc_feature    63700..64470
                     /locus_tag="Mmc1_0059"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    63700..64110
                     /locus_tag="Mmc1_0059"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    64243..64470
                     /locus_tag="Mmc1_0059"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            64649..65251
                     /locus_tag="Mmc1_0060"
                     /db_xref="GeneID:4482381"
     CDS             64649..65251
                     /locus_tag="Mmc1_0060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863995.1"
                     /db_xref="GI:117923378"
                     /db_xref="GeneID:4482381"
                     /translation="MSFHVRSHPWSLRADGSGESGWVHSPDGLYRVAAKGCHGEVLRQ
                     VPGLGMVGRFLHMMGPMEMSDTAHVGVEGLARMAELADLGRPDGQAQRHIYELAELAM
                     QGRVTCDDREVLRVAVRRLMEAINAAANDEPYELEGGTLNPMGRLRDGQFVPLGMVEG
                     LLVDGVDRVMEPRHQTTFNQGQTGTDGRTASVLGESDVET"
     gene            65238..65969
                     /locus_tag="Mmc1_0061"
                     /db_xref="GeneID:4482382"
     CDS             65238..65969
                     /locus_tag="Mmc1_0061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_863996.1"
                     /db_xref="GI:117923379"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4482382"
                     /translation="MLKRNSQAAGGGTGCHSRAGLRLVARGSMPRWATQIELGWVRQL
                     GPMPVVRLQQGYLLAEVWREIRMAIRSVSRKGCSRLVGRVEREHAGGLLGVGRLMLLH
                     GPETPSLRAQRSVGSHGQQVEVENLGAVFPLLMESRKPIQVPHSRTIGQWRIRNGRVI
                     RSGTLRRRPNGLMPRRGPLSNGVVEPHEGAMGWSIFNDGTSLLMGLPVERVEARSLGA
                     WQVSQAGEIERSARNRMIWRSMLDS"
     gene            66117..66887
                     /locus_tag="Mmc1_0062"
                     /db_xref="GeneID:4482383"
     CDS             66117..66887
                     /locus_tag="Mmc1_0062"
                     /note="PFAM: flagellin domain protein;
                     KEGG: neu:NE1593 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_863997.1"
                     /db_xref="GI:117923380"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482383"
                     /translation="MLTRASNGLQTHYERLASGRRINSAADDASGLAITSRTTAQVRG
                     FNQASRNANDGISFLQVADGALEETHAMLQQLRELAVESANGSYNALDRGNMQQVVSE
                     LTAEIQRIGSERKYNDHVMLDGTFANQTFQIGAFSSENITVTIASATASALGVEDLSF
                     STQAKAEAALATLDSALDAVSDIRLDLGAVQNRFMSAMGNLGSMSMHTSAMQSQMMDT
                     DMAAETALLTRSSVIQQAGVAMLSQANQRPQLALQLLA"
     misc_feature    66120..66881
                     /locus_tag="Mmc1_0062"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    66120..66497
                     /locus_tag="Mmc1_0062"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    66624..66854
                     /locus_tag="Mmc1_0062"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            67016..67822
                     /locus_tag="Mmc1_0063"
                     /db_xref="GeneID:4482384"
     CDS             67016..67822
                     /locus_tag="Mmc1_0063"
                     /note="PFAM: flagellin domain protein;
                     KEGG: gsu:GSU3038 flagellin FliC"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_863998.1"
                     /db_xref="GI:117923381"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482384"
                     /translation="MALSVNPNAFWLNAQQSVNGSALGIGKSTEQRTSSKRAHVAKQD
                     QQVLAAAAMTAKVRERNQESHATNDGISVIQVAQEALYQTTSTLEKVRCLTQVLEDGG
                     VAQQKEGVCEQIEVLLAEIDRIAAQTVFNQQTLISTGGWTGIVDLAPHQVICLTVGSA
                     TQRALGLDEMDLSERQGQKVEGVLKQVDNAMTSVADMRAQLGDMQVRFKEIIEQIAQV
                     EAKNGGVRIRSAQVAREAALHVKGSIQIFSDRSIVAQANQQPLLAVNLMN"
     misc_feature    67016..67795
                     /locus_tag="Mmc1_0063"
                     /note="flagellin; Provisional; Region: PRK12802"
                     /db_xref="CDD:139237"
     misc_feature    67028..67441
                     /locus_tag="Mmc1_0063"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    67574..67801
                     /locus_tag="Mmc1_0063"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            68873..69688
                     /locus_tag="Mmc1_0064"
                     /db_xref="GeneID:4482385"
     CDS             68873..69688
                     /locus_tag="Mmc1_0064"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_863999.1"
                     /db_xref="GI:117923382"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482385"
                     /translation="MALYVNTNVSSLNAQRKLNNSTNALSKTYERLSSGFRINSAADD
                     AAGLTVSTRMTAQIRGLNQAARNANDGISLVQVSEGALAETEAALQRMRELAVQAASG
                     TYTNTDRSDLNDELTQLVSEITRIATETKFNGMVTLSATQTFDIQVGADAGQKITINT
                     TAAGASALGVTAASITSAGLASAAITKIDAAIASVSDMRSVLGAQQNRLEAAIANLTN
                     VSERTQAARSRIMDADIAQETAALTRNAILQQAGTAILAQANQQPQLALSLLG"
     misc_feature    68876..69685
                     /locus_tag="Mmc1_0064"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    68885..69301
                     /locus_tag="Mmc1_0064"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    69425..69658
                     /locus_tag="Mmc1_0064"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            69892..70707
                     /locus_tag="Mmc1_0065"
                     /db_xref="GeneID:4482386"
     CDS             69892..70707
                     /locus_tag="Mmc1_0065"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864000.1"
                     /db_xref="GI:117923383"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482386"
                     /translation="MALYVNTNVASLNAQRKLNNSTNALSKTYERLSSGFRINSAADD
                     AAGLTVSTRMTAQIRGLNQAARNANDGISLVQVSEGALAETEAALQRMRELAVQAASG
                     TYTNTDRSDLNDELTQLVSEITRIATETKFNGMVTLSATQTFDIQVGADAGQKITINT
                     TAAGASALGVTAASITSAGLASAAITKIDAAIASVSDMRSVLGAQQNRLEAAIANLTN
                     VSERTQAARSRIMDADIAQETAALTRNAILQQAGTAILAQANQQPQLALSLLG"
     misc_feature    69895..70704
                     /locus_tag="Mmc1_0065"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    69904..70320
                     /locus_tag="Mmc1_0065"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    70444..70677
                     /locus_tag="Mmc1_0065"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            70911..71726
                     /locus_tag="Mmc1_0066"
                     /db_xref="GeneID:4482387"
     CDS             70911..71726
                     /locus_tag="Mmc1_0066"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864001.1"
                     /db_xref="GI:117923384"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482387"
                     /translation="MALYVNTNVASLNAQRKLNNSTNALSKTYERLSSGFRINGAADD
                     AAGLTVSTRMTAQIRGLNQAARNANDGISLVQVSEGALAETEAALQRMRELAVQAASG
                     TYTNTDRSDLNDELTQLVSEITRIATETKFNGMVTLSATQTFDIQVGADAGQKITINT
                     TAAGASALGVTAASITSAGLASAAITKIDAAIASVSDMRSVLGAQQNRLEAAIANLTN
                     VSERTQAARSRIMDADIAQETAALTRNAILQQAGTAILAQANQQPQLALSLLG"
     misc_feature    70914..71723
                     /locus_tag="Mmc1_0066"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    70923..71339
                     /locus_tag="Mmc1_0066"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    71463..71696
                     /locus_tag="Mmc1_0066"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            complement(71868..72170)
                     /locus_tag="Mmc1_0067"
                     /db_xref="GeneID:4482388"
     CDS             complement(71868..72170)
                     /locus_tag="Mmc1_0067"
                     /note="KEGG: sai:Saci_2354 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864002.1"
                     /db_xref="GI:117923385"
                     /db_xref="GeneID:4482388"
                     /translation="MSTLLTCPDLQLRGAHALCPIPEPLENRFTPLAGNLASLNQRFT
                     PLAGNLASLNQRFTPLAGNLASLNQRFTPLAGNLASLNQRFTPLAGPFWTSFPSPA"
     gene            72401..73216
                     /locus_tag="Mmc1_0068"
                     /db_xref="GeneID:4482389"
     CDS             72401..73216
                     /locus_tag="Mmc1_0068"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864003.1"
                     /db_xref="GI:117923386"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482389"
                     /translation="MSMSIITNVASLQAQRKLSGTTNALSQTYERLSSGLRINGAADD
                     AAGLTISTRMTAQIRGLNQASRNANDGISLVQVTEGALQETEAALQRMRELAVQASSA
                     TYTNTDRADLNDELTQLVTEITRIATETKFNGMVMLSATQTYDIQVGADAGQKITVST
                     TAAGASALGVTAASITSAGLASIAIGKIDAAIASVSDMRSVLGSQQNRLEAAIANLDN
                     VSERTQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
     misc_feature    72404..73213
                     /locus_tag="Mmc1_0068"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    72413..72829
                     /locus_tag="Mmc1_0068"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    72953..73186
                     /locus_tag="Mmc1_0068"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            73748..74563
                     /locus_tag="Mmc1_0069"
                     /db_xref="GeneID:4482390"
     CDS             73748..74563
                     /locus_tag="Mmc1_0069"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864004.1"
                     /db_xref="GI:117923387"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482390"
                     /translation="MSMSIITNVASLQAQRKLSGTTNALSQTYERLSSGLRINGAADD
                     AAGLTISTRMTAQIRGLNQASRNANDGISLVQVTEGALQETEAALQRMRELAVQASSA
                     TYTNTDRADLNDELTQLVTEITRIATETKFNGMVMLSATQTYDIQVGADAGQKITVST
                     TAAGASALGVTAASITSAGLASIAIGKIDAAIASVSDMRSVLGSQQNRLEAAIANLDN
                     VSERTQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
     misc_feature    73751..74560
                     /locus_tag="Mmc1_0069"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    73760..74176
                     /locus_tag="Mmc1_0069"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    74300..74533
                     /locus_tag="Mmc1_0069"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            75111..75926
                     /locus_tag="Mmc1_0070"
                     /db_xref="GeneID:4482391"
     CDS             75111..75926
                     /locus_tag="Mmc1_0070"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864005.1"
                     /db_xref="GI:117923388"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4482391"
                     /translation="MSLYINTNIASSNAQRQLLKSTNALGKTYERLSSGLRINSAADD
                     AAGLTVSSRMTAQIRGLNQSARNANDGISLVQVAEGALAETEAALQRMRELAVQAASG
                     SYTNTDRSDLNDEVTQLVSEITRISTDTKFNGVSLMSSNQTFDIQVGADAGQKITVST
                     TAAGASALGVTTASITSAGLASIAIGKIDAAIASVSDMRSVLGAQQNRLEAAITNLSN
                     VSERTQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
     misc_feature    75123..75923
                     /locus_tag="Mmc1_0070"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    75123..75539
                     /locus_tag="Mmc1_0070"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    75663..75896
                     /locus_tag="Mmc1_0070"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            76171..77304
                     /locus_tag="Mmc1_0071"
                     /db_xref="GeneID:4483641"
     CDS             76171..77304
                     /locus_tag="Mmc1_0071"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864006.1"
                     /db_xref="GI:117923389"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4483641"
                     /translation="MTGSMRVGSIAEGVRMTGVNTPVREPTAEVPTQIEWTGHGEGDD
                     RDRETRVPWGRAALYKVRSRDRYGIGLGSERGQDRWPMTPWKEGLLGENSDSESQRMS
                     RAFTMFMYLNAYRATDRLQRKLKSSSQELGKAYVRLASGYRINGASDDAAGLAVSTRM
                     TAQIRGLNQSARNANDGISLVQVAEGALVETEAALQRMRELAVQAVSGTYTDSDRSDL
                     NDEVSALISEITRISTQTTFNGAVLMSSTMTFDIQVGADVGQKITVSTAAAGASALGV
                     NTTSITSVGLASVAITKIDAAIARVSDMRAVLGVQQNRLEAAVHNLSSLCAHTEVARG
                     RIMDVDMAQETANLTKQSILQQTGAAMLAQANQQPQLLLGLLR"
     misc_feature    76504..76917
                     /locus_tag="Mmc1_0071"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    76531..77268
                     /locus_tag="Mmc1_0071"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    77041..77268
                     /locus_tag="Mmc1_0071"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            77939..78754
                     /locus_tag="Mmc1_0072"
                     /db_xref="GeneID:4483642"
     CDS             77939..78754
                     /locus_tag="Mmc1_0072"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864007.1"
                     /db_xref="GI:117923390"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4483642"
                     /translation="MSMYINTNVASSNAQRQLSKSTNALATTFERLSSGLRINSASDD
                     AAGLTVSTRMTAQIRGLNQSARNANDGISMVQVAEGALAETEDALQRMRELAVQAASG
                     SYNNTDRSDLNDEVTQLVTEITRISTDTKFNGVSLMSSNQTFDIQVGADVGQKITVST
                     QGAGASALGVTTASITSAGLASIAIGKIDAAIASVSDMRSVLGAQQNRLEAAITNLEN
                     VSERTQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQLMLSLLR"
     misc_feature    77951..78751
                     /locus_tag="Mmc1_0072"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    77951..78367
                     /locus_tag="Mmc1_0072"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    78491..78724
                     /locus_tag="Mmc1_0072"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            79378..80193
                     /locus_tag="Mmc1_0073"
                     /db_xref="GeneID:4483643"
     CDS             79378..80193
                     /locus_tag="Mmc1_0073"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pca:Pcar_1115 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864008.1"
                     /db_xref="GI:117923391"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4483643"
                     /translation="MSLYINTNIAASNAQRQLTKSTNALGKTYERLSSGLRINSASDD
                     AAGLTVSSRMTAQIRGLNQSARNANDGISLVQVAEGALAETEAALQRMRELAVQAASG
                     SYNNTDRSDLNDEVTQLVTEITRISTDTKFNGVSLMSSNQTFDIQVGADVGQKITVST
                     QGAGASLLGVTTASITSAGLASIAIGKIDAAIASVSDMRSVLGAQQNRLEAAITNLSN
                     VSERTQAARSRIMDADIAQETANLTKQSILQQAGAAMLAQANQQPQIMLSLLR"
     misc_feature    79390..80190
                     /locus_tag="Mmc1_0073"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    79390..79806
                     /locus_tag="Mmc1_0073"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    79930..80163
                     /locus_tag="Mmc1_0073"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            80287..80652
                     /locus_tag="Mmc1_0074"
                     /db_xref="GeneID:4483644"
     CDS             80287..80652
                     /locus_tag="Mmc1_0074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864009.1"
                     /db_xref="GI:117923392"
                     /db_xref="GeneID:4483644"
                     /translation="MSMERDKTFVSEEQPFRRLYWTAVPVLQTQTSAAVRSNRAWGSL
                     RAAAGRAAREMDDLGCLLEELGGSTASAEETQQAQHAVHFMRRIMAETVAFEARLEHM
                     APASSSLFPAYGDDEVLPH"
     gene            complement(80649..81017)
                     /locus_tag="Mmc1_0075"
                     /db_xref="GeneID:4483645"
     CDS             complement(80649..81017)
                     /locus_tag="Mmc1_0075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864010.1"
                     /db_xref="GI:117923393"
                     /db_xref="GeneID:4483645"
                     /translation="MLNGAVITQPCCFRSVPAENPIHHPILDGGCLHLSIVPVKNPFF
                     TIPDKALNNPSSQLIASPAQPYLLSWLLCQSFKPIRHLWADPAKKSVPTPSGEGTLSK
                     GRGHDVKRHTHGDRANARPP"
     gene            81137..81964
                     /locus_tag="Mmc1_0076"
                     /db_xref="GeneID:4483646"
     CDS             81137..81964
                     /locus_tag="Mmc1_0076"
                     /note="PFAM: flagellin domain protein;
                     KEGG: ade:Adeh_1342 flagellin-like"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864011.1"
                     /db_xref="GI:117923394"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4483646"
                     /translation="MGLTIYGNVFSLDAHRARSRRSDLSDRGTFKRLISRIEPDAGEP
                     AVLDMLRDYRRANRLRTVNQARQNANAGISTIQVAEQALRETESALQRIQEITSRPLD
                     GEPVEGSKRAKYDQEVAQLVRDIDGLAGESQRHSMRLMRGGLSSHSFAVGVDQPEEIC
                     FTVDDTSSAQMGVEASVAWDDPQLALDALANIHRAMNRVAQVRQELDQVHNRFNTVLE
                     RLSSLSEQALTERRGIESAQEAETVVAGLHSALSQQAEAAITMQANQHTMLVNLLLN"
     misc_feature    81137..81931
                     /locus_tag="Mmc1_0076"
                     /note="flagellin; Provisional; Region: PRK12802"
                     /db_xref="CDD:139237"
     misc_feature    <81299..81571
                     /locus_tag="Mmc1_0076"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     gene            82288..83112
                     /locus_tag="Mmc1_0077"
                     /db_xref="GeneID:4483647"
     CDS             82288..83112
                     /locus_tag="Mmc1_0077"
                     /note="PFAM: flagellin domain protein;
                     KEGG: mfa:Mfla_1986 flagellin-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864012.1"
                     /db_xref="GI:117923395"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4483647"
                     /translation="MALTINTNMAALIASKNLNNVQGSLNKSFQRLSSGLRINSAADD
                     AAGLSQASRMSSTIRGSNQAIRNTNDGISIAQVAETALNETESALQRIRELTVQAANG
                     TMTTTDRSDISKEVQALAAEIQRISTDTKFNGNTLLSTGGFSAYIKTNAEATAATVAV
                     QVGSATSTALGIYQTLSFATASKATSALTAIDNALSSVSSMRASLGAVQSRLESVVSG
                     LQGIVENTTSARSRIMDADVAAETTNLTRSAIIQQAGVAILAQANQQPSIVLALLS"
     misc_feature    82291..83109
                     /locus_tag="Mmc1_0077"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    82300..82704
                     /locus_tag="Mmc1_0077"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    82849..83082
                     /locus_tag="Mmc1_0077"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            complement(83294..84106)
                     /locus_tag="Mmc1_0078"
                     /db_xref="GeneID:4483648"
     CDS             complement(83294..84106)
                     /locus_tag="Mmc1_0078"
                     /EC_number="3.1.3.25"
                     /note="PFAM: inositol monophosphatase;
                     KEGG: cbu:CBU_1133 inositol-1-monophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol-phosphate phosphatase"
                     /protein_id="YP_864013.1"
                     /db_xref="GI:117923396"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="GeneID:4483648"
                     /translation="MNPAPALHVAIRAARRAGQIALQQFDRPEKLEIHEKAPHDLVTS
                     ADLAVEKELMDQLSRGYPQYGFLTEESGSHRPHAEFQWIIDPIDGTTNFVRGIPHFAI
                     SIALARRGEVVAGVVHDPFKDETFTAEKGGGAFFNERRIRVSGQERLSHALLGTGFPF
                     RHRSVMPSYLKAFGQVMENVSEVRRAGSAALDLAYVAAGRFDGFWEMRLAPWDIAAGQ
                     LLVTEAGGYVCSVTGEKDYMKSGDIVAATPGIHEKLLHLLQGAGLHQAPKRG"
     misc_feature    complement(83366..84088)
                     /locus_tag="Mmc1_0078"
                     /note="IMPase, inositol monophosphatase and related
                     domains. A family of Mg++ dependent phosphatases,
                     inhibited by lithium, many of which may act on inositol
                     monophosphate substrate. They dephosphorylate inositol
                     phosphate to generate inositol, which may be...; Region:
                     IMPase; cd01639"
                     /db_xref="CDD:238817"
     misc_feature    complement(order(83468..83473,83837..83854,83897..83902,
                     83969..83971,83987..83989,83999..84001))
                     /locus_tag="Mmc1_0078"
                     /note="active site"
                     /db_xref="CDD:238817"
     misc_feature    complement(order(83501..83512,83522..83524,83546..83566,
                     83579..83581,83585..83590,83597..83599,83606..83611,
                     83633..83638,83642..83644,83648..83656,83810..83827,
                     83831..83836,83984..83986,83990..83992))
                     /locus_tag="Mmc1_0078"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238817"
     gene            84532..86298
                     /locus_tag="Mmc1_0079"
                     /db_xref="GeneID:4483649"
     CDS             84532..86298
                     /locus_tag="Mmc1_0079"
                     /note="TIGRFAM: flagellar hook-associated protein FlgK;
                     PFAM: protein of unknown function DUF1078 domain protein;
                     KEGG: lic:LIC13451 flagellar hook-associated protein 1"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="YP_864014.1"
                     /db_xref="GI:117923397"
                     /db_xref="InterPro:IPR002371"
                     /db_xref="InterPro:IPR010930"
                     /db_xref="GeneID:4483649"
                     /translation="MQGKMAVTISSLLNISKTGLLSNQYALSSVSQNIANVNTAGYSR
                     QTAALTSNQGALRGNTDGIGGGVAVSDLKRSVDALVDNRIQLGLGEKGRLETRNQYLN
                     MIENVFNDQDGDGLSTRLDEFFSMVDKLADNPTSPASRAELVASAQNVTNFANKMYDD
                     LAGLALPVDQEIDVLVNTINTKLKSLAEVDSAIQLREKTNNPALDLKDQRDEMIRELS
                     GMIDVQVLSNQDGSTTLMTAGGELLMDHGFTATFGRGALDTTTGFAGITVNGKSGDYT
                     DKLSSGSLKALLEVRDQVVGGSSGYLTKLESIVDELRFQVNSITSTSSSMYLNQSQTG
                     VFDLGTQTATAVNAQDYTTVNAPPPDLGRVVDGTVTFAYGSDANNLSFDSVNITSSMT
                     IDEVVAALNASNAVSASVNANNQLSIAAKSTYYAVSADSSNIMAAMGIGALFGGTGAS
                     NMAVNSEMVADQTTVPVGRIRTDANGLPQFDNADNDGVLALGDLRNTKFTLFGESLTL
                     SAHYASTISQLGAEQASNEEQLGAATSTYNFMQQVRASISGVSLEEELTDLMRFQRAF
                     QASSKMVVTADELLQSVIGMVR"
     misc_feature    84562..85551
                     /locus_tag="Mmc1_0079"
                     /note="flagellar hook-associated protein FlgK; Region:
                     flgK_ends; TIGR02492"
                     /db_xref="CDD:233894"
     misc_feature    <86173..86289
                     /locus_tag="Mmc1_0079"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            86321..87526
                     /locus_tag="Mmc1_0080"
                     /db_xref="GeneID:4483650"
     CDS             86321..87526
                     /locus_tag="Mmc1_0080"
                     /note="KEGG: sat:SYN_02811 flagellin and related
                     hook-associated proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin-like protein"
                     /protein_id="YP_864015.1"
                     /db_xref="GI:117923398"
                     /db_xref="GeneID:4483650"
                     /translation="MLRVTQSTLYSTTVTQLQDQYRTMSQIQEKSTSGQEVNRPSDDP
                     TIAYRDMLFSTQLSEVDALVRTTDLASERMRMAETNLSTMEGKMLDAQQLVLTLGTAV
                     QSGQPSVFNAAAREAQAIYEDLLSSVNAELDGVPLFSGGKTTLPYSESNLTTSAVKIR
                     EGGQGQVKATTGYSAALTGTPTDIPASVRVIYRSTDDAGTALATPQYQVNVNGVEGST
                     IDSTGFPQTLDLGDGMQLQVDSAPGDKDALFFEVVPAYQGGAADREVRIATGQRLEGN
                     VTGEEVMQGTGNGRGADVFAAVAGLRGALLRNDYEEINAWLTPVQDGRAQIQDLEAVT
                     GVRTVLMESVNDSLELDSDALKTVKAVNISVDAFDIYSQLQQTSQAMQMMTASERQIL
                     DNSLLDFIR"
     misc_feature    86321..87523
                     /locus_tag="Mmc1_0080"
                     /note="flagellar hook-associated protein FlgL; Validated;
                     Region: PRK06663"
                     /db_xref="CDD:180648"
     misc_feature    86339..86749
                     /locus_tag="Mmc1_0080"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     gene            87557..88045
                     /locus_tag="Mmc1_0081"
                     /db_xref="GeneID:4483651"
     CDS             87557..88045
                     /locus_tag="Mmc1_0081"
                     /note="PFAM: protein of unknown function DUF180;
                     KEGG: dsy:DSY3025 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864016.1"
                     /db_xref="GI:117923399"
                     /db_xref="InterPro:IPR003775"
                     /db_xref="GeneID:4483651"
                     /translation="MEIQGTRFGTLEFDEKEIIYLNEGLLGFPLSKQFLMFPYGEDSS
                     FFWLQSVDEPEIAFIVINPFDFFSDLEFAVEDEDASSLVLARSEDVEIFTLVTIPEGR
                     PEEMRTNLAGPVVVNVQNRLGKQILCKDYSPRQPLIPDSMRSQLKEQARSSKGGHVAG
                     GR"
     misc_feature    87557..87991
                     /locus_tag="Mmc1_0081"
                     /note="flagellar assembly protein FliW; Provisional;
                     Region: PRK13285"
                     /db_xref="CDD:237334"
     gene            88268..89086
                     /locus_tag="Mmc1_0082"
                     /db_xref="GeneID:4483652"
     CDS             88268..89086
                     /locus_tag="Mmc1_0082"
                     /note="PFAM: flagellin domain protein;
                     KEGG: pha:PSHAa0781 flagellin"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain-containing protein"
                     /protein_id="YP_864017.1"
                     /db_xref="GI:117923400"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:4483652"
                     /translation="MALYINTNVASLNAQRNLSNSTGKLGTTFSRLASGLRINSARDD
                     AAGLAITQRMTAQIRGLNQAIRNANDGISVSQVAEGALDETTNALQRIRELAVQSANA
                     IYNSSDRLNLDKEVDQMLAEVQRISVDTEFNKLNVLDGTYTGQAIQVGAFASQTITIS
                     IAGAQLSHLGITNVTISTAAGATAALSLIDLALDSIADVRANLGAIQSRFGAVTANLS
                     NIVENMSASRSRIQDADIAAETATLTKNAILQQAGTAVLAQANQQPQLALQLLG"
     misc_feature    88271..89050
                     /locus_tag="Mmc1_0082"
                     /note="flagellin; Reviewed; Region: PRK08869"
                     /db_xref="CDD:236344"
     misc_feature    88280..88696
                     /locus_tag="Mmc1_0082"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    88823..89050
                     /locus_tag="Mmc1_0082"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            89154..89534
                     /locus_tag="Mmc1_0083"
                     /db_xref="GeneID:4483653"
     CDS             89154..89534
                     /locus_tag="Mmc1_0083"
                     /note="PFAM: flagellar protein FlaG protein;
                     KEGG: cvi:CV3877 Flagellin protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlaG protein"
                     /protein_id="YP_864018.1"
                     /db_xref="GI:117923401"
                     /db_xref="InterPro:IPR005186"
                     /db_xref="GeneID:4483653"
                     /translation="MMQISAISQSYVPYEVWVRVGERALSQDSDRAVVGRDGEKAQEA
                     AKIADLGSDVSRLLEKNVKKLENALSAFTSLRFAVDRDTEERVVRVVNRQTNEVIRQI
                     PTEEMLTLSRRLRNAQSLLLETTA"
     misc_feature    89223..89528
                     /locus_tag="Mmc1_0083"
                     /note="FlaG protein; Region: FlaG; pfam03646"
                     /db_xref="CDD:252082"
     gene            89589..91028
                     /locus_tag="Mmc1_0084"
                     /db_xref="GeneID:4483654"
     CDS             89589..91028
                     /locus_tag="Mmc1_0084"
                     /note="PFAM: flagellar hook-associated protein 2 domain
                     protein; flagellar hook-associated 2 domain protein;
                     flagellin hook IN repeat protein;
                     KEGG: gme:Gmet_0444 flagellar hook-associated protein
                     2-like"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated 2 domain-containing
                     protein"
                     /protein_id="YP_864019.1"
                     /db_xref="GI:117923402"
                     /db_xref="InterPro:IPR003481"
                     /db_xref="InterPro:IPR010809"
                     /db_xref="InterPro:IPR010810"
                     /db_xref="GeneID:4483654"
                     /translation="MATGSITFGGLASGLPADIVDQLMQSEQARLTKMNQTSNQVSAT
                     KSTYSSLESQLLALKSKAEDMQSADFFRPHTATSSDEDVATISADSDAQEGNHSITVN
                     QLATYDTFVSKGSVTTTTAGLSADTTFSFDYNGTSYSVALTAGDTLADIADAITNTTY
                     DNEDDGEGVTASVLYDGSNYRLLLNARDSGTNSGASRLDLSGAADLAFDSGETITGGV
                     TGSNDNSAWWNSVAGVDASLTVDNIAVTSTTNEVSDVLAGIKMSLKSTGNFTISITND
                     EETLKTNVQSFVDSFNSVISFINNNKSSFGGDSLARNTINMLRAEINTPTSDSSSPYS
                     ELSTYSTLSSIGIKTDRSSGLLSIDSTDFSEAMSNGFSKIASIFTSKPSSADETAFET
                     AGGNEGLSYRMESLVYSLTTDTDNPFDAKSSGLQARLDSMATSIEREESRLEKVRDRL
                     TKQYANLEQLMSQMQSTQSALTSALAGLS"
     misc_feature    89589..91025
                     /locus_tag="Mmc1_0084"
                     /note="Flagellar capping protein [Cell motility and
                     secretion]; Region: FliD; COG1345"
                     /db_xref="CDD:224264"
     misc_feature    89622..89915
                     /locus_tag="Mmc1_0084"
                     /note="Flagellar hook-associated protein 2 N-terminus;
                     Region: FliD_N; pfam02465"
                     /db_xref="CDD:251313"
     misc_feature    90285..90986
                     /locus_tag="Mmc1_0084"
                     /note="Flagellar hook-associated protein 2 C-terminus;
                     Region: FliD_C; pfam07195"
                     /db_xref="CDD:254097"
     gene            91126..91491
                     /locus_tag="Mmc1_0085"
                     /db_xref="GeneID:4483655"
     CDS             91126..91491
                     /locus_tag="Mmc1_0085"
                     /note="PFAM: flagellar protein FliS;
                     KEGG: bba:Bd0611 flagellar protein FliS"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FliS"
                     /protein_id="YP_864020.1"
                     /db_xref="GI:117923403"
                     /db_xref="InterPro:IPR003713"
                     /db_xref="GeneID:4483655"
                     /translation="MAAIQVKQEQVVPSQDQLGLLIDLYEGAIRFLEQAVQAGQAGDM
                     VGFRTNLGRGRRIIQEFQRTLNPRHGGDVPSQLNRLYQFMIDTLNEVDLTGETAPVKQ
                     VVGQLGTLLDAWRGVVPML"
     misc_feature    91126..91482
                     /locus_tag="Mmc1_0085"
                     /note="Flagellar protein FliS; Region: FliS; cl00654"
                     /db_xref="CDD:242007"
     gene            91595..92116
                     /locus_tag="Mmc1_0086"
                     /db_xref="GeneID:4483656"
     CDS             91595..92116
                     /locus_tag="Mmc1_0086"
                     /note="PFAM: flagellar protein FliS;
                     KEGG: bba:Bd0611 flagellar protein FliS"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FliS"
                     /protein_id="YP_864021.1"
                     /db_xref="GI:117923404"
                     /db_xref="InterPro:IPR003713"
                     /db_xref="GeneID:4483656"
                     /translation="MSYGLRSYKSSRANTASREDLLILLYEGAIRFLEKSLQAHTAGT
                     LSEHKMMLQRAMAIISELQNTLDFEKGGDLAMQLFDLYNYMLDRLTKANINRDMSAIS
                     EVIEHLNVLLDGWRQAVAQVKRQGGMAALVANGGSASTDPVDTVTASKPVAPRPQQKA
                     PGALPRLSRPQVL"
     misc_feature    91595..91978
                     /locus_tag="Mmc1_0086"
                     /note="Flagellar protein FliS; Region: FliS; cl00654"
                     /db_xref="CDD:242007"
     gene            92165..92506
                     /locus_tag="Mmc1_0087"
                     /db_xref="GeneID:4483657"
     CDS             92165..92506
                     /locus_tag="Mmc1_0087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864022.1"
                     /db_xref="GI:117923405"
                     /db_xref="GeneID:4483657"
                     /translation="MEHHIRELKRILDALEAPDGMDSAKIHTLELEMKQVESAIVESA
                     KLPWPEAQRKKWGDRLDEQVRRMPSIQARLLQERGRISAQLMNENRRVKRMRDDRASV
                     AVNNRVIGRTA"
     gene            complement(92618..92691)
                     /locus_tag="Mmc1_R0001"
                     /note="tRNA-Gly4"
                     /db_xref="GeneID:4481088"
     tRNA            complement(92618..92691)
                     /locus_tag="Mmc1_R0001"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:4481088"
     gene            complement(92776..93432)
                     /locus_tag="Mmc1_0088"
                     /db_xref="GeneID:4481089"
     CDS             complement(92776..93432)
                     /locus_tag="Mmc1_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864023.1"
                     /db_xref="GI:117923406"
                     /db_xref="GeneID:4481089"
                     /translation="MVERLPADPFERIQAGLKISLERPMLSNELTMPGVKREDPDSVR
                     PLEEEWQAARQRIAQFNAQRNWMGVLNTLLEMSNNDRHPEAYLARLQAAWLVVKLPQA
                     PVSHVVIVLYNLLASLESGHPAAGPLAALANLMALHRTPDHPERELAQMQAQQMWDMA
                     AHNLGIEPGSHFESWMERNGLNDPNSFVPRIMGMLEKMENRPWWIDKEAIQEDMMQQA
                     "
     gene            93583..93849
                     /locus_tag="Mmc1_0089"
                     /db_xref="GeneID:4481090"
     CDS             93583..93849
                     /locus_tag="Mmc1_0089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864024.1"
                     /db_xref="GI:117923407"
                     /db_xref="GeneID:4481090"
                     /translation="MQETEKRFFLWRFIDDLDWFVLIVVAIMLGAVPFGEPHLWQKLT
                     MLAAGTLTKPLDIFDLCMHGTPSVLLAIKAIRHYGGFAPVKEKS"
     gene            93846..94439
                     /locus_tag="Mmc1_0090"
                     /db_xref="GeneID:4481091"
     CDS             93846..94439
                     /locus_tag="Mmc1_0090"
                     /EC_number="2.7.1.71"
                     /note="PFAM: shikimate kinase;
                     KEGG: lic:LIC20099 shikimate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="YP_864025.1"
                     /db_xref="GI:117923408"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="GeneID:4481091"
                     /translation="MNICLIGMRGSGKSNLSRRLSVLTKRTVFSTDALISYEQEGQSI
                     EEIVRNAARGWHDFRDLEYQVVRRAARMQGVIIDCGGGVIVDLDSQGSEVYSSRKVGA
                     LKRSGIVVWLRGDVDRLVQKAQTKAMAEDPNRPQLDTTQSLKALMEHRLPFYEKAADI
                     ILDIDGKKRRDLAVELMKRTSDAAWHSMVMRRGQELD"
     misc_feature    93849..94349
                     /locus_tag="Mmc1_0090"
                     /note="Shikimate kinase (SK) is the fifth enzyme in the
                     shikimate pathway, a seven-step biosynthetic pathway which
                     converts erythrose-4-phosphate to chorismic acid, found in
                     bacteria, fungi and plants. Chorismic acid is a important
                     intermediate in the synthesis...; Region: SK; cd00464"
                     /db_xref="CDD:238260"
     misc_feature    order(93873..93890,94209..94211,94245..94247)
                     /locus_tag="Mmc1_0090"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    order(93885..93887,93933..93935,93939..93941)
                     /locus_tag="Mmc1_0090"
                     /note="magnesium binding site [ion binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    order(93939..93941,94020..94022,94029..94031,94083..94091,
                     94293..94295)
                     /locus_tag="Mmc1_0090"
                     /note="putative shikimate binding site; other site"
                     /db_xref="CDD:238260"
     gene            95149..95442
                     /locus_tag="Mmc1_0091"
                     /db_xref="GeneID:4481092"
     CDS             95149..95442
                     /locus_tag="Mmc1_0091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864026.1"
                     /db_xref="GI:117923409"
                     /db_xref="GeneID:4481092"
                     /translation="MTHAMDIHGARVYDRLSRPAAPQQNRVQQVSDAPSGRTAAPVRD
                     QVTISASVERVTDAIDTLVADTLDNMPGRWDARIEREALEQSMISLRLGTLYA"
     gene            complement(95540..95830)
                     /locus_tag="Mmc1_0092"
                     /db_xref="GeneID:4481093"
     CDS             complement(95540..95830)
                     /locus_tag="Mmc1_0092"
                     /note="TIGRFAM: integration host factor, subunit alpha;
                     PFAM: histone family protein DNA-binding protein;
                     KEGG: ade:Adeh_1969 integration host factor, subunit
                     alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor subunit alpha"
                     /protein_id="YP_864027.1"
                     /db_xref="GI:117923410"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="InterPro:IPR005684"
                     /db_xref="GeneID:4481093"
                     /translation="MTMTKADIVQTVYQRLGLSKKESADIVESVFELIRNQLENGDPV
                     KISGFGNFTMREKNPRQGRNPKTGEEVEISARRVVTFKASQILLNKVNNGKG"
     misc_feature    complement(95558..95821)
                     /locus_tag="Mmc1_0092"
                     /note="Alpha subunit of integration host factor (IHFA);
                     Region: IHF_A; cd13835"
                     /db_xref="CDD:259857"
     misc_feature    complement(order(95567..95569,95576..95578,95585..95587,
                     95597..95599,95603..95605,95612..95614,95618..95620,
                     95633..95653,95660..95662,95666..95668,95678..95680,
                     95684..95692,95696..95698,95759..95761,95816..95821))
                     /locus_tag="Mmc1_0092"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259857"
     misc_feature    complement(order(95558..95563,95588..95590,95594..95596,
                     95600..95605,95690..95692,95696..95707,95723..95728,
                     95732..95737,95744..95746,95756..95758,95798..95800,
                     95807..95809))
                     /locus_tag="Mmc1_0092"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259857"
     gene            96408..97709
                     /locus_tag="Mmc1_0093"
                     /db_xref="GeneID:4481094"
     CDS             96408..97709
                     /locus_tag="Mmc1_0093"
                     /EC_number="5.4.3.8"
                     /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
                     PFAM: aminotransferase class-III;
                     KEGG: psp:PSPPH_4384
                     glutamate-1-semialdehyde-2,1-aminomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="YP_864028.1"
                     /db_xref="GI:117923411"
                     /db_xref="InterPro:IPR004639"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="GeneID:4481094"
                     /translation="MDQRGGTMSRSASLFQQAAGLIPGGVNSPVRAFKSVGGIPPFIR
                     EAAGAMMTDEDGKSYIDYVGSWGPMILGHAPKEVVAAIQQAAVRGCSFGAPTSNEILL
                     AQKLIELVPSLEMVRLVNSGTEATMSALRLARAATGRDAILKFDGCYHGHADSLLVAA
                     GSGLATFGVPSSPGVTRGTAKDTLTVPFNDLAAVEACFAQHPEGIAAVIVEPVAGNMG
                     CVLPRPGYLKGLRDICTKYGTILIFDEVMTGFRVDLRCAQGFYDVTPDLTCLGKVIGG
                     GLPVGAYGGKMELMNQVSPAGPVYQAGTLSGNPLATAAGLATLEAISQPGFYETLTSR
                     TQRLTVGIGKALDEAGIPHVSYHIGSMFGLFFTDAREVYNFADAAKNDHNRFKDWFHC
                     MLEEGVYFAPSPYEAGFVSIAHDEAIIDLTIEKARKVAKTL"
     misc_feature    96429..97706
                     /locus_tag="Mmc1_0093"
                     /note="glutamate-1-semialdehyde aminotransferase;
                     Provisional; Region: PRK00062"
                     /db_xref="CDD:234607"
     misc_feature    96447..97694
                     /locus_tag="Mmc1_0093"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(96768..96776,96852..96857,96861..96863,97038..97040,
                     97137..97139,97143..97148,97221..97223)
                     /locus_tag="Mmc1_0093"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(96771..96776,96852..96857,97038..97040,97137..97139,
                     97146..97148,97221..97223)
                     /locus_tag="Mmc1_0093"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    97221..97223
                     /locus_tag="Mmc1_0093"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(97882..99483)
                     /locus_tag="Mmc1_0094"
                     /db_xref="GeneID:4481095"
     CDS             complement(97882..99483)
                     /locus_tag="Mmc1_0094"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864029.1"
                     /db_xref="GI:117923412"
                     /db_xref="GeneID:4481095"
                     /translation="MNQRNHFRLHDPSIPTYVRRLIPSKRATTLKRGEGGALEGKWQK
                     VTLWDLSAGGYSFVFPEESLRPGDKMEVRIAIAQVEEVPPMQMRSMIVGGRNHDKFGA
                     YRYFCKFDSMRPNEAETLARHIQNRQRLQLMEESQKNWEEDAEWEAQANAWDEQALTP
                     EGTDDQQTDENAKPKKKRAFRFGQALPTVAMEKTEDAPAQPPPKKDRAFDRVDEVIPF
                     VWRKITPAEYAEAETLFQAGQPLPQAFKSGYQPINVDPLKRCWAVIQVQSPGAAMNLQ
                     KLWQRIDSLCAQVSANKKVNLFVPLRDQLVKTTNLLVNHNMVSAAQTETLDRIETILA
                     DVVSDHGRATAESRKQRRELVKRVRDDVRNLKRSGTSQSDGIPELFERLTDVIDKINI
                     FGYDHVFGHAPQDLNLSGGGIAFVEEASKSASQSLLKRSDKEEGGSEIVSLKRGDCVV
                     VRVGLHADPWRWVFAYGKIVMVKSLSRRASAQMDKDGGILPPRRVAVEFTLIGKEDVQ
                     ALIAATHSKQLDERRKAYAEDDQIY"
     misc_feature    complement(99112..99480)
                     /locus_tag="Mmc1_0094"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     misc_feature    complement(98185..98364)
                     /locus_tag="Mmc1_0094"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:266524"
     gene            99703..100650
                     /locus_tag="Mmc1_0095"
                     /db_xref="GeneID:4481096"
     CDS             99703..100650
                     /locus_tag="Mmc1_0095"
                     /note="PFAM: beta-lactamase;
                     KEGG: tbd:Tbd_1103  hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_864030.1"
                     /db_xref="GI:117923413"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:4481096"
                     /translation="MRGRLIFCLLYFIMLPLHAGEKVRAYPPVQVADGVYVMHGPLGV
                     PSVANQGFMNNPAFIITQTGVVVIDPGSSVQAGRMVVEQIRTVTEKPVTHVLNTHVHG
                     DHWLGNHGIVEGYAGVQILAHPAMIEEALGSQAERWLEYMVKATEGFTQGTQAVIPTV
                     PVGDDTVLTLGGVRMEILAPPKAHSGTDMMIYLPSQRLLFTGDNVTSERFGRLDDGTF
                     KGGIAACDRALERPVEVVVPGHGATGGVGLIAVYRTYLRTLYDTVKVLYDEGTLDTPH
                     AMKPRVVEALSVYHDWVDFDEMVGRHISAAFQQVEASEF"
     misc_feature    99874..100422
                     /locus_tag="Mmc1_0095"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(100922..101356)
                     /locus_tag="Mmc1_0096"
                     /db_xref="GeneID:4481097"
     CDS             complement(100922..101356)
                     /locus_tag="Mmc1_0096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864031.1"
                     /db_xref="GI:117923414"
                     /db_xref="GeneID:4481097"
                     /translation="MGAVWVPTTVCSIKPVKTQGSHRFRPAGGDFPLRVLLLIFWARP
                     SLRELSGLFLPLSNQRATLLIPYWGSLASFSKEAPIGDAKCPCGVSVRAVVGKWRGSP
                     PSHSVSKRGFHPSHLGPNRPPRWRVTSLPYAPYRTPTKPVLS"
     gene            101607..102569
                     /locus_tag="Mmc1_0097"
                     /db_xref="GeneID:4481098"
     CDS             101607..102569
                     /locus_tag="Mmc1_0097"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type;
                     SMART: ATPase AAA;
                     KEGG: mca:MCA1096 sigma-54-dependent transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent trancsriptional regulator"
                     /protein_id="YP_864032.1"
                     /db_xref="GI:117923415"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4481098"
                     /translation="MTPHDPKQEILTRTPEMESVMRAATLVAQTNVTVLITGESGTGK
                     ERIGHLVHAESRRNKGPWVPVNCAALQDNLAESELFGHVRGAFTGATDAHQGRVRASS
                     GGTLFLDEVGELSLPLQAKLLRLLENSECQVVGQAQPVRVDIRIVAATNVDLAQRVRE
                     GLFREDLFYRLNIAPLTLPPLRDRPRDIPLLMDHFLLEAAARFERKPPRFTSKALQQI
                     QNHRWPGNIRELLNFCTRMVIYHGGEEVDLPALPVELRGTVPEVASGSPFDLPSQGVD
                     LTAVERGLIKQALERATGNKSKAARLLGLTRDTLLYRLKKHTLD"
     misc_feature    101649..102125
                     /locus_tag="Mmc1_0097"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    101655..102557
                     /locus_tag="Mmc1_0097"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    101718..101741
                     /locus_tag="Mmc1_0097"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(101721..101744,101931..101933,102057..102059)
                     /locus_tag="Mmc1_0097"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    101919..101936
                     /locus_tag="Mmc1_0097"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    102114..102116
                     /locus_tag="Mmc1_0097"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    102435..102557
                     /locus_tag="Mmc1_0097"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(102678..103601)
                     /locus_tag="Mmc1_0098"
                     /db_xref="GeneID:4481099"
     CDS             complement(102678..103601)
                     /locus_tag="Mmc1_0098"
                     /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
                     protein; oxidoreductase FAD-binding domain protein;
                     KEGG: noc:Noc_0363 dihydroorotate dehydrogenase electron
                     transfer subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate oxidase B, electron transfer
                     subunit"
                     /protein_id="YP_864033.1"
                     /db_xref="GI:117923416"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="GeneID:4481099"
                     /translation="MSQAMRPKLCRETAQVVFNRALPGDQYVIRLRAPGLAQGCRPGH
                     FAQVDCGPTTTLPRPLSILDADAAAGTVDIFYKVVGRGTELMAQWQAGAEVTLMGPVG
                     RTFTLIDAPKRAVLIGGGVGAAPVDFLARTLAGRGVECTLFLGMESESPFVLEQAKQP
                     LPGVERSIILALAPLQGAGVRSRMAALTPRQGWFTGYVTDLAAAYLAALTDQQREETV
                     LYTCGPTPMMAAANRVAKRFALSGQASMEEHMACGFGGCAGCVAPIRVGGALGWNYRR
                     VCVDGPVFDLDEIAWEQMGYAPAPVQACGCP"
     misc_feature    complement(102729..103562)
                     /locus_tag="Mmc1_0098"
                     /note="2-polyprenylphenol hydroxylase and related
                     flavodoxin oxidoreductases [Coenzyme metabolism / Energy
                     production and conversion]; Region: UbiB; COG0543"
                     /db_xref="CDD:223617"
     misc_feature    complement(102747..103556)
                     /locus_tag="Mmc1_0098"
                     /note="FAD/NAD binding domain in the electron transfer
                     subunit of dihydroorotate dehydrogenase. Dihydroorotate
                     dehydrogenases (DHODs) catalyze the only redox reaction in
                     pyrimidine de novo biosynthesis. They catalyze the
                     oxidation of (S)-dihydroorotate to...; Region:
                     DHOD_e_trans; cd06218"
                     /db_xref="CDD:99814"
     misc_feature    complement(order(102855..102860,103239..103241,
                     103347..103355,103371..103379,103419..103430,
                     103434..103436))
                     /locus_tag="Mmc1_0098"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99814"
     misc_feature    complement(order(103419..103424,103428..103430))
                     /locus_tag="Mmc1_0098"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99814"
     misc_feature    complement(order(103296..103298,103302..103304,
                     103326..103328,103338..103340,103347..103349,
                     103356..103358))
                     /locus_tag="Mmc1_0098"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99814"
     misc_feature    complement(order(103227..103229,103233..103244,
                     103254..103256))
                     /locus_tag="Mmc1_0098"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99814"
     misc_feature    complement(order(102930..102935,103161..103169,
                     103236..103241))
                     /locus_tag="Mmc1_0098"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99814"
     misc_feature    complement(order(102768..102770,102822..102824,
                     102831..102833,102846..102848))
                     /locus_tag="Mmc1_0098"
                     /note="Iron coordination center [ion binding]; other site"
                     /db_xref="CDD:99814"
     gene            complement(103804..104160)
                     /locus_tag="Mmc1_0099"
                     /db_xref="GeneID:4481100"
     CDS             complement(103804..104160)
                     /locus_tag="Mmc1_0099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864034.1"
                     /db_xref="GI:117923417"
                     /db_xref="GeneID:4481100"
                     /translation="MSETQLVENKLITAYLPDDGSDKEVLKALHGKGIYTANSVGLRG
                     ISMLRPAKGKAGRLPESEAVKMVTVMVAGEEADEMFEFIFDKGHVGRQGGGFMFVSTL
                     SAATLFTLPEDVQAEH"
     gene            complement(104173..104538)
                     /locus_tag="Mmc1_0100"
                     /db_xref="GeneID:4481101"
     CDS             complement(104173..104538)
                     /locus_tag="Mmc1_0100"
                     /note="PFAM: nitrogen regulatory protein P-II;
                     KEGG: mma:MM0930 nitrogen regulatory protein P-II"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="YP_864035.1"
                     /db_xref="GI:117923418"
                     /db_xref="InterPro:IPR002187"
                     /db_xref="GeneID:4481101"
                     /translation="MSERNITYLTDVSLITCIVQRGLGDVIVKAAREAGAQGATVYYA
                     KGSGVRERLGALGVAVEVEKEVVNLVVSKEQQDLVFNSAYLAGNLDTPGMGFMYVTPL
                     EKAATYIPHEVIQRLQQAS"
     misc_feature    complement(<104395..104496)
                     /locus_tag="Mmc1_0100"
                     /note="Nitrogen regulatory protein P-II; Region: P-II;
                     cl00412"
                     /db_xref="CDD:260410"
     gene            complement(104535..106340)
                     /locus_tag="Mmc1_0101"
                     /db_xref="GeneID:4481102"
     CDS             complement(104535..106340)
                     /locus_tag="Mmc1_0101"
                     /note="PFAM: protein of unknown function DUF1538;
                     KEGG: wsu:WS0013 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864036.1"
                     /db_xref="GI:117923419"
                     /db_xref="InterPro:IPR011435"
                     /db_xref="GeneID:4481102"
                     /translation="MGQNYRYGDYQREATIERNEISYNNLTPKLERDEQGHYKPYSPP
                     PVKLRSVDVFKLLKPYISVRFMDQLKAVVPLAIYLALFQFFVLRQLVQDSFSITAGLF
                     AVCLGLMFFMEGLKLGLMPFGEVIGNTLPKKSPLPVVLLIAFLLGIGVTFAEPAIGAL
                     KQAGQIVSVERAPYLYTLLNDWSGVLVLVVGGGVGLAAILGTLRFLYGWSLKPMVYLS
                     LAPALALTMYASGNPELTKILGLAWDCGAVTTGPVTVPLVLSLGIGIAAAAGKGDSGL
                     SGFGIVTLASIFPIIGVLILSLVVANTVTPEEIIAAAKIASAAAPVGPAPWYESSPGV
                     EVILGIRAILPLVLFLYLVLRYLLKEQVKNAGEITYGITLTIVGMCVFNLGLTYGLSA
                     LGEQSGSLVPASFIEIKIAAAGMYTAYGPIYSAIVGMILSLGFAWVLGFGATLAEPAL
                     NALGATVENLTNGVFKKQTLMIAVSIGVAFGLAIGLAKLIFELPLQWLLIPSYALGII
                     LTYFSTEEFVNVAWDSAGVTTGPITVPLVLAMGLGFGNAVDALEGFGILSMASICPIL
                     SVLITGLWVRYRAKTQAKAATHAGSASPDKEVQTI"
     misc_feature    complement(105441..106118)
                     /locus_tag="Mmc1_0101"
                     /note="Protein of unknown function (DUF1538); Region:
                     DUF1538; pfam07556"
                     /db_xref="CDD:148909"
     misc_feature    complement(104616..105305)
                     /locus_tag="Mmc1_0101"
                     /note="Protein of unknown function (DUF1538); Region:
                     DUF1538; pfam07556"
                     /db_xref="CDD:148909"
     gene            complement(106509..107795)
                     /locus_tag="Mmc1_0102"
                     /db_xref="GeneID:4481103"
     CDS             complement(106509..107795)
                     /locus_tag="Mmc1_0102"
                     /EC_number="3.5.2.3"
                     /note="KEGG: gsu:GSU1272 dihydroorotase, multifunctional
                     complex type;
                     TIGRFAM: dihydroorotase;
                     PFAM: amidohydrolase; amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="YP_864037.1"
                     /db_xref="GI:117923420"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004722"
                     /db_xref="InterPro:IPR005847"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="GeneID:4481103"
                     /translation="MMRTESLFIRGARVVDPANERDEIADILIVDGVIREIGKLDAPA
                     HVPVIEADGLIAAPGLVDMHVHLREPGYEYKETIAGGTRAAAAGGVTSVAAMPNTKPV
                     NDDPSVTGYMLDKARVAGFANLFPIGAVSKGLQGKEITEMGLLQAAGCVAFSDDGLPI
                     MNSGLMRRALDYSRAFGGLIIQHAEDSGLVGCGCMNEGEVATRLGLSGICNAAEDILV
                     ERDIRLVELTGGRYHVAHISSAGAVASVAKAREKGLRVSCEAAPHHLVLNDTHVGNYD
                     TNAKMAPPLRNQRDVNAIQEALARGVISVIATDHAPHEEDSKRVPFCQAANGVVGLET
                     LLPITLELVEAGVLPLAKALAAISCNPARLLGMPRGTLSLNAVGDVVLFDPQQSWTVD
                     ALALHGSSKNTAFAGRQVKGRVKYTILAGRIVHQEA"
     misc_feature    complement(106515..107780)
                     /locus_tag="Mmc1_0102"
                     /note="dihydroorotase; Validated; Region: pyrC; PRK09357"
                     /db_xref="CDD:236479"
     misc_feature    complement(<107595..107771)
                     /locus_tag="Mmc1_0102"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(106545..107654)
                     /locus_tag="Mmc1_0102"
                     /note="Dihydroorotase (DHOase), subgroup IIa; DHOases
                     catalyze the reversible interconversion of carbamoyl
                     aspartate to dihydroorotate, a key reaction in pyrimidine
                     biosynthesis. This subgroup also contains proteins that
                     lack the active site, like unc-33, a C; Region:
                     DHOase_IIa; cd01317"
                     /db_xref="CDD:238642"
     misc_feature    complement(order(106869..106871,107088..107090,
                     107247..107249,107598..107600,107604..107606))
                     /locus_tag="Mmc1_0102"
                     /note="active site"
                     /db_xref="CDD:238642"
     gene            complement(107792..108781)
                     /locus_tag="Mmc1_0103"
                     /db_xref="GeneID:4481104"
     CDS             complement(107792..108781)
                     /locus_tag="Mmc1_0103"
                     /EC_number="2.1.3.2"
                     /note="TIGRFAM: aspartate carbamoyltransferase;
                     PFAM: aspartate/ornithine carbamoyltransferase,
                     Asp/Orn-binding region; aspartate/ornithine
                     carbamoyltransferase, carbamoyl-P binding domain;
                     KEGG: pca:Pcar_1615 aspartate carbamoyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="YP_864038.1"
                     /db_xref="GI:117923421"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="GeneID:4481104"
                     /translation="MDPEQNAWTRRHMLGMDGLARHEIGAILDSAQAFRDVNYREIKK
                     VPTLRGKTVINLFYENSTRTRTSFELAGKRMSADVINISASSSSAAKGETLLDTVATL
                     QAMRPDVVVLRHGDSGAPHFLARHLDAGIINAGDGQHEHPTQSLLDLLTIQDHLEEMG
                     KSSFEGMNVAICGDVLHSRVARSNAFALRTLGANVRFVGPPTLMPSEATKVFGVTVHH
                     NMEEGLRGVDVIIMLRLQLERMTSAYLPSVREYFAYWGLTRGRLELTQPHALVMHPGP
                     INRGVEIASDVADNPNRSVILEQVANGLAVRMAVLYHLCTGAARNSAQLGESL"
     misc_feature    complement(107831..108766)
                     /locus_tag="Mmc1_0103"
                     /note="aspartate carbamoyltransferase catalytic subunit;
                     Provisional; Region: pyrB; PRK00856"
                     /db_xref="CDD:234849"
     misc_feature    complement(108317..108751)
                     /locus_tag="Mmc1_0103"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    complement(107840..108289)
                     /locus_tag="Mmc1_0103"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            complement(108831..109379)
                     /locus_tag="Mmc1_0104"
                     /db_xref="GeneID:4481105"
     CDS             complement(108831..109379)
                     /locus_tag="Mmc1_0104"
                     /note="PFAM: phosphoribosyltransferase;
                     KEGG: dra:DR1110 pyrimidine operon regulatory protein
                     PyrR"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="YP_864039.1"
                     /db_xref="GI:117923422"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="GeneID:4481105"
                     /translation="MNAILENTLMTPDQIHQAITELAETILPSISDPTQWCVVGIRRG
                     GAVIAQQLRDSLSASLQVKLPIGFLDITFYRDDLSTIGPHPTVGATDLGLLDVEHARV
                     ILVDDILYSGRTVRAGLDALFAFGRPELVKLAVLVDRGHRQLPIQPDFCARQVPTELH
                     DNLKVVTHADQRLSLVHTRALP"
     misc_feature    complement(108924..109328)
                     /locus_tag="Mmc1_0104"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(108963..108965,109038..109052,
                     109056..109064,109248..109250,109254..109256))
                     /locus_tag="Mmc1_0104"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            109450..110055
                     /locus_tag="Mmc1_0105"
                     /db_xref="GeneID:4482200"
     CDS             109450..110055
                     /locus_tag="Mmc1_0105"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: pfl:PFL_0541 ADP-ribose pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_864040.1"
                     /db_xref="GI:117923423"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR004385"
                     /db_xref="GeneID:4482200"
                     /translation="MVKLLTLEPLSSGFLKVVRAVVDYQRSDGGRSGPHPLECVKRPP
                     AAVMIPYDPRRDELILVRQFRIGAYMEDSSRGWALEFPAGLCDQESDPMQTARRELLE
                     ETGYQAISVEPVMTFLVNPGFVSERIHLFLTIIDAEHPVALGGGLEHEQEDIQTLRVT
                     YDEALAMVADGRMDGGPPILALQWLTLNRARIRAEAAALHE"
     misc_feature    109453..110013
                     /locus_tag="Mmc1_0105"
                     /note="ADP-ribose pyrophosphatase NudF; Provisional;
                     Region: nudF; PRK10729"
                     /db_xref="CDD:182682"
     misc_feature    109573..110013
                     /locus_tag="Mmc1_0105"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    order(109573..109575,109579..109581,109633..109635,
                     109639..109641,109645..109647,109678..109680,
                     109795..109806,109810..109812,109816..109830,
                     109903..109908,109912..109914,109951..109956,
                     109975..109977,109987..109989,109996..109998,
                     110008..110013)
                     /locus_tag="Mmc1_0105"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(109582..109584,109642..109644,109702..109704,
                     109744..109746,109756..109758,109825..109827)
                     /locus_tag="Mmc1_0105"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    order(109642..109644,109696..109704,109744..109746,
                     109756..109758,109825..109827,109903..109905)
                     /locus_tag="Mmc1_0105"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    order(109699..109710,109714..109767)
                     /locus_tag="Mmc1_0105"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(109744..109746,109756..109758,109903..109905)
                     /locus_tag="Mmc1_0105"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            110180..111577
                     /locus_tag="Mmc1_0106"
                     /db_xref="GeneID:4482201"
     CDS             110180..111577
                     /locus_tag="Mmc1_0106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864041.1"
                     /db_xref="GI:117923424"
                     /db_xref="GeneID:4482201"
                     /translation="MHGSSPSVSLLRWLPALFLLVLGLVYLWLNLPEWSVKHYPDSNS
                     YLLLEKQTFIEALSHVRTMGYPAFAWALKTLTGSYAAVPVVQYVLHLLAALLLWYGLC
                     VYGLRPWSALVVTLPVLFANIIRYFSHALLSDALGATLVVVVVALLLLYIARPWQWGY
                     GVALAVAVFVAFQVRPANQVLVPMLVLVGGLLYGMRPARLRSDGAMGFWSMLGRLSAA
                     GFVPLLGFFTLRLLLVGHFGLVAATGIPLIGIAGSLITPDLLPQIREEVRPLAQTIVD
                     DREKDGMEVPFSTLGWIRYGEWYRQYDWNNYHNTVLAHARRMHNGNHVMADQSLQQLA
                     VQVLRLRFSYYAKWIMAAAGDALGVLLRRDFNLQLTGLLWLLAVLFYHTLRGMRVWRG
                     KPIVAARDAQAMWEISVVVVVGLLYAGMATLLVILTAPPIERYLQNTAIFLPGVVALL
                     AYIRVQEGWQLWRSS"
     gene            complement(111585..112298)
                     /locus_tag="Mmc1_0107"
                     /db_xref="GeneID:4482202"
     CDS             complement(111585..112298)
                     /locus_tag="Mmc1_0107"
                     /note="KEGG: pho:PH0433 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864042.1"
                     /db_xref="GI:117923425"
                     /db_xref="GeneID:4482202"
                     /translation="MNATPTITLCLLTFNELEGCRHDLPHLPLDHFDAVYALDGGSRD
                     GTDTFLREQGITVHTQQKAGYNAAYLEAFAHCQTDVLVLFHPKGCIDPQSVLNFKPLF
                     QAGNDLVIASRLGPGAHNEEDEQLLKPRKWFVQGISILAALLWRRDRGPHLWDVLHGM
                     RGMRVAAFHAIAPRDHGLSIDLEMVVRSYRLKLKRAAFPVHERTRLAGQTHFKALPTG
                     WKLLKYMASELCRPKTEPR"
     misc_feature    complement(111738..112184)
                     /locus_tag="Mmc1_0107"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     gene            complement(112295..113317)
                     /locus_tag="Mmc1_0108"
                     /db_xref="GeneID:4482203"
     CDS             complement(112295..113317)
                     /locus_tag="Mmc1_0108"
                     /note="KEGG: rpb:RPB_1530 conserved hypothetical protein
                     ZK105.3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864043.1"
                     /db_xref="GI:117923426"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4482203"
                     /translation="MKTTLIVTSIHAPNPVMHALAQGCQAAGYDFILAGDSKSPDSFA
                     LDGCHFLSLEQQRQSGFRLGLSSPIKHYARKNIAYLQAIAQGTQCILETDDDNWPRAA
                     FFAPRSRMVETVTVQQPGWLNVYGLFLQPDDHALPLWPRGLPLDAVRQSLPPLTAMQS
                     VDCPIQQGLADENPDVDAIYRLTLPLPRNFIADRQIALGEGVWSPFNSQNTLWWRDAF
                     PLLYLPATCSFRMTDIWRSFVAQRLAWSCGWRVLFFSPTVWQERNEHDLNRDFQDEVP
                     GYLHNAAIAAGLAQLNLPTGTAHLLDNLHTCYAWLVEQGHMQPLELSLLQDWIFDLTQ
                     CGWKAP"
     misc_feature    complement(<112298..112630)
                     /locus_tag="Mmc1_0108"
                     /note="Protein of unknown function, DUF288; Region:
                     DUF288; pfam03385"
                     /db_xref="CDD:251915"
     gene            113431..113673
                     /locus_tag="Mmc1_0109"
                     /db_xref="GeneID:4482204"
     CDS             113431..113673
                     /locus_tag="Mmc1_0109"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864044.1"
                     /db_xref="GI:117923427"
                     /db_xref="GeneID:4482204"
                     /translation="MSTPMGILFLSIATSGGWVAASQHDGGYRCWNRLPSNFIARCME
                     TLKCAEFGVMDGEAGVMQGHSRFSGRVGRSRSRMGG"
     gene            114158..115123
                     /locus_tag="Mmc1_0110"
                     /db_xref="GeneID:4482205"
     CDS             114158..115123
                     /locus_tag="Mmc1_0110"
                     /note="PFAM: permease;
                     KEGG: tbd:Tbd_1427  permease"
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="YP_864045.1"
                     /db_xref="GI:117923428"
                     /db_xref="InterPro:IPR005524"
                     /db_xref="GeneID:4482205"
                     /translation="MFYWFTELADALVFGLLGMDATTRAASALHFFIEDVAKIFFLLI
                     VIVFLLGFFRSLVSAERARRMIGGQSPWRSYPLAVALGAVTPFCSCSSVPLFIGFLEA
                     GIPLGVTMAFLITSPMINEVAVLMLASTMGWKMAAAYVVTGLVVGLAGGLVIAALKLE
                     HHVEAYVWQIRMGQAALPEVDATWRGRLRYAAGQVREIVGRIWPYVLGGIGVGALLHG
                     FVPEHFFLQYAGADNPWAVPVAVLAGIPLYSNATGVIPVAEALLAKGVPIGTALALMM
                     SVAAISLPEMIILRKVIKLPLIAIFVAWLFVAFVVVGYLFNAWFA"
     misc_feature    114239..115108
                     /locus_tag="Mmc1_0110"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0701"
                     /db_xref="CDD:223773"
     gene            115146..115379
                     /locus_tag="Mmc1_0111"
                     /db_xref="GeneID:4482206"
     CDS             115146..115379
                     /locus_tag="Mmc1_0111"
                     /note="KEGG: rpd:RPD_3416 thiol-disulfide isomerase and
                     thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase and thioredoxins"
                     /protein_id="YP_864046.1"
                     /db_xref="GI:117923429"
                     /db_xref="GeneID:4482206"
                     /translation="MKEIKVLGSGCKNCETTARIITAQAERMGVAIRLEKVTDMAVIL
                     GYGVMSTPGVVVDGRVVHAGGLPGPDDVTAWLS"
     misc_feature    115149..115376
                     /locus_tag="Mmc1_0111"
                     /note="Thioredoxin domain; Region: Thioredoxin_3;
                     pfam13192"
                     /db_xref="CDD:257560"
     gene            115802..117094
                     /locus_tag="Mmc1_0112"
                     /db_xref="GeneID:4482207"
     CDS             115802..117094
                     /locus_tag="Mmc1_0112"
                     /note="KEGG: xcb:XC_3587 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864047.1"
                     /db_xref="GI:117923430"
                     /db_xref="GeneID:4482207"
                     /translation="MAKIEGFRIKNFRALKDVTLGRLWNQQQADPLTSMTAVIGKNGV
                     GKSTLFDAFGFLSDALKSGVEEACDSRGRGGFERIRAQGQKGSIEFEVYYKEDGNARP
                     ITYEISIDVDSSGRPYVLKERLRQRRKGQKHGWPFSFLVLNSGKGVVWKGDQEGRQID
                     EEQGDFDLLGLMESIKSGEAKEESKETDVVELDDMRKLGIATLGSLKQHPRISAFRKF
                     IEGWYLSYFTPDAARSLPLAGPQKHLNIHGDNLGNVVQFMEREHPKRFQAILNRIAEK
                     IPGINKIDTEKTNDGRLLLRFNDRGFQDPFYSQQMSDGTLKVFAYLLLLEDPTPPPFL
                     CIEEPENGLYHKLLESLVNEFRDHATGRKGGSQVFITTHQPYLVDALESKEVWILEKG
                     SDGYSVIRRASNDAIVENMVAAGLPLGGLWYSDYLDAR"
     misc_feature    115808..117004
                     /locus_tag="Mmc1_0112"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG4637"
                     /db_xref="CDD:226984"
     misc_feature    115811..>115966
                     /locus_tag="Mmc1_0112"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    115904..>116143
                     /locus_tag="Mmc1_0112"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     misc_feature    115919..115942
                     /locus_tag="Mmc1_0112"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(115928..115933,115937..115945)
                     /locus_tag="Mmc1_0112"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    116549..116938
                     /locus_tag="Mmc1_0112"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     gene            117099..117803
                     /locus_tag="Mmc1_0113"
                     /db_xref="GeneID:4482208"
     CDS             117099..117803
                     /locus_tag="Mmc1_0113"
                     /note="KEGG: cte:CT0910 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864048.1"
                     /db_xref="GI:117923431"
                     /db_xref="GeneID:4482208"
                     /translation="MHFEILVEDQSGKKALDILVPKIIGDDHTFNVHFYKGIGRIPKN
                     LGNKADASKRILLDQFPKLLRGYGNTFAKYPADYPAAVILVCDLDDKCLKAFRQELFN
                     ILNACDPQPETRFCVAIEEGEAWFLGDIPAVKSAYPKAKDAVLNAYVNDSICGTWERL
                     AEAVYTGGSTALSEKGWQAVGAEKSQWAEKISPHMDVTNNASPSFAYFRQKLLELAGA
                     RGVPGGSSGDIYGPTP"
     misc_feature    117114..117743
                     /locus_tag="Mmc1_0113"
                     /note="Domain of unknown function (DUF4276); Region:
                     DUF4276; pfam14103"
                     /db_xref="CDD:258322"
     gene            complement(118084..118248)
                     /locus_tag="Mmc1_0114"
                     /pseudo
                     /db_xref="GeneID:4482209"
     gene            complement(118245..118673)
                     /locus_tag="Mmc1_0115"
                     /pseudo
                     /db_xref="GeneID:4482210"
     gene            118832..120241
                     /locus_tag="Mmc1_0116"
                     /db_xref="GeneID:4482211"
     CDS             118832..120241
                     /locus_tag="Mmc1_0116"
                     /note="KEGG: dsy:DSY3991 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864049.1"
                     /db_xref="GI:117923432"
                     /db_xref="GeneID:4482211"
                     /translation="MIFNRPLPFISAFVEEIDGALREQHTHSVGMSVCQRSWFGFCIM
                     AIMLTNSICWAQFERAGLGRYGLGALAWMFRSSKIPWERLFQMSVRVVLRRHGITHGV
                     LVVDDTDKRRAKVTTRISHVHKMRDKSSGGYLFGQQIVFLLLVADMVTIPVGFAFYRP
                     DPARTVWRKEVKAQKRKGILKSKRPVEPARNPDYPTKPELALRLLRQFKQWHAVVQVK
                     AILADALYGAADFVDQGSSLYAGIQCVSQLRKNQKVRFLSRDLTVEEFFQRYPGVTGR
                     LPVRGGENRAIVFRSARIHVKAHGVKRFVIALKYDGEQDYRYLFASDLTWRTEDILKV
                     FTLRWLIEVFFQDWKAHEGWGNLTKLQGDEGSSQGLILSLMVDHCLLVQPDQLAQLKH
                     KQPAFTVGSLINHIKADNLVALIHDLLNANAPEQELTQLADVLAKQFRLNLSEKHMVG
                     RDLGRQAPSASLKYKTALA"
     misc_feature    <119237..>119521
                     /locus_tag="Mmc1_0116"
                     /note="DDE superfamily endonuclease; Region: DDE_5;
                     cl17874"
                     /db_xref="CDD:266901"
     gene            complement(120076..121734)
                     /locus_tag="Mmc1_0117"
                     /db_xref="GeneID:4482212"
     CDS             complement(120076..121734)
                     /locus_tag="Mmc1_0117"
                     /note="KEGG: tbd:Tbd_0555  nitric oxide reductase
                     activation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide reductase activation protein"
                     /protein_id="YP_864050.1"
                     /db_xref="GI:117923433"
                     /db_xref="GeneID:4482212"
                     /translation="MEELVGHAWDRLITAKLKSRHPEAAVRLEHLERRVGILFRSAGG
                     NPALEIKGVPDHYHGGKRGFWRRLAGVERHYPMAWRDQDHLYLPERIDLFPKAELNGD
                     LYRWWAYLLPLTPPISGNPAVWFGNARTATHVLLSHFPTLEPLYVRLVSAHLEQRPVI
                     AASNAALQASERQLRLALLQPHREIAPPPMLSVLWPIPLWPHPEPPQSSTTTPSLEEA
                     RHPKGGSQNMGAEEQRLRKRGQRSEQQEREDGLMIYRFEALLSWAEMIHINRPSDEEE
                     DAQSAKRASRDMDTLTLTRGGDAPAKSIRFDLDLPAPALDDRPLGPGVHLPEWDYKRA
                     RLLPDHCLLQLMETENVSPQPLPVHLRRVSRRIQGQITHWKPDGVWLRRREEGTELDL
                     EACLEHAVNRRCGQGPAEAGLWRDYLRGSRDLSTLLLADLSLSTDAWVNDEQRVIDVI
                     RDALFIFAEALAATGDAFSLYGFSSKKRDHIRFNSMFKFSALDSRSRCHANAVLYLSD
                     ADGACRPRSRPTMCFSERFSLNCLASTSANWVNSCSGAFAFNRS"
     misc_feature    complement(120268..121734)
                     /locus_tag="Mmc1_0117"
                     /note="Nitric oxide reductase activation protein
                     [Inorganic ion transport and metabolism]; Region: NorD;
                     COG4548"
                     /db_xref="CDD:226921"
     misc_feature    complement(<120250..120465)
                     /locus_tag="Mmc1_0117"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     gene            complement(121739..122698)
                     /locus_tag="Mmc1_0118"
                     /db_xref="GeneID:4482213"
     CDS             complement(121739..122698)
                     /locus_tag="Mmc1_0118"
                     /note="KEGG: tbd:Tbd_0556 iron-sulfur cluster-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster-binding protein"
                     /protein_id="YP_864051.1"
                     /db_xref="GI:117923434"
                     /db_xref="GeneID:4482213"
                     /translation="MNHASQPSYHPQPTRLHRIQFNRRLTRTAFFTLFLVAPTLDLFR
                     IDLANGHLVLFWHRFTPGVGSFLHEAATSPLAAAMGIALYLLLPVATVIVTVLWISRR
                     WGRLYCGWLCPHFTVVEWINGLMEKALGKPTLWEPTPMGRRTSRAWLLIMLLSGAAMG
                     LLWAVSLITYVLPPQMIFEHIWHGTLTFAQGLFIAVASVVFFIDFIFARHLFCRFGCA
                     VGLAQSLAWMSNPAALSPFLNSRERGSCSGCPAPCVTGCPMRLDPRGGKRRISTCTQC
                     GICVQGCADISQVRAKNAPLIWTHGAAVSARPTSLFIHKGTEE"
     misc_feature    complement(121844..122656)
                     /locus_tag="Mmc1_0118"
                     /note="quinol dehydrogenase membrane component;
                     Provisional; Region: napH; PRK09477"
                     /db_xref="CDD:236535"
     misc_feature    complement(122303..122446)
                     /locus_tag="Mmc1_0118"
                     /note="4Fe-4S binding domain; Region: Fer4_5; pfam12801"
                     /db_xref="CDD:257308"
     gene            complement(122737..123549)
                     /locus_tag="Mmc1_0119"
                     /db_xref="GeneID:4482214"
     CDS             complement(122737..123549)
                     /locus_tag="Mmc1_0119"
                     /note="PFAM: ATPase associated with various cellular
                     activities, AAA_5; CbbQ/NirQ/NorQ C-terminal domain
                     protein;
                     KEGG: tbd:Tbd_0558  nitric oxide reductase activation
                     protein NorQ"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_864052.1"
                     /db_xref="GI:117923435"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013615"
                     /db_xref="GeneID:4482214"
                     /translation="MDASTPSTESSTTQPLYRPVGQEIELFEYAYKHQLPLLVKGPTG
                     CGKTRFIRHMAHRLKRPLFTVACHDDLTAADLVGRHLIGPDGGAHWHDGPLTRAVRAG
                     GICYLDEVVEARKDTTVILHPLADDRRQLPIERTGETLDAPPEFMLVVSYNPGYQNLM
                     KGMKPSTRQRFVALRFDFPPAPVETRVLIDETGIAPHIAQRLITLGTALRALGEVDLE
                     EGVSTRLLIYAARLIQGGFPLLAACRSALAESLSDDPEVIAALMEVIEVHMG"
     misc_feature    complement(122746..123507)
                     /locus_tag="Mmc1_0119"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    complement(<123220..123492)
                     /locus_tag="Mmc1_0119"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(123406..123429)
                     /locus_tag="Mmc1_0119"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(123226..123228,123403..123426))
                     /locus_tag="Mmc1_0119"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(123223..123240)
                     /locus_tag="Mmc1_0119"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(122743..123000)
                     /locus_tag="Mmc1_0119"
                     /note="CbbQ/NirQ/NorQ C-terminal; Region: CbbQ_C;
                     pfam08406"
                     /db_xref="CDD:149460"
     gene            complement(123629..125011)
                     /locus_tag="Mmc1_0120"
                     /db_xref="GeneID:4482215"
     CDS             complement(123629..125011)
                     /locus_tag="Mmc1_0120"
                     /note="PFAM: cytochrome C oxidase subunit I;
                     KEGG: hch:HCH_04410 nitric oxide reductase large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit I"
                     /protein_id="YP_864053.1"
                     /db_xref="GI:117923436"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="GeneID:4482215"
                     /translation="MTYQSQSVARLYFIGALGLFVGQILFGLVLGTQYVIGDFLFPEI
                     PFNVARMVHSNLLIVWLLFGFMGASYYLVPEESETELWSPLLAKLLFWVFLVAGALTI
                     LGYLLVPYAKLAELTHNDLLPTMGREFLEQPTITKIGIVIVVLGFILNIGMTMLKGRK
                     TSISIVLLTGLIGLAVMFLFSFYNPSNLVLDKFYWWWVVHLWVEGVWELILGAILAFV
                     LIKVTGVDREVIEKWLYLIIAMTLITGILGTGHHYYWIGTQEYWQWVGSLFSALEPIP
                     FFMMVLFAFNMINKRRRNHPNKAATLWAMGTAVMAFLGAGVWGFLHTLAPVNYLTHGT
                     QITAAHGHMAFYGAYVMIVLTIISYAMPYLRGHGPTSGERAQIWEMWGFWLMTIAMVF
                     ITLFLTGAGILQTYMQRMGDDPGAFMDVQEKIAFFYWLRLAAGFVFMGGLVVYLMSFF
                     KGKPGQTENA"
     misc_feature    complement(123647..>125011)
                     /locus_tag="Mmc1_0120"
                     /note="Heme-copper oxidase subunit I.  Heme-copper
                     oxidases are transmembrane protein complexes in the
                     respiratory chains of prokaryotes and mitochondria which
                     catalyze the reduction of O2 and simultaneously pump
                     protons across the membrane.  The superfamily is...;
                     Region: Heme_Cu_Oxidase_I; cl00275"
                     /db_xref="CDD:260317"
     misc_feature    complement(123698..124999)
                     /locus_tag="Mmc1_0120"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    complement(order(124637..124639,124691..124693,
                     124709..124714,124886..124888,124889..124891,
                     124913..124915,124922..124924))
                     /locus_tag="Mmc1_0120"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    complement(order(123713..123715,123785..123790,
                     123974..123979,123986..123988,124007..124009,
                     124808..124810))
                     /locus_tag="Mmc1_0120"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238461"
     misc_feature    complement(order(123788..123790,124013..124018,
                     124028..124030,124433..124438))
                     /locus_tag="Mmc1_0120"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    complement(order(123992..123994,124256..124261,
                     124412..124414))
                     /locus_tag="Mmc1_0120"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238461"
     misc_feature    complement(order(124163..124165,124172..124174,
                     124256..124261,124370..124372,124397..124399,
                     124412..124414))
                     /locus_tag="Mmc1_0120"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    complement(order(123785..123790,124013..124018,
                     124256..124258))
                     /locus_tag="Mmc1_0120"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238461"
     gene            complement(125025..125465)
                     /locus_tag="Mmc1_0121"
                     /db_xref="GeneID:4482216"
     CDS             complement(125025..125465)
                     /locus_tag="Mmc1_0121"
                     /note="PFAM: cytochrome C, class I;
                     KEGG: hch:HCH_04411 cytochrome C, mono- and diheme
                     variants"
                     /codon_start=1
                     /transl_table=11
                     /product="nitric-oxide reductase"
                     /protein_id="YP_864054.1"
                     /db_xref="GI:117923437"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4482216"
                     /translation="MNEKMTISMARNIFFGGSLFFVLVFLGLTLGTMRSLPERDHREN
                     ITPQVALGKKVWEDNNCVGCHTLLGEGAYFAPELGNVYLRRGGKDGGIDFIKDWIRAQ
                     PSGVEGRRQMPQFNLTEEELDAVATFLKWTSEINTAGWPPNIEG"
     misc_feature    complement(125076..125321)
                     /locus_tag="Mmc1_0121"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            complement(126903..127619)
                     /locus_tag="Mmc1_0122"
                     /db_xref="GeneID:4481011"
     CDS             complement(126903..127619)
                     /locus_tag="Mmc1_0122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864055.1"
                     /db_xref="GI:117923438"
                     /db_xref="GeneID:4481011"
                     /translation="MPCGLLDAYITACYAVRNTSFREVKTMKRFIAVLIAVAALTGCA
                     GGIKGVSNSNLYGKLPPGGTFALQLISGDSLIGRKIERMISHQISKQGYRPTDSSPDI
                     LVSYAFDVHSAGSVSSAYTSINTVPQKSFVYGNTIYTKPSTSTATTSVSTTKLYQKTI
                     VVRISDARTGEKLWESNVSEQGWCNQIFVTAPSILALMFEGFPHEQTNVNKMVTHADP
                     AAKELMNLFPESTNWGCTRT"
     misc_feature    complement(127011..127409)
                     /locus_tag="Mmc1_0122"
                     /note="Domain of unknown function (DUF4136); Region:
                     DUF4136; pfam13590"
                     /db_xref="CDD:257905"
     gene            127974..128348
                     /locus_tag="Mmc1_0123"
                     /db_xref="GeneID:4481012"
     CDS             127974..128348
                     /locus_tag="Mmc1_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864056.1"
                     /db_xref="GI:117923439"
                     /db_xref="GeneID:4481012"
                     /translation="MTVNNHQNSNKKQSSDIMNGPASLLDDVYISSTSKTSASSAAKS
                     GLGKTTQSAKVKLDLAHSKSALAKGGAFAGGSSAKWASGLILAAPAFAAGMLVGVGCV
                     CLHYAGSRSNRRSYAQSVAIPS"
     gene            128914..131037
                     /locus_tag="Mmc1_0124"
                     /db_xref="GeneID:4481013"
     CDS             128914..131037
                     /locus_tag="Mmc1_0124"
                     /note="TIGRFAM: translation elongation factor G; small
                     GTP-binding protein;
                     PFAM: elongation factor G domain protein; protein
                     synthesis factor, GTP-binding; elongation factor G, domain
                     IV;
                     KEGG: gsu:GSU1933 translation elongation factor G"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor G"
                     /protein_id="YP_864057.1"
                     /db_xref="GI:117923440"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="GeneID:4481013"
                     /translation="MCEDVLPHYFDAEGEKGMTESQITRIRNVALMAHGGGGATTLAE
                     TLFYNAGVIPKRGTVEGKNTVLRSEPEELERGLTIAPQIGHFQWKGVEINIIDTPGYI
                     DFIEHTRAVLNVVGGAVLVYSGASGVKTENTRFWSMIQEAQVPGIGFINKMDKPRADF
                     IRVLGEIEQDLQVTTLPVTIPIGQGESFAGIVDLIPMTAWSAKDGVFTQIEMPDSVKQ
                     DVAYYRTQLIEKIIETDDELLEAYLENETLPTEEQLHERLKEAVLTRRLLPIFCGSGG
                     ANIGVRALANGISQYLPSPIDKAAIKPLIGVNPNNRDQEIARSVSEEDPFSAVVFKTA
                     IDPFSGKLSVVRVFSGTLQADSALLNGTRDLKEKGGHLYLLEGNDMTQVDVLKAGQIG
                     AIARLAHTHTGDTLCDISAPIHYHRVRYQEPVFSYAVEVETKMEDKVATGLAKLCDED
                     PTLHFYRDEDTHEMILAGMGQTHLAVTLDRLQRKYGGKASLKVPKVAYRETITRACRV
                     QGKLKKQSGGRGQFGDCWIEVEPLPRGAGFVFEDRVVGGVIPRNFIPSVEKGVVEAMN
                     KGVVGGYPVVDVQVNLVDGSHHSVDSSDNAFRTAGSMAFRSAMEQGGAVLLEPLMSME
                     ISVPDEVMGDVIGDMNSRRGKITGVTPRGNGQTIHCETPMSEILDYGNSLNAMTSGRG
                     IYTMRLANYQEVPSHIARKVLEQQN"
     misc_feature    128995..129798
                     /locus_tag="Mmc1_0124"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cl17170"
                     /db_xref="CDD:266525"
     misc_feature    129007..131025
                     /locus_tag="Mmc1_0124"
                     /note="elongation factor G; Reviewed; Region: PRK12740"
                     /db_xref="CDD:237186"
     misc_feature    129010..129033
                     /locus_tag="Mmc1_0124"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(129016..129036,129211..129213,129364..129369,
                     129373..129375,129733..129741)
                     /locus_tag="Mmc1_0124"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    129142..129144
                     /locus_tag="Mmc1_0124"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    129157..129165
                     /locus_tag="Mmc1_0124"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    129202..129213
                     /locus_tag="Mmc1_0124"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(129208..129213,129259..129264)
                     /locus_tag="Mmc1_0124"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    129364..129375
                     /locus_tag="Mmc1_0124"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    129733..129741
                     /locus_tag="Mmc1_0124"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    129802..>129891
                     /locus_tag="Mmc1_0124"
                     /note="Catalytic NodB homology domain of the carbohydrate
                     esterase 4 superfamily; Region: CE4_SF; cl15692"
                     /db_xref="CDD:265761"
     misc_feature    129889..130137
                     /locus_tag="Mmc1_0124"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    130177..130371
                     /locus_tag="Mmc1_0124"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    130405..130752
                     /locus_tag="Mmc1_0124"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    130765..130998
                     /locus_tag="Mmc1_0124"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            131289..131552
                     /locus_tag="Mmc1_0125"
                     /db_xref="GeneID:4481014"
     CDS             131289..131552
                     /locus_tag="Mmc1_0125"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864058.1"
                     /db_xref="GI:117923441"
                     /db_xref="GeneID:4481014"
                     /translation="MADKRTRDLFFFSLNDAKECVMRPFDSYPGMVSILDVPQRRSQE
                     STQRGTFRGVVAGQPHLSRGGRGDFQTILQQTLNKAGKRSDEY"
     gene            131620..132234
                     /locus_tag="Mmc1_0126"
                     /db_xref="GeneID:4481015"
     CDS             131620..132234
                     /locus_tag="Mmc1_0126"
                     /note="KEGG: ilo:IL1814 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864059.1"
                     /db_xref="GI:117923442"
                     /db_xref="GeneID:4481015"
                     /translation="MAEIQATQVEMAYLTAVRNQQTAGSAVKSPTTETKTATDVLTLA
                     QRMRVVASDAADFSSPQDMVAYANQRLQESLQQELERGMGSFKNSEALAAFQEMRGVT
                     DPGQTAGFIVSQVSSYFGNYLDNHTDVSFEENLQGFRELVDGAIDKGFSQAQAFLGEA
                     VDLFEGIQRMLEETRQKINEKLGQFVEMQRRDQQAPSGEPVVDA"
     gene            133279..134679
                     /locus_tag="Mmc1_0127"
                     /db_xref="GeneID:4481016"
     CDS             133279..134679
                     /locus_tag="Mmc1_0127"
                     /note="PFAM: peptidase M16 domain protein;
                     KEGG: pca:Pcar_3059 peptidase, M16 family"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16 domain-containing protein"
                     /protein_id="YP_864060.1"
                     /db_xref="GI:117923443"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="GeneID:4481016"
                     /translation="MGSFSINQESSPLHPMDMEAFSLAHPLTEPHYGTSQLDNGLTVV
                     SFPMPWLHEVGVTILARSGSRFERDREAGIAHFLEHMLFKGTKRIPDPTELHTQLEAL
                     AADMNAATGPETNLYWLNVPLIHLEESLSLFAELFTEPALLGIENERQVILAEMREDE
                     NEAGENTHPFVMASGQLWKNHPLERSVLGTRETVENVEVADLHRYLQKHYRGDNMAVA
                     FFGPVEHAHVHALAEKTLGALAAGPGEPTPPPPPMPAGPHWLAVNDPTAQLSLSLFFR
                     CAGQQEPNRFYPTAAMRRLLDDGFASRLQAEVREKEGLVYDLWAAYSAYTDTGTLEIG
                     ASVSPENLEVLFHNLIQQLHKLRTEPAGQEEWLRLKTRWYAALGSSLDRPSELVERYV
                     SDQLFHCVEPVTESWQRVLQLTPEQVQFQAELLLRPENLVVVLVGPNAEKHRKKLKAR
                     FSETLASWHISSPWQG"
     misc_feature    133324..134622
                     /locus_tag="Mmc1_0127"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    133432..133851
                     /locus_tag="Mmc1_0127"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    133864..134394
                     /locus_tag="Mmc1_0127"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(134709..135095)
                     /locus_tag="Mmc1_0128"
                     /db_xref="GeneID:4481017"
     CDS             complement(134709..135095)
                     /locus_tag="Mmc1_0128"
                     /note="PFAM: protein of unknown function DUF486;
                     KEGG: neu:NE1692 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864061.1"
                     /db_xref="GI:117923444"
                     /db_xref="InterPro:IPR007437"
                     /db_xref="GeneID:4481017"
                     /translation="MADCSLMMVWMTMNTLLQTILLLVASNVFMTFAWYAHLKHLDAK
                     PWYIAAGISWGIAFLEYMLQVPANRIGFTVLSLPQLKILQEVITLTVFVPFAVFYMHQ
                     PLKLDFLWAGLCLVGAVYFMFRGALS"
     misc_feature    complement(134721..135059)
                     /locus_tag="Mmc1_0128"
                     /note="Protein of unknown function, DUF486; Region:
                     DUF486; cl01236"
                     /db_xref="CDD:242381"
     gene            complement(135318..136931)
                     /locus_tag="Mmc1_0129"
                     /db_xref="GeneID:4481018"
     CDS             complement(135318..136931)
                     /locus_tag="Mmc1_0129"
                     /note="TIGRFAM: type I restriction-modification system, M
                     subunit;
                     PFAM: N-6 DNA methylase;
                     KEGG: noc:Noc_0439 type I restriction-modification system
                     M subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system, M
                     subunit"
                     /protein_id="YP_864062.1"
                     /db_xref="GI:117923445"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR003356"
                     /db_xref="InterPro:IPR004546"
                     /db_xref="GeneID:4481018"
                     /translation="MTKEELSQLGKTLWAIADDLRGAMNADDFRDYMLSFLFLRYLSD
                     NYEAAAKKELGPDYPKLQEDDRRTPLAVWYAANTEDIPDLEKQMRRKMHYVIHPDYLW
                     SSIYERARTQDAELLQTLQRGFKYIENESFASAFQGLFSELNLHSEKLGRTPVDRNKK
                     LCAIITKVAEGIAQFSTDSDILGDAYEYLIGQFAAGSGKKAGEFYTPQSLSTILSRIV
                     TLDSQEPATGKKRKLSCVLDFACGSGSLLLNVRKQMGTHGIGMIYGQEKNITTYNLAR
                     MNMLLHGVKDSGFQIHHGDSLINDWDMLSEMNPAKKVKCDAIVANPPFSYRWEPNEAL
                     GEDFRFKSHGLAPKSAADFAFLLHGFHFLSDEGTMAIILPHGVLFRGGVESRIRTKLL
                     KDGHIDTVIGLPANLFFSTGIPVCILVLKKCKKPDDVLFINASEYFEKGKRQNQLLPE
                     HIDNIVETYQYRKEEERYARRVEMAEIEKNDYNLNISRYVSTAMSEQQIDLGAVNHKL
                     VALEEKIVAATQKHNGFLEELGLPPLPLG"
     misc_feature    complement(136428..136907)
                     /locus_tag="Mmc1_0129"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     misc_feature    complement(135453..136403)
                     /locus_tag="Mmc1_0129"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
                     /db_xref="CDD:251262"
     misc_feature    complement(135807..136226)
                     /locus_tag="Mmc1_0129"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     gene            complement(136928..138028)
                     /locus_tag="Mmc1_0130"
                     /db_xref="GeneID:4481019"
     CDS             complement(136928..138028)
                     /locus_tag="Mmc1_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="anticodon nuclease"
                     /protein_id="YP_864063.1"
                     /db_xref="GI:117923446"
                     /db_xref="GeneID:4481019"
                     /translation="MNAPQTFASLDALARHLRERLDKKYVLLFAFNGTGKTRLSMAFK
                     DMGKETVEDDEGNEVTTRDTLYFNAFTEDLFHWDNDRRVLRMHTDSRFFDGLQELEME
                     SRIRPLLARYADIDFLIDYATSEITFFREKDADGAPIPIKVSRGEENIFVWCFFLAVA
                     QLAVDGQESYRWVKYLYIDDPISSLDDNNAIAVASHLAQLLKKSDGQIRTVISTHHHL
                     FFNVMGNELKPAQYFLSKEDGQFLLKNTGKTPRFHHIALLKELNAVVESGQIFTYHFN
                     ILRNILEKTATFHGFQHFSACIQQFSDDEDGILRERMIQLFSHGNYSLFEPQEMMPEN
                     KEYFRKILRDFMNNYRFNPELFPEPPQESVTP"
     misc_feature    complement(137003..>137599)
                     /locus_tag="Mmc1_0130"
                     /note="AAA domain; Region: AAA_13; pfam13166"
                     /db_xref="CDD:257537"
     gene            complement(138025..139032)
                     /locus_tag="Mmc1_0131"
                     /db_xref="GeneID:4481020"
     CDS             complement(138025..139032)
                     /locus_tag="Mmc1_0131"
                     /note="KEGG: eba:ebA2608 DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="YP_864064.1"
                     /db_xref="GI:117923447"
                     /db_xref="GeneID:4481020"
                     /translation="MSGLILYTTEDGQSRIQLRADGQTVWLTQLEMAELFQTSKQNIA
                     KHLKAIFAEAELSAEAVVNHWLTTAADGKNYRIAHYNLDAILAVGYRVRSPRGAQFRR
                     WASTVLGEYLKKGFVMDDERLKNPDGRPDYFDEMLARIRDIRASEKRFYQKVRDLFAL
                     SSDYDKSDRAAQQFFATVQNLLLHAVTGQTAAELVSARANPADPHFGLLNWKGARVRK
                     QDILVAKNYLTEDEIDTLNRLVVIFLETAELRAKRQTQTSMAFWRDNVGLIITNNGFP
                     LLSNAGSISHERMEQQVDKQFQDYDQQRKAQEAQAADAQDEAELKALERRIKNRKGRA
                     S"
     misc_feature    complement(138118..138858)
                     /locus_tag="Mmc1_0131"
                     /note="Virulence protein RhuM family; Region:
                     Virulence_RhuM; pfam13310"
                     /db_xref="CDD:257647"
     gene            complement(139029..140312)
                     /locus_tag="Mmc1_0132"
                     /db_xref="GeneID:4481021"
     CDS             complement(139029..140312)
                     /locus_tag="Mmc1_0132"
                     /note="PFAM: restriction modification system DNA
                     specificity domain;
                     KEGG: sab:SAB0265 type-I specificity determinant subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="restriction modification system DNA specificity
                     subunit"
                     /protein_id="YP_864065.1"
                     /db_xref="GI:117923448"
                     /db_xref="InterPro:IPR000055"
                     /db_xref="GeneID:4481021"
                     /translation="MSKAMKDEKKALVPRLRFPEFRDAGEWEKTTIGEIGKFYYGKSA
                     PKWSLEEDAPTPCVRYGELYTKFGPIITETYSRTNIDPGKLRFSKGGEILVPRVGEKT
                     EDFGKCCCYLPLGDIAIGEMISVFETAQNPLFYTYYFRRLYRQFSKVVEGQNVKNLYY
                     VELEPLEIYRPPLTEQQKIADCLSSLDALIAAQADKIDALKTHKKGLIQQLFPREGKT
                     VPRLRFPEFQEAGEWTEHRLENMAKRGSGHTPNKKFPSYYNGGIKWVSLADSNKLDDG
                     YIYDTKVEISDDGINNSSAVLYPAGTVILSRDAGVGKSAVLYSPMAVSQHFMAWQCYE
                     NMLSNWFFYYLLQKLKATFESIAVGNAIKTIGAAYFKEMTITAPSLPEQQKIADCLVS
                     LDGMIAAHTEKLDSLKTHKNGLMQQLFPSPEAVEA"
     misc_feature    complement(139710..140237)
                     /locus_tag="Mmc1_0132"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     misc_feature    complement(139056..140234)
                     /locus_tag="Mmc1_0132"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    complement(139089..139619)
                     /locus_tag="Mmc1_0132"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            complement(140391..141236)
                     /gene="dinD"
                     /locus_tag="Mmc1_0133"
                     /db_xref="GeneID:4481022"
     CDS             complement(140391..141236)
                     /gene="dinD"
                     /locus_tag="Mmc1_0133"
                     /note="KEGG: cch:Cag_1524 DNA-damage-inducible protein D"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein D"
                     /protein_id="YP_864066.1"
                     /db_xref="GI:117923449"
                     /db_xref="GeneID:4481022"
                     /translation="MKHELVHTLTESFEGHAQETENGVEYWLARDLQHLLGYTKWENF
                     LNVISKAKTACEVTGHDIADHFADVGKMVELGSGSQREISDIMLTRYACYLTAQNGDS
                     AKQPIAFAQTYFAMQTRKAELIEQRLLEAERVSARKKLSTTEKELSDVIFEQAGGNQN
                     FALIHSKGDTALFGKNTKAMKAQWRVPDNRPLADFAPTIILKAKDFATEITIHNAREH
                     NMRSERQISGEHVTNNEAVRQTLLDRGIRPESLSPAEDVKKVERRLASAEKKALKNPD
                     GLEDK"
     misc_feature    complement(140412..141221)
                     /gene="dinD"
                     /locus_tag="Mmc1_0133"
                     /note="DNA-damage-inducible protein D; Provisional;
                     Region: dinD; PRK11525"
                     /db_xref="CDD:183178"
     misc_feature    complement(140892..141179)
                     /gene="dinD"
                     /locus_tag="Mmc1_0133"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:251333"
     gene            complement(141254..144301)
                     /locus_tag="Mmc1_0134"
                     /db_xref="GeneID:4481023"
     CDS             complement(141254..144301)
                     /locus_tag="Mmc1_0134"
                     /note="KEGG: mfa:Mfla_1215 type I site-specific
                     deoxyribonuclease, HsdR family;
                     TIGRFAM: type I site-specific deoxyribonuclease, HsdR
                     family;
                     PFAM: type III restriction enzyme, res subunit; protein of
                     unknown function DUF450;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="HsdR family type I site-specific
                     deoxyribonuclease"
                     /protein_id="YP_864067.1"
                     /db_xref="GI:117923450"
                     /db_xref="InterPro:IPR004473"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR007409"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="REBASE:MspMCORF129P"
                     /db_xref="GeneID:4481023"
                     /translation="MIGIDSMTEQQIEQDFITKLGELKYSFRKDIRDRASLENNFREK
                     FNALNRVRLTDAEFTRLRDEIITADVFQAAKTLREYGYIEREDGTPLDYMLVNLKDWC
                     KNEFEVIHQLRINTDNSHHRYDVILLINGLPLVQIELKSLGINPRRAMEQIIEYRNDS
                     GTGYANTLLCFMQLFIVSNRDDTWYFTNNHNQHFAFNAEERFLPIYQWADKDNRKVCH
                     LDDFAEKFLAKCTLGQMISRYMVLVVSEQKLLIMRPYQIYAVQAIVDCIHQNRGNGYI
                     WHTTGSGKTLTSFKASTLLKDNLDIEKCLFVVDRKDLDRQTRIEFNRFQEGCVEENTN
                     TETLVRRLLSEDYAHKVIVTTIQKLGLALDETGNKAQQYKEKGKPTFKERLAPLRDQR
                     IIIIFDECHRSQFGENHKAIKEFFPKAQLFGFTGTPIFEQNASYTQVDGELASHKTTE
                     EIFEKRLHAYTITHAIDDRNVLRFHIDYFKPEAASPAGDKAKANTTSLTRPETQRLVV
                     DTILKKHDAATDHRRFNALLATASINDAINYYELFKQAQAERREEDPDFIPLHIACVF
                     SPPAEGNKDVKQLQEDLPQEKDDNQQEPERKKAALQQIIADYNTQYGTNHKLGEFDLY
                     YQDVQLRIKDQKYPNSDFLRKNKIDLTIVVDMLLTGFDAQYLNTLYVDKNLKHHGLIQ
                     ALSRTNRMLNDTKPYGNILDFRAQKGAVDEAIALFSGEDVTRSREIWLVDPAPKVIDK
                     LDSAVKRLEAFMQAQGQPCTPAAVNDLKGDVARAEFINCFKEVQRLKTQLDQYTDLSD
                     AQKQQIEQYLPAEQLRGFKGMYLETAQRLKAQQGKSGIEASEAKDAIEQLDFEFVLFS
                     SAMIDYDYIMGLVSRFTQQLPGKQSMSRDQIINLLATNSNLMAEREEITAYIKTLEEG
                     QGRSVEAIRDGYQSFKAHKAEGELAALAQRHGLERDALQGLVVGILDRMIFDGEQLND
                     LFAPLELGWKDRSKAELALMEELVPLLKKQAGGREISGLAAYE"
     misc_feature    complement(141314..144289)
                     /locus_tag="Mmc1_0134"
                     /note="Type I site-specific restriction-modification
                     system, R (restriction) subunit and related helicases
                     [Defense mechanisms]; Region: COG0610"
                     /db_xref="CDD:223683"
     misc_feature    complement(143735..>144007)
                     /locus_tag="Mmc1_0134"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:252519"
     misc_feature    complement(143018..143485)
                     /locus_tag="Mmc1_0134"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(143447..143461)
                     /locus_tag="Mmc1_0134"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(143099..143110)
                     /locus_tag="Mmc1_0134"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(141299..142120)
                     /locus_tag="Mmc1_0134"
                     /note="Type I restriction and modification enzyme -
                     subunit R C terminal; Region: EcoR124_C; pfam12008"
                     /db_xref="CDD:256796"
     gene            complement(144686..145177)
                     /locus_tag="Mmc1_0135"
                     /db_xref="GeneID:4481024"
     CDS             complement(144686..145177)
                     /locus_tag="Mmc1_0135"
                     /note="TIGRFAM: methylated-DNA--protein-cysteine
                     methyltransferase;
                     PFAM: methylated-DNA-[protein]-cysteine
                     S-methyltransferase;
                     KEGG: rru:Rru_A3621 methylated-DNA-(protein)-cysteine
                     S-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="YP_864068.1"
                     /db_xref="GI:117923451"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="GeneID:4481024"
                     /translation="MSFLPYDSQVGMLWLEIRQGALVALSWSLPDSMAEPLEDAALCR
                     RITHWLDDHFRRAPRGVDFPVRPAGTVFQQKVWREISRVGPGQTITYGELAKRLNSSA
                     RAVGVAAGQNPIPVVIPCHRVVGAKELGGYSGHGGLHTKRTLLSLEGALIGDIGIPFR
                     QAC"
     misc_feature    complement(144728..>145078)
                     /locus_tag="Mmc1_0135"
                     /note="Methylated DNA-protein cysteine methyltransferase
                     [DNA replication, recombination, and repair]; Region: Ada;
                     COG0350"
                     /db_xref="CDD:223427"
     misc_feature    complement(144731..144964)
                     /locus_tag="Mmc1_0135"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    complement(order(144785..144787,144803..144805,
                     144818..144820,144842..144844,144848..144853,
                     144860..144862,144866..144871,144875..144877,
                     144878..144880,144902..144907,144959..144964))
                     /locus_tag="Mmc1_0135"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    complement(order(144734..144736,144809..144811,
                     144815..144820,144905..144907))
                     /locus_tag="Mmc1_0135"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            complement(145506..145715)
                     /locus_tag="Mmc1_0136"
                     /db_xref="GeneID:4481025"
     CDS             complement(145506..145715)
                     /locus_tag="Mmc1_0136"
                     /note="PFAM: ribosomal protein L31;
                     KEGG: gme:Gmet_0377 ribosomal protein L31"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="YP_864069.1"
                     /db_xref="GI:117923452"
                     /db_xref="InterPro:IPR002150"
                     /db_xref="GeneID:4481025"
                     /translation="MKEGIHPKYEEATFTCASCSNEIKTRSTAGDLTLGICSECHPFY
                     TGKHKLVDTAGRVERFRRKYGMQDQ"
     misc_feature    complement(145509..145715)
                     /locus_tag="Mmc1_0136"
                     /note="50S ribosomal protein L31; Reviewed; Region: rpmE;
                     PRK00019"
                     /db_xref="CDD:234576"
     gene            complement(145879..147144)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /db_xref="GeneID:4481026"
     CDS             complement(145879..147144)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="YP_864070.1"
                     /db_xref="GI:117923453"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004665"
                     /db_xref="InterPro:IPR011112"
                     /db_xref="InterPro:IPR011113"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR013223"
                     /db_xref="GeneID:4481026"
                     /translation="MCTLMNLKDLKAMNASQLSEIAEERKIENYSGMRRQELIYALLK
                     TESENNGQIYGEGVLEVLQDGFGFLRAPDTNYLPGPDDIYVSPSQIRRFGLRTGDVVE
                     GQIRAPKESERYFALLRVERINYEDPLKARNKILFDNLTPLYPDERLKMEIADESSNL
                     EARVMDLIVPIGKGQRGLIVAQPRTGKTMLMQKIAHSIAENHPDTVLLVLLIDERPEE
                     VTDMKRSVKGEVVSSTFDEPATRHVQVAEMVLEKAKRLVEHKRDVVILLDSITRLARA
                     YNTVAPSSGKVLSGGIDANALQRPKRFFGAARNVEEGGSLTILATALVDTGSRMDEVI
                     FEEFKGTGNMEVHLDRKLVEKRTFPAIDIAKSGTRKEELLTERDELSKLWVLRRILLP
                     MGPLDSMSFLLDKLRATKDNSEFFESMNG"
     misc_feature    complement(145882..147132)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="transcription termination factor Rho; Provisional;
                     Region: rho; PRK09376"
                     /db_xref="CDD:236490"
     misc_feature    complement(146992..147120)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="Rho termination factor, N-terminal domain; Region:
                     Rho_N; pfam07498"
                     /db_xref="CDD:254238"
     misc_feature    complement(146782..146982)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="Rho_CSD: Rho protein cold-shock domain (CSD). Rho
                     protein is a transcription termination factor in most
                     bacteria. In bacteria, there are two distinct mechanisms
                     for mRNA transcription termination. In intrinsic
                     termination, RNA polymerase and nascent mRNA...; Region:
                     Rho_CSD; cd04459"
                     /db_xref="CDD:239906"
     misc_feature    complement(order(146803..146811,146818..146820,
                     146893..146895,146899..146901,146935..146937,
                     146941..146943,146947..146949,146959..146961,
                     146965..146967))
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239906"
     misc_feature    complement(145924..146670)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="Transcription termination factor rho is a bacterial
                     ATP-dependent RNA/DNA helicase. It is a homohexamer. Each
                     monomer consists of an N-terminal domain of the OB fold,
                     which is responsible for binding to cysteine rich
                     nucleotides. This alignment is of the...; Region:
                     rho_factor; cd01128"
                     /db_xref="CDD:238548"
     misc_feature    complement(order(145981..145983,145993..145995,
                     146035..146040,146110..146112,146116..146130,
                     146134..146139,146212..146214,146221..146223,
                     146230..146232,146239..146244,146251..146253,
                     146284..146286,146617..146619))
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238548"
     misc_feature    complement(146581..146604)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238548"
     misc_feature    complement(order(146071..146073,146578..146589,
                     146593..146595))
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238548"
     misc_feature    complement(146341..146355)
                     /gene="rho"
                     /locus_tag="Mmc1_0137"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238548"
     gene            147442..148494
                     /locus_tag="Mmc1_0138"
                     /db_xref="GeneID:4481027"
     CDS             147442..148494
                     /locus_tag="Mmc1_0138"
                     /EC_number="4.2.1.70"
                     /note="PFAM: tRNA pseudouridine synthase D, TruD;
                     KEGG: dge:Dgeo_0594 pseudouridylate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridylate synthase"
                     /protein_id="YP_864071.1"
                     /db_xref="GI:117923454"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="GeneID:4481027"
                     /translation="MNHEISDIQPHLPKLTSQPGLGGQLKQQPEDFLVEELRPNPLSG
                     EGEHWIVRIIKRDLTTDQVAAWLAKRFAVPQKDVGFAGQKDRQAVTIQDFSVYLPGQA
                     PPQGWADDPLPGITIHSVGRDRRKIKPGMLSGNRFVIRLRGCDGALSASQRQQLADAT
                     QARLLRYGAPNYFGPQRFGRDGDNWQAGLKLLRAGRKRRKGNRNTEALQISAVRSELF
                     NRVVTARLQQGLFNTLLLGDVVQLAGRTAAFRVEDLAAEQPRFDAVQIHPTGPLFGRD
                     MLAPTGQAAEIEAAIAQAEPEAIELLEQFDMQGVRKSLRLIPGELSHHWEQADLIVTF
                     TLPRGCFATSIMREYM"
     misc_feature    147508..148491
                     /locus_tag="Mmc1_0138"
                     /note="Pseudouridine synthase, similar to Escherichia coli
                     TruD; Region: PseudoU_synth_EcTruD; cd02575"
                     /db_xref="CDD:211340"
     misc_feature    147535..147555
                     /locus_tag="Mmc1_0138"
                     /note="Permutation of conserved domain; other site"
                     /db_xref="CDD:211340"
     misc_feature    147685..147696
                     /locus_tag="Mmc1_0138"
                     /note="active site"
                     /db_xref="CDD:211340"
     gene            complement(148539..149393)
                     /locus_tag="Mmc1_0139"
                     /db_xref="GeneID:4481028"
     CDS             complement(148539..149393)
                     /locus_tag="Mmc1_0139"
                     /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
                     protein; oxidoreductase FAD-binding domain protein;
                     KEGG: plt:Plut_0809 2-polyprenylphenol hydroxylase and
                     related flavodoxin oxidoreductase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD/NAD(P)-binding subunit"
                     /protein_id="YP_864072.1"
                     /db_xref="GI:117923455"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="GeneID:4481028"
                     /translation="MDHAYQGELCMSTANDYNATVVERLDITPNLMIIRVKPDVTPFP
                     FLAGQFAILGLQRNAPRIPEADPEEVPEDKALRLVRRAYSISSGSHETHLEFYISLVQ
                     SGELTPRLFALAVGERLFLGKSASGHFTLDRVPPGHNILMVSTGTGLAPYISMVRTMA
                     LGIGCPITPMAVVHGASYSWDLGYRTELEGLNRQCDHFRYVPVVSRPQDDKDWSGRTG
                     RLNVWVENKKALEEACGFPVDPAHTHIFLCGNPGMIEFTEKYFVEQCGYDAGSKKEPG
                     NLHAEKYW"
     misc_feature    complement(148542..149354)
                     /locus_tag="Mmc1_0139"
                     /note="ferredoxin-NADP reductase; Provisional; Region:
                     PRK10926"
                     /db_xref="CDD:182844"
     misc_feature    complement(148545..149336)
                     /locus_tag="Mmc1_0139"
                     /note="Ferredoxin-NADP+ (oxido)reductase is an
                     FAD-containing enzyme that catalyzes the reversible
                     electron transfer between NADP(H) and electron carrier
                     proteins such as ferredoxin and flavodoxin. Isoforms of
                     these flavoproteins (i.e. having a non-covalently...;
                     Region: FNR1; cd06195"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(148545..148547,148953..148955,
                     149073..149078,149082..149084,149091..149093,
                     149097..149099,149103..149105,149142..149153,
                     149244..149246))
                     /locus_tag="Mmc1_0139"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(149142..149147,149151..149153))
                     /locus_tag="Mmc1_0139"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(149013..149015,149019..149021,
                     149046..149048,149064..149066,149073..149075,
                     149082..149084))
                     /locus_tag="Mmc1_0139"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(148941..148943,148947..148958,
                     148968..148970))
                     /locus_tag="Mmc1_0139"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(148644..148649,148863..148871,
                     148950..148955))
                     /locus_tag="Mmc1_0139"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     gene            149649..150197
                     /locus_tag="Mmc1_0140"
                     /db_xref="GeneID:4480994"
     CDS             149649..150197
                     /locus_tag="Mmc1_0140"
                     /note="KEGG: sdy:SDY_3404 stringent starvation protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864073.1"
                     /db_xref="GI:117923456"
                     /db_xref="GeneID:4480994"
                     /translation="MVTTDQPSKPDIIRYLLEQEGRVMLCVDATQERVEVPRRFANDN
                     SLRLVLNRQMPQTIHVGEDALESELRFGGIPHYCIIPYETLWGAFNPDTGHGMLWPDT
                     MPNEVRQNYWLSQALRQEGGFEMPEGALKQLQKLREEQAAASGRPQLQVVPSDGPASP
                     PAHPTDQEPPPERRKPTLRLVK"
     misc_feature    149667..150194
                     /locus_tag="Mmc1_0140"
                     /note="Stringent starvation protein B; Region: SspB;
                     cl01120"
                     /db_xref="CDD:260796"
     gene            150542..151063
                     /locus_tag="Mmc1_0141"
                     /db_xref="GeneID:4480995"
     CDS             150542..151063
                     /locus_tag="Mmc1_0141"
                     /note="KEGG: sru:SRU_1567 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864074.1"
                     /db_xref="GI:117923457"
                     /db_xref="GeneID:4480995"
                     /translation="MLKKIISGGQTGVDRGALDAALSQGLLCGGWVPANRRAEDGPIP
                     PRYPVRALVRGGYLVRNRLNVQDSDATLIITDGALSGGTARSVEFARRLGRPFLVLQI
                     TRCLQDADLLIKLCQWLKVYDVQVLNVAGPRESRKPGIYQLTRQFLVQLIKRSQDPCP
                     LDQPYEGTPHNAL"
     misc_feature    150554..151000
                     /locus_tag="Mmc1_0141"
                     /note="Putative molybdenum carrier; Region: MoCo_carrier;
                     pfam12694"
                     /db_xref="CDD:257228"
     gene            151501..152022
                     /locus_tag="Mmc1_0142"
                     /db_xref="GeneID:4480996"
     CDS             151501..152022
                     /locus_tag="Mmc1_0142"
                     /EC_number="3.5.1.88"
                     /note="KEGG: rru:Rru_A3350 peptide deformylase;
                     TIGRFAM: peptide deformylase;
                     PFAM: formylmethionine deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_864075.1"
                     /db_xref="GI:117923458"
                     /db_xref="InterPro:IPR000181"
                     /db_xref="GeneID:4480996"
                     /translation="MAILPIVTAPDPVLKKRAEPVVAVDASIQQLMRDMLETMYAAPG
                     IGLAAPQVGVSKRVIVVDVTYSEAAAQDGEPYCLANPEIIAAEGEITWEEGCLSVPES
                     YGKVDRKEHVVVRGLNAQGELVTLEAHGLFAVCLQHEIDHLDGTLFIDHLSSLKRTMI
                     IKKLKKLKTEQAS"
     misc_feature    151516..151944
                     /locus_tag="Mmc1_0142"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    order(151630..151638,151651..151653,151783..151791,
                     151912..151917,151924..151926)
                     /locus_tag="Mmc1_0142"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    order(151636..151638,151651..151653,151789..151791,
                     151915..151917)
                     /locus_tag="Mmc1_0142"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    order(151786..151788,151912..151914,151924..151926)
                     /locus_tag="Mmc1_0142"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            152019..152957
                     /locus_tag="Mmc1_0143"
                     /db_xref="GeneID:4480997"
     CDS             152019..152957
                     /locus_tag="Mmc1_0143"
                     /EC_number="2.1.2.9"
                     /note="TIGRFAM: methionyl-tRNA formyltransferase;
                     PFAM: formyl transferase domain protein;
                     KEGG: ppu:PP0067 methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_864076.1"
                     /db_xref="GI:117923459"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="GeneID:4480997"
                     /translation="MTAWRVVFMGTPDFATGTLQALLDGPDTVVAVFTQPDKPVGRGM
                     KMQKTPVKQLAEQHGIPVYQPNRLREAEAVTALRALRPDVVVVVAYGQILSREVLEIP
                     THGCINVHASLLPRWRGAAPIQRAILAGDAQSGVTIMAMEEGLDTGPMYSTVVQSIDN
                     HTTGGQLHDQLMAAGGGLLVETLARIKHEGLTPQIQPEQGVTYAAKLKKEEGLVDWSQ
                     PAIQIQRAVQAFDPWPCAFTLWQGKPLKLFAASVVVGHGTPGEVIEVEKDGFVVACGD
                     GALRVAQVQAAGKKRMSSGEWLRGHGVKQGERLGEG"
     misc_feature    152028..152639
                     /locus_tag="Mmc1_0143"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    152031..152948
                     /locus_tag="Mmc1_0143"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    order(152046..152048,152058..152063,152277..152300,
                     152313..152315,152340..152351,152373..152375,
                     152433..152435,152439..152444,152451..152456)
                     /locus_tag="Mmc1_0143"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    order(152049..152054,152058..152060,152121..152123,
                     152133..152135,152139..152150,152280..152291,
                     152340..152342,152346..152351,152373..152381,
                     152634..152636)
                     /locus_tag="Mmc1_0143"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    order(152277..152279,152286..152288,152292..152300,
                     152313..152315,152340..152342,152439..152444,
                     152451..152456)
                     /locus_tag="Mmc1_0143"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    order(152340..152342,152346..152348,152454..152456)
                     /locus_tag="Mmc1_0143"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    152646..152897
                     /locus_tag="Mmc1_0143"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    order(152715..152717,152748..152750,152754..152756,
                     152871..152873,152877..152879,152883..152888,
                     152892..152894)
                     /locus_tag="Mmc1_0143"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            153069..153914
                     /locus_tag="Mmc1_0144"
                     /db_xref="GeneID:4480998"
     CDS             153069..153914
                     /locus_tag="Mmc1_0144"
                     /note="PFAM: peptidase M48, Ste24p;
                     KEGG: cvi:CV4263 heat shock protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HtpX-2 peptidase"
                     /protein_id="YP_864077.1"
                     /db_xref="GI:117923460"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:4480998"
                     /translation="MNTMKTAMLLAALTALFMMIGFALGGQGGMLIALLFAGGMNLYA
                     YWNSDQMVLRMHNAQEVGPREAPELYGLVQSLAKRGKMPMPKVYVIHDPSPNAFATGR
                     DPEHAAVAATTGLMQILTREELAGVMAHELGHVMNRDTLISTISATFAGAITAIANMA
                     QFAAIFGNRDEEEGGGGPMGLIMMILAPIAAALIQMAISRTREYKADRVGAELCGNPL
                     WLASALHKLERGVQQIPSPVAQAHPEAAHLYICNPLAGGLGSLFSTHPPIPERIRKLQ
                     RMTGR"
     misc_feature    153069..153902
                     /locus_tag="Mmc1_0144"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     gene            complement(153996..154907)
                     /locus_tag="Mmc1_0145"
                     /db_xref="GeneID:4480999"
     CDS             complement(153996..154907)
                     /locus_tag="Mmc1_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864078.1"
                     /db_xref="GI:117923461"
                     /db_xref="GeneID:4480999"
                     /translation="MGQYLENRPRFGYGHPVHCDKRLLRVISFQRLMGYMGRWLHGVP
                     SQIGTQQDFQRRVKDLRGELDYLDSLGMVLPHVANRHNGLHGDPHHFTTFADALELTI
                     DTILGRITTRRADRYKSDDFSAYLALTLKEQQAGCLPTNRDGLHTLNIRARQLGCVLT
                     AMVTLLMTREQWRELFIYAYDDEQLGRYAHLEAQLTRGRQWIPDYLSYLGITGSYLLQ
                     RRLQRATTDPGLNGQDCQALIDRIHATGFDDERFLAQVNRARQTALHASHGCREFIMD
                     DAGGWQERVHGGHPGRAWTALVPYKTV"
     misc_feature    complement(154587..>154718)
                     /locus_tag="Mmc1_0145"
                     /note="superfamily containing globins and truncated
                     hemoglobins; Region: globin_like; cl00280"
                     /db_xref="CDD:260322"
     gene            complement(155144..156010)
                     /locus_tag="Mmc1_0146"
                     /db_xref="GeneID:4481000"
     CDS             complement(155144..156010)
                     /locus_tag="Mmc1_0146"
                     /note="PFAM: protein of unknown function DUF344;
                     KEGG: ana:alr2191 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864079.1"
                     /db_xref="GI:117923462"
                     /db_xref="InterPro:IPR005660"
                     /db_xref="GeneID:4481000"
                     /translation="MSKKDKKPEAQAAEAAPLIHTIDEKSEKKKKLDSKFYEKELVKL
                     QVELVKLQEWIKAEGLRVVVIFEGRDAAGKGGVIKRITERFNPRICRVVALGTPTERE
                     KTQWYFQRYVANLPAAGEMVLFDRSWYNRAGVERVMGFCTDEEYKEFLRSCPEFERML
                     VRSGIILIKYWFSVSDDEQERRFHARVEDPVKRWKLSPMDLESRQRWVEYSKAKDEMF
                     AHTDIKQAPWYVVNGEDKKRARLNCITHLLSMIPYQDLTPEPIKLPKRRANMLGYVRP
                     PKGEQTLIPEKY"
     misc_feature    complement(155231..155920)
                     /locus_tag="Mmc1_0146"
                     /note="polyphosphate kinase 2, PA0141 family; Region:
                     PPK2_P_aer; TIGR03707"
                     /db_xref="CDD:213852"
     gene            complement(156172..158757)
                     /locus_tag="Mmc1_0147"
                     /db_xref="GeneID:4481001"
     CDS             complement(156172..158757)
                     /locus_tag="Mmc1_0147"
                     /note="PFAM: ATPase AAA, central domain protein; Clp N
                     terminal domain protein; ATPase associated with various
                     cellular activities, AAA_5; ATPase AAA;
                     SMART: ATPase AAA;
                     KEGG: dsy:DSY1668 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_864080.1"
                     /db_xref="GI:117923463"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="GeneID:4481001"
                     /translation="MKQEQLTSKSAEALNSAVGLAAERNHQFVEPEHLLLAMLEQKDG
                     VIPALLIKMNTPLPALQQATSVAVENLPRVHGGGAAQTLPSRRLQSLWQDAEREAATL
                     RDDYTSTEHFLLAMTEHKEGALPSLLRPFTITRTRVLEALKTVRSGQRVTSKEPEGTF
                     QALEKYARDLTALAKSGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIV
                     EGLALRMERGDVPESLKGVRVVALDMGALVAGAKYRGEFEERLKAVIKEVQEAQGKII
                     LFIDEMHTIVGAGQSEGAMDAGNLLKPALARGDLHCVGATTLDEYRKHVEKDPALERR
                     FQPVQVREPSVEATISILRGIKDKYELHHGVRITDAAIVAAATLAHRYISDRFLPDKA
                     IDLVDEAAARIRMEITSKPQVLDSLDRQILQLQIEQSALSKEKDSASRERLTKLEAEL
                     ADLKENAHAMTIRWEQERLNIKQVGILKETLESTRLQLEQAERSGNLEKAGELRYGTL
                     PKLEQELQKAQELAAQSRENPLLKELVDEEEIATVVARWTGIPVARMLEGEKDKLLKM
                     EERLGHQVVGQERALQAIARAVRRARAGLQDNNRPIGSFFFLGPTGVGKTELSKALAQ
                     FLFNDESAMVRLDMSEYMEKHTVARLIGAPPGYVGYEEGGQLTEQVRRRPYSVVLLDE
                     VEKAHPDLFNTLLQVLDEGRLTDGHGRTVDFRNTVLIMTSNIGSHLMAEGGPTAQVEH
                     RVMELLKQTFRPEFLNRLDEIIPFHALQREHMGAIVDIQLKRLHKLLDKLNIRLELEP
                     AARAALAEEGYDPIYGARPLKRVMQRLVQDPLAEAMLSGHLHEGDRVVIHFDGEQFVI
                     NPVHR"
     misc_feature    complement(156193..158742)
                     /locus_tag="Mmc1_0147"
                     /note="ATP-dependent chaperone ClpB; Region:
                     chaperone_ClpB; TIGR03346"
                     /db_xref="CDD:234173"
     misc_feature    complement(158566..158709)
                     /locus_tag="Mmc1_0147"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    complement(158317..158475)
                     /locus_tag="Mmc1_0147"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    complement(157750..158211)
                     /locus_tag="Mmc1_0147"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(158113..158136)
                     /locus_tag="Mmc1_0147"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(157807..157809,157918..157920,
                     158110..158133))
                     /locus_tag="Mmc1_0147"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(157915..157932)
                     /locus_tag="Mmc1_0147"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(157756..157758)
                     /locus_tag="Mmc1_0147"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(156466..156963)
                     /locus_tag="Mmc1_0147"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(156910..156933)
                     /locus_tag="Mmc1_0147"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(156589..156591,156715..156717,
                     156907..156930))
                     /locus_tag="Mmc1_0147"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(156712..156729)
                     /locus_tag="Mmc1_0147"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(156487..156489)
                     /locus_tag="Mmc1_0147"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(156217..156459)
                     /locus_tag="Mmc1_0147"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            158901..159929
                     /locus_tag="Mmc1_0148"
                     /db_xref="GeneID:4481002"
     CDS             158901..159929
                     /locus_tag="Mmc1_0148"
                     /note="PFAM: polysaccharide deacetylase;
                     KEGG: dde:Dde_3250 polysaccharide deacetylase family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="YP_864081.1"
                     /db_xref="GI:117923464"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="GeneID:4481002"
                     /translation="MRHDGAQTPLVDPQPQAHASMLSTLHIVMYHYVRPLRQSRYPAI
                     KGLEKEAFLGQLDYIQRHYQVIGMEQLAAALVGAEPLPPRSALLTFDDGYLDHYLHVF
                     PHLLARGLTAAFFPPVCAVERRQLLDVNKIHFILASVADQDRLISALNQAIEAASAHY
                     GLASVAHYEATWKKPFGYDTAQVIYFKRMLQHVLPQALRQQITHDLFSQFVTQDETAF
                     AHELYMDSAQLRVMIQGGMHVGGHGDAHHWLNHLDAEAARQDIQKTRSFLDDLGASTP
                     IASFCYPYGGYNATTQQLLQEYGFSVAVTTEPLGVDLGRDTALSLPRLDTNVLPRQGD
                     ADYLQLAP"
     misc_feature    159159..159890
                     /locus_tag="Mmc1_0148"
                     /note="Catalytic NodB homology domain of the carbohydrate
                     esterase 4 superfamily; Region: CE4_SF; cl15692"
                     /db_xref="CDD:265761"
     gene            159960..160250
                     /locus_tag="Mmc1_0149"
                     /db_xref="GeneID:4481003"
     CDS             159960..160250
                     /locus_tag="Mmc1_0149"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864082.1"
                     /db_xref="GI:117923465"
                     /db_xref="GeneID:4481003"
                     /translation="MQQATIAAILAEAITELNRQLPAESRLQSQDSETILVGEGGVLD
                     SLSLITLFVAVEEQLQEQLDLSLSLLDAMADEGNMAHFHTLGRLTQWLVEQA"
     gene            160250..161941
                     /locus_tag="Mmc1_0150"
                     /db_xref="GeneID:4481004"
     CDS             160250..161941
                     /locus_tag="Mmc1_0150"
                     /note="TIGRFAM: HAD-superfamily phosphatase, subfamily
                     IIIC; FkbH like protein;
                     KEGG: rsp:RSP_1535 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FkbH-like protein"
                     /protein_id="YP_864083.1"
                     /db_xref="GI:117923466"
                     /db_xref="InterPro:IPR010033"
                     /db_xref="InterPro:IPR010037"
                     /db_xref="GeneID:4481004"
                     /translation="MVMAISKTPLTLISDFNLSVLARLLNHAQQDTPLEATLSPFGQP
                     YQTLAAPPEREDAVVMVWCRAEGVLPSFAQGLQFEAVDEQVLEGEVRHFAQQLRHHAT
                     QVKHLLVSSWVLPPQERGYGMLDWQPGLGLRYLLARANLLLAQQLADAANIHLLDTQA
                     WLQSAGNKAASPRMAYASKTPYGNGVFEAAAADILAVLDGLQGRSRRLVLVDLDDTLW
                     GGIIGETGWQGIRLGGHDHGGEAFQDFQRALKGLIKRGVLVGVVSKNTEEVALAAFEK
                     HPEMVLKKEDLAGWRINWQDKAQNVVELSQQINLGLQSVVFIDDNPAERGRVREALPQ
                     VLVPEWPKQPSEYAAFLRAMNCFELPALSDEDRQRAAMVRAERARQETKGTLANHGDW
                     LQSLGMQVRLSPITPVNLPRVEQLFNKTNQMNISTRRLSESQIHHWAQQPGHVLWAAS
                     VTDRFGDSGLTGILAVALEGEEAVITDLILSCRVMGRQVEHLLLHRGVAWAMAQGAKR
                     LVAHYRPTDRNAPCLSFLRGSGLTEAPEHTFSWSCVTPYPQPQHVMLEELPHVQG"
     misc_feature    <160484..>160639
                     /locus_tag="Mmc1_0150"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Csx10; Region: Csx10; cl17558"
                     /db_xref="CDD:248112"
     misc_feature    160868..161839
                     /locus_tag="Mmc1_0150"
                     /note="FkbH-like domain; Region: FkbH; TIGR01686"
                     /db_xref="CDD:233530"
     misc_feature    160868..161245
                     /locus_tag="Mmc1_0150"
                     /note="Acid Phosphatase; Region: Acid_PPase; cl17256"
                     /db_xref="CDD:266591"
     gene            161928..162956
                     /locus_tag="Mmc1_0151"
                     /db_xref="GeneID:4481005"
     CDS             161928..162956
                     /locus_tag="Mmc1_0151"
                     /note="KEGG: cjr:CJE1501 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864084.1"
                     /db_xref="GI:117923467"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:4481005"
                     /translation="MSKVEIRRCEMHERDAVMAFIDEHWSKGHIMGNHTGLFEWQHRG
                     VGRQGYDFMLAWRGSELLGVLGYITMTRFDAALAGRHGIWLALWKVREDCGVAGLGLA
                     LLRTLMQQEPHSWIGAVGINTAVMALYKALGFHTGQLSQYVLFHPTLVPQLAHRPRDF
                     VAPTVPLGDAQLVPLHAAALQAWPDLNGQAVPAKSNRYLQSRYLEHPYYDYQLFGVVR
                     GEQPVALLVARKVCHGGHCALRVVDYVGELHHLGACGGALSQQIVQQQCEYVDLWAHL
                     PDTTPLQQAGLHRVDAQGELMVPNYFEPFEARNVCIYYAFKGEAQHRIWRGDGDQDRP
                     NRLASTNK"
     gene            163172..163576
                     /locus_tag="Mmc1_0152"
                     /db_xref="GeneID:4481006"
     CDS             163172..163576
                     /locus_tag="Mmc1_0152"
                     /note="PFAM: sulfate transporter/antisigma-factor
                     antagonist STAS"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma-factor antagonist"
                     /protein_id="YP_864085.1"
                     /db_xref="GI:117923468"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR003658"
                     /db_xref="GeneID:4481006"
                     /translation="MSRAIDYDGWGTMIKTWNIKGKIHIQLDEPLNAKNQVAFLKAVE
                     THPQGEQVSLHMDLVPYIDSSGLASLLQLRDHAHGFHNVILCNPSERVLHTLRVSNFH
                     RLYTIQQSPKTAQSTATAASVQPMLNGGHNAL"
     misc_feature    163211..163492
                     /locus_tag="Mmc1_0152"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist) domain of anti-anti-sigma factors, key
                     regulators of anti-sigma factors by phosphorylation;
                     Region: STAS_anti-anti-sigma_factors; cd07043"
                     /db_xref="CDD:132914"
     misc_feature    order(163259..163261,163265..163273,163289..163291,
                     163352..163354,163358..163366,163370..163378,
                     163385..163390,163451..163453,163463..163468,
                     163472..163474)
                     /locus_tag="Mmc1_0152"
                     /note="anti sigma factor interaction site; other site"
                     /db_xref="CDD:132914"
     misc_feature    163361..163363
                     /locus_tag="Mmc1_0152"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:132914"
     gene            163846..164055
                     /locus_tag="Mmc1_0153"
                     /db_xref="GeneID:4481007"
     CDS             163846..164055
                     /locus_tag="Mmc1_0153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864086.1"
                     /db_xref="GI:117923469"
                     /db_xref="GeneID:4481007"
                     /translation="MANRVKRVEWINAEEADLFQYEDYLDAIMRPSERSLISGSQLPD
                     MLQGCEVLLRQAPCSTNRKSPFSTD"
     gene            164855..165130
                     /locus_tag="Mmc1_0154"
                     /db_xref="GeneID:4481008"
     CDS             164855..165130
                     /locus_tag="Mmc1_0154"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864087.1"
                     /db_xref="GI:117923470"
                     /db_xref="GeneID:4481008"
                     /translation="MHQSFMADAIARRRIFAQLNDPTLIELQELANSGQLQDAELRRL
                     DRIIAKLYDEAARLSGAQCQVDSHTPDNWFEDEDLFPPADAFEDDWS"
     gene            complement(165365..165859)
                     /locus_tag="Mmc1_0155"
                     /db_xref="GeneID:4481009"
     CDS             complement(165365..165859)
                     /locus_tag="Mmc1_0155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864088.1"
                     /db_xref="GI:117923471"
                     /db_xref="GeneID:4481009"
                     /translation="MPISTQKHSFINLLQAEHHELLTLLDAVDAHGVEHPFGFYGLQA
                     AEQLIKEHLLREIEFLYPFLRQSVAHDAQLIHELVLLETDMKSILHWVELFFETYAHS
                     TTHENLKIDYQKLKHAIQERIQLARERLLPLYQELTALTPAPHDRGLTTTINRDSSPH
                     THHC"
     gene            166168..167097
                     /locus_tag="Mmc1_0156"
                     /db_xref="GeneID:4481010"
     CDS             166168..167097
                     /locus_tag="Mmc1_0156"
                     /note="PFAM: type IV pilus assembly PilZ;
                     KEGG: dps:DP0663 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly PilZ"
                     /protein_id="YP_864089.1"
                     /db_xref="GI:117923472"
                     /db_xref="InterPro:IPR009875"
                     /db_xref="GeneID:4481010"
                     /translation="MSQPSTAPVKSKERITDKKVISLIKKALEEGSNLEVQVNNRSEV
                     LFTRFLDHPPQAVDGEVAEKSKYQPFSYLSAKDHLVIARVVPEESNENMVPGSLLRLR
                     FYNGKKAIESYVVLIEPIEIGGQHAYKLGFPTTMEAWDQRRHFRVKVIPELEIGIVEP
                     MKARIMDLSVGGMAICFPSDMEPIPAGTPMNFKIKVPPSLEVQHQHEIKTKSGLVMEL
                     PSNPDFELMGYVRNYGSANDQQICPKGQRCGVQFQISSALKAMQVGELYGFVEREFLR
                     KQALSKGDQGNFHAKSPHEGHSLLDKIKSALLG"
     misc_feature    166585..>166764
                     /locus_tag="Mmc1_0156"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            complement(167323..168606)
                     /locus_tag="Mmc1_0157"
                     /db_xref="GeneID:4481029"
     CDS             complement(167323..168606)
                     /locus_tag="Mmc1_0157"
                     /note="PFAM: nucleoside recognition domain protein;
                     KEGG: mag:amb1309 uncharacterized membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside recognition domain-containing
                     protein"
                     /protein_id="YP_864090.1"
                     /db_xref="GI:117923473"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="GeneID:4481029"
                     /translation="MNGIFIALIFIAFSMAAFNTLTGDATAMQALSTAMVDAAKSSVD
                     LALGLVGVMALFLGLMKVVEKGGLLTILAKLIRPLMIRLFPEIPPNHPAMGAMILNLA
                     ANALGLGNAATPFGIRAMQALDSLNPQKGTATNSMALFLAINTSSVTLLPTGVITLRA
                     AAGSLDPAAILPTTLFATICSTTVAILAARLYQRFSPAPTSQTNNAENITMDDSLSID
                     QKEMLQNSHTATSTTASYLFLAAILCLVPLTILYGKAISPWVMPGLMVGMLGFGMLRG
                     VKVYEAFIEGAKEGFDVALKIIPYLVAILVAVGMFRASGAMNLLIGLLSPITSWFGLP
                     AEALPMALLRPLSGSGAYGILADTIQNPAIGPDSYVGLLVSTLQGSTETTFYVLAVYF
                     GAVQIKRVRHALATALTADLAGILAAVFICHLLFA"
     misc_feature    complement(168025..168606)
                     /locus_tag="Mmc1_0157"
                     /note="Uncharacterized membrane protein, required for
                     spore maturation in B.subtilis. [General function
                     prediction only]; Region: SpmA; COG2715"
                     /db_xref="CDD:225336"
     misc_feature    complement(167326..167829)
                     /locus_tag="Mmc1_0157"
                     /note="Uncharacterized membrane protein [Function
                     unknown]; Region: SpmB; COG0700"
                     /db_xref="CDD:223772"
     gene            complement(169785..170987)
                     /locus_tag="Mmc1_0158"
                     /db_xref="GeneID:4481030"
     CDS             complement(169785..170987)
                     /locus_tag="Mmc1_0158"
                     /note="PFAM: hypothetical protein; Tetratricopeptide TPR_2
                     repeat protein;
                     SMART: hypothetical protein;
                     KEGG: ppr:PBPRA2447  N-acetylglucosaminyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864091.1"
                     /db_xref="GI:117923474"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4481030"
                     /translation="MRIDGVMTFSFFVEWAPWIVMGLILFGIGYRMGQHAPMEDMEEM
                     ARRRDAAFTYRGLNFLLNDEPDKAIEAFSQAVRVNSETVEVYLSLANLFLKQGELGRA
                     IRMHQNLLERPNLSRETRIAALYGLGEDYRKSGFVDRAVHAYHQTLEVDPGHLKALRA
                     LMTLHENEKRWDKALEMLERIRKVTGDEDPRRAAHLRVQIGREQLRHDVAPPSVEDAT
                     RNFERAIEVHPGCVEARRIMAEVALKGGDPGHAVDLLKELRHTRPGHMFLLVDILRRS
                     YDALEDRCGFESCMDEAAHAQSASPQLMVQWGKWLEAEGRLEEVSALLEMGLRRRPDS
                     AVLAQWYVAFLGRHGRSDEGLLVATRCLDGIVGRQPNFRCTHCGFESHEIYWRCPQCH
                     EWDEMEPL"
     misc_feature    complement(169788..170918)
                     /locus_tag="Mmc1_0158"
                     /note="tetratricopeptide repeat protein; Provisional;
                     Region: PRK11788"
                     /db_xref="CDD:236983"
     misc_feature    complement(170532..170837)
                     /locus_tag="Mmc1_0158"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(170586..170591,170598..170603,
                     170610..170615,170703..170708,170715..170720,
                     170724..170729,170814..170819,170826..170831,
                     170835..170837))
                     /locus_tag="Mmc1_0158"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(170547..170549,170556..170558,
                     170568..170570,170604..170606,170661..170663,
                     170670..170672,170682..170684,170718..170720,
                     170763..170765,170772..170774,170784..170786,
                     170820..170822))
                     /locus_tag="Mmc1_0158"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(<169794..169874)
                     /locus_tag="Mmc1_0158"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     gene            complement(171166..173550)
                     /locus_tag="Mmc1_0159"
                     /db_xref="GeneID:4481031"
     CDS             complement(171166..173550)
                     /locus_tag="Mmc1_0159"
                     /note="PFAM: AsmA family protein;
                     KEGG: noc:Noc_2265 conserved hypothetical protein, AsmA"
                     /codon_start=1
                     /transl_table=11
                     /product="AsmA family protein"
                     /protein_id="YP_864092.1"
                     /db_xref="GI:117923475"
                     /db_xref="InterPro:IPR007844"
                     /db_xref="GeneID:4481031"
                     /translation="MKKLLIALISLIVLVIVVLVAIPLFVDPNEHKPLIAEKVHEATG
                     RTLSLNGNLHLSLFPWAGVTIEAAELGNPADIGVGQAMVKLNKVDVRVKLMPLLSKQV
                     VVDRIIIDGLEAHLIRDKHGKDNWSDLSGGGKGAQTDTAAPQAGGTNQEKAAGSSPLA
                     GLSLGGVEISNAKVSFRDEQADLVASLNPLNLATGAVALGQPVDLTLDAKLAKRSISG
                     KGEALDVGVQFSGQLQPAADMQSLLLNGMKLMIETTAKGLPVTKVQTQLSADVAVDLK
                     GGTVKISRNKLAIEAEGSPELGMDTVRAALTGSIGVNLEPLTIEISGLDLTVQGNGGK
                     LPGGSVDLHMAADLLANMAAGTVGVKNLRLEGFEQQLKASGDVDVSNLNGDPRVGWQL
                     TMQPTSPKGLMSKLGLPALQTADPTALTKLALAIQGKLEMAGAGSVALSKFDLTLDDT
                     HLTGTVSAPRLDGTAARFDLRGDGLNLDRYMMTAGGEGAKAAQPNSTAEGKAAATGDE
                     ILIDQATMAQLRKLDIKGQIVLDRLTAAKGHFEKVTIKVDAGDGVLKLNPFSVNLYKG
                     SLVTTGQMDVRGNEPKMAFRKVLQGVQVGDMLKEMADVTLITGQADLDLDTTTQGSTM
                     KGLKRHVNGRIQGGVTKGTLQGLDILGQIKAAYAMARGKPAPSGGSKDTAFDDMLLDA
                     RIVDGVIQHERLKVSSNDLIMEGKGTVDLAEEQLDYHMEAKVRNLGGDGKSLTVPVLV
                     KGSWNSPGVSVDTAALLQSLAKEQAQDKINDVLDKKLGDKAAPVKQLLKGLKLF"
     misc_feature    complement(171478..173484)
                     /locus_tag="Mmc1_0159"
                     /note="AsmA family; Region: AsmA; pfam05170"
                     /db_xref="CDD:253057"
     misc_feature    complement(<172711..173067)
                     /locus_tag="Mmc1_0159"
                     /note="Domain of Unknown Function (DUF748); Region:
                     DUF748; pfam05359"
                     /db_xref="CDD:253165"
     misc_feature    complement(<171826..172275)
                     /locus_tag="Mmc1_0159"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     misc_feature    complement(171310..171933)
                     /locus_tag="Mmc1_0159"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     gene            complement(173579..174511)
                     /locus_tag="Mmc1_0160"
                     /db_xref="GeneID:4481032"
     CDS             complement(173579..174511)
                     /locus_tag="Mmc1_0160"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; 3-beta
                     hydroxysteroid dehydrogenase/isomerase; polysaccharide
                     biosynthesis protein CapD; dTDP-4-dehydrorhamnose
                     reductase; Male sterility C-terminal domain;
                     KEGG: mag:amb1437 nucleoside-diphosphate-sugar epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_864093.1"
                     /db_xref="GI:117923476"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="GeneID:4481032"
                     /translation="MATYLITGGCGFIGSHLADALLARGDGVRILDDLSTGKRENVQG
                     TCEIILGDVADSQTVRQAMQGVDGCFHLAAVASVARSNEDWVGTHRINQTGSVNVFDA
                     ARHAKDGQPVPVVYASSAATYGACQTLPIHEDAPRNPLTAYGADKLGSELHAVVASGV
                     HGVPTCGFRFFNVYGPRQDPSSPYSGVISIFTNRMRVGQDVTIFGDGGQTRDFVYVAD
                     VVAHLLAGMDRATGEAKVYNVCTGREITLLQLALMIRSLLDSKIAIHHGEPRAGDIRE
                     SLGDPRRATAELGVRAEITLEDGLKRLLDSLKNG"
     misc_feature    complement(173597..174502)
                     /locus_tag="Mmc1_0160"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(173585..174499)
                     /locus_tag="Mmc1_0160"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(order(173993..174004,174071..174073,
                     174083..174085,174155..174163,174290..174298,
                     174410..174418,174473..174475,174479..174484,
                     174488..174490))
                     /locus_tag="Mmc1_0160"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(174071..174073,174083..174085,
                     174155..174157,174236..174238))
                     /locus_tag="Mmc1_0160"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(174594..175565)
                     /locus_tag="Mmc1_0161"
                     /db_xref="GeneID:4481033"
     CDS             complement(174594..175565)
                     /locus_tag="Mmc1_0161"
                     /note="KEGG: afm:Afu2g17000 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864094.1"
                     /db_xref="GI:117923477"
                     /db_xref="GeneID:4481033"
                     /translation="MEPLAWIGIALGTMAVWFLWERGANKPSAPPPPPPQPRRENPKQ
                     TVLPPEPKPEPKPKAAPATVTVEAVAEPDIEPIPASPPVAEPCVTPTAEAVPEKEAPP
                     PITPTKPLVEKTVEPVTEPLVEKTVEPVTEPISVAQPKSRANDQKNALSEAKELMLPI
                     LSDKYDKSYQGKNPLDENVESRMNPAQQICSCADFVQNRKDYPLGDIRRVCACQALKL
                     TQIRAKSCYEPLVWCAIIGGKQRDLSHFYQTDLLGDPAGIGFIPGGSVVALHTRAPKR
                     GDDQGHATGDYKVFEYDLSSREWLEPAPPIHLAEVAQPMLDDLFNTH"
     misc_feature    complement(<175104..175376)
                     /locus_tag="Mmc1_0161"
                     /note="transport protein TonB; Provisional; Region:
                     PRK10819"
                     /db_xref="CDD:236768"
     gene            complement(175862..176632)
                     /locus_tag="Mmc1_0162"
                     /db_xref="GeneID:4481542"
     CDS             complement(175862..176632)
                     /locus_tag="Mmc1_0162"
                     /note="KEGG: gme:Gmet_0193 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864095.1"
                     /db_xref="GI:117923478"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="GeneID:4481542"
                     /translation="MSPNQLKNMLEQVANGTLTVQNALSQLKHFPTDTIQQQGQTIAQ
                     LDTHRELRHGFPEVILAQGKKFAHLNAITSRALNHKRNLLITRIGKKRAAKLLANHPQ
                     LTHHPLPRCVTWQPTANQPNIGLVAVLCAGTSDLAVAEEAALTARMLGAQVETHYDAG
                     VAGLHRLLAASTLLQTARVFIVVAGMEGALPSVVGGLVDRPVIAVPTSQGYGASLGGI
                     AALLGMLNSCASNVTTVNIDNGFGAGYVAALINRTSMP"
     misc_feature    complement(175874..176617)
                     /locus_tag="Mmc1_0162"
                     /note="NCAIR mutase (PurE)-related proteins [General
                     function prediction only]; Region: COG1691"
                     /db_xref="CDD:224605"
     misc_feature    complement(175883..176263)
                     /locus_tag="Mmc1_0162"
                     /note="AIR carboxylase; Region: AIRC; smart01001"
                     /db_xref="CDD:214965"
     gene            complement(177972..178988)
                     /locus_tag="Mmc1_0163"
                     /db_xref="GeneID:4481543"
     CDS             complement(177972..178988)
                     /locus_tag="Mmc1_0163"
                     /note="TIGRFAM: thiamine-monophosphate kinase;
                     PFAM: AIR synthase related protein domain protein;
                     KEGG: hit:NTHI1618 thiamine-monophosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="YP_864096.1"
                     /db_xref="GI:117923479"
                     /db_xref="InterPro:IPR006283"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="GeneID:4481543"
                     /translation="MGDKSVANLGEFGVIQHIFAPIQSKQGEGVQLGIGDDAACLVVP
                     RTQDLLATTDTMVEGIHFSSDADPYLLGQKALAVNLSDIAAMGGLPRWYLLSMAVPNR
                     TSQSWLEEFARGVKAASEMFHVALVGGDTVRSNAKIVITVQMLGLIGQHRAVARSGAQ
                     VGDRLYLSGTLGDSAFGLAHLLGKLPAMLADDVSYLSRRHHLPEPRIQLGMALQDAAL
                     AHACIDVSDGLLADLQHICEASQVSAVVDVEKLPFSESAQRVIAQYGRSALELALTGG
                     EDYELLFAISPGAADQVEKIVHQVGVSLVEIGEVVGVGERPGVVVRQGGEVLSIAQSG
                     WTHF"
     misc_feature    complement(177975..178964)
                     /locus_tag="Mmc1_0163"
                     /note="thiamine monophosphate kinase; Provisional; Region:
                     PRK05731"
                     /db_xref="CDD:235583"
     misc_feature    complement(178056..178961)
                     /locus_tag="Mmc1_0163"
                     /note="ThiL (Thiamine-monophosphate kinase) plays a dual
                     role in de novo biosynthesis and in salvage of exogenous
                     thiamine. Thiamine salvage occurs in two steps, with
                     thiamine kinase catalyzing the formation of thiamine
                     phosphate, and ThiL catalyzing the...; Region: ThiL;
                     cd02194"
                     /db_xref="CDD:100030"
     misc_feature    complement(order(178308..178313,178317..178319,
                     178521..178523,178599..178607,178653..178655,
                     178704..178706,178743..178745,178878..178886,
                     178944..178946))
                     /locus_tag="Mmc1_0163"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100030"
     misc_feature    complement(order(178560..178562,178566..178568,
                     178590..178601,178608..178610,178653..178655,
                     178818..178820,178824..178832,178875..178877,
                     178935..178937))
                     /locus_tag="Mmc1_0163"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100030"
     gene            complement(178991..179488)
                     /locus_tag="Mmc1_0164"
                     /db_xref="GeneID:4481544"
     CDS             complement(178991..179488)
                     /locus_tag="Mmc1_0164"
                     /note="TIGRFAM: transcription antitermination factor NusB;
                     PFAM: NusB/RsmB/TIM44;
                     KEGG: deh:cbdb_A1206 N utilization substance protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="NusB antitermination factor"
                     /protein_id="YP_864097.1"
                     /db_xref="GI:117923480"
                     /db_xref="InterPro:IPR006027"
                     /db_xref="InterPro:IPR011605"
                     /db_xref="GeneID:4481544"
                     /translation="MAHKSDKSGKSRNTMRRGGRSKSREIALQVLYGCEIAHDPVGPA
                     LRNMLEDPHSEGMDQDYFSQLTLGVEAEREVLDSWIGRAGAAWSMDRFSVVDHNILRL
                     GIYELLKQPEVPHRVILNEAIELSKRFGGEESSRFVNGVMDKVANLVREEDAAPMRVW
                     DTQES"
     misc_feature    complement(179051..179431)
                     /locus_tag="Mmc1_0164"
                     /note="Transcription termination factor NusB (N
                     protein-Utilization Substance B). NusB plays a key role in
                     the regulation of ribosomal RNA biosynthesis in eubacteria
                     by modulating the efficiency of transcriptional
                     antitermination. NusB along with other Nus...; Region:
                     Terminator_NusB; cd00619"
                     /db_xref="CDD:238342"
     misc_feature    complement(order(179417..179419,179429..179431))
                     /locus_tag="Mmc1_0164"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238342"
     gene            complement(179498..179968)
                     /locus_tag="Mmc1_0165"
                     /db_xref="GeneID:4481545"
     CDS             complement(179498..179968)
                     /locus_tag="Mmc1_0165"
                     /EC_number="2.5.1.9"
                     /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase;
                     KEGG: lip:LI0154 riboflavin synthase beta-chain"
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="YP_864098.1"
                     /db_xref="GI:117923481"
                     /db_xref="InterPro:IPR002180"
                     /db_xref="GeneID:4481545"
                     /translation="MGDIIELEGHLTVDGKKFCLLLSRFNSFITERLLEGAIDCIVRH
                     GGKREDITVARVPGAFELPLVAQKAAKSGKYDGIVCLGAVIRGSTPHFDYVSSEVTKG
                     VASISLAYDMPIGFGVLTTDTVEQAIDRAGTKAGNKGWEATISVIEMINLLDGM"
     misc_feature    complement(179519..179902)
                     /locus_tag="Mmc1_0165"
                     /note="lumazine synthase (6,7-dimethyl-8-ribityllumazine
                     synthase, LS), catalyzes the penultimate step in the
                     biosynthesis of riboflavin (vitamin B2); type-I; Region:
                     Lumazine_synthase-I; cd09209"
                     /db_xref="CDD:187742"
     misc_feature    complement(order(179522..179527,179534..179536,
                     179546..179548,179555..179557,179579..179581,
                     179591..179593,179603..179605,179609..179611,
                     179615..179617,179621..179623,179633..179638,
                     179645..179659,179663..179671,179675..179683,
                     179687..179692,179696..179698,179702..179707,
                     179711..179713,179744..179746,179756..179758,
                     179762..179770,179774..179782,179786..179791,
                     179798..179809,179894..179896))
                     /locus_tag="Mmc1_0165"
                     /note="homopentamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187742"
     misc_feature    complement(order(179546..179548,179555..179557,
                     179579..179581,179612..179626,179693..179698,
                     179702..179704,179708..179725,179786..179797,
                     179891..179896))
                     /locus_tag="Mmc1_0165"
                     /note="active site"
                     /db_xref="CDD:187742"
     gene            complement(179987..181213)
                     /locus_tag="Mmc1_0166"
                     /db_xref="GeneID:4481546"
     CDS             complement(179987..181213)
                     /locus_tag="Mmc1_0166"
                     /EC_number="3.5.4.25"
                     /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate
                     synthase; GTP cyclohydrolase II;
                     KEGG: sat:SYN_02371 GTP cyclohydrolase II /
                     3,4-dihydroxy-2-butanone-4-phosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="YP_864099.1"
                     /db_xref="GI:117923482"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR000926"
                     /db_xref="GeneID:4481546"
                     /translation="MSDFNSITEILEDFRQGKMVILVDDENRENEGDLIVAAEFCDAP
                     AVNFMTKHGRGLICLSLTQARVEKLQLPLMVVDNDAKFKTAFTVSIEAKVGVTTGISA
                     QDRARTIEAAIADTSGPEDISRPGHVFPLVAKDGGVLVRAGHTEASVDLARLSGLKPA
                     AVICEILKDDGTMARVPDLIPLAKQMGIKLGTIADLIAYRRQTEQLVHRAVETRLPSA
                     YGGEWKLVAYTNDVDQHQHVALVKGNVDDGSPVLVRVHSECLTGDMFGSLRCDCGPQL
                     QAAMEQIGQEGRGVIVYLRQEGRGIGLINKMHAYNLQDEGQDTVEANEALGFSADLRD
                     YGIGAQILKDLGVTHMKLMTNNPKKIVGLTGYGLDVVDRVPLEIKSGMTNERYLRAKK
                     HKLGHMLRQFPESNES"
     misc_feature    complement(180017..181213)
                     /locus_tag="Mmc1_0166"
                     /note="bifunctional 3,4-dihydroxy-2-butanone 4-phosphate
                     synthase/GTP cyclohydrolase II protein; Provisional;
                     Region: PRK09311"
                     /db_xref="CDD:181774"
     misc_feature    complement(180614..181195)
                     /locus_tag="Mmc1_0166"
                     /note="3,4-dihydroxy-2-butanone 4-phosphate synthase;
                     Region: DHBP_synthase; pfam00926"
                     /db_xref="CDD:250231"
     misc_feature    complement(180017..180598)
                     /locus_tag="Mmc1_0166"
                     /note="GTP cyclohydrolase II (RibA).  GTP cyclohydrolase
                     II catalyzes the conversion of GTP to
                     2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'
                     phosphate, formate, pyrophosphate (APy), and GMP in the
                     biosynthetic pathway of riboflavin. Riboflavin is the...;
                     Region: GTP_cyclohydro2; cd00641"
                     /db_xref="CDD:238348"
     misc_feature    complement(order(180272..180274,180281..180286,
                     180290..180295,180302..180307,180329..180331,
                     180335..180337,180374..180376,180383..180388,
                     180407..180409,180413..180427,180431..180436,
                     180440..180442,180494..180496,180500..180502,
                     180506..180508,180527..180535,180539..180541,
                     180566..180586))
                     /locus_tag="Mmc1_0166"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238348"
     misc_feature    complement(order(180137..180139,180146..180154,
                     180215..180217,180221..180223,180257..180259,
                     180275..180277,180284..180286,180296..180298,
                     180317..180328,180389..180391,180398..180400,
                     180404..180406,180431..180433,180437..180454))
                     /locus_tag="Mmc1_0166"
                     /note="active site"
                     /db_xref="CDD:238348"
     gene            complement(181224..181895)
                     /locus_tag="Mmc1_0167"
                     /db_xref="GeneID:4481547"
     CDS             complement(181224..181895)
                     /locus_tag="Mmc1_0167"
                     /EC_number="2.5.1.9"
                     /note="catalyzes the formation of riboflavin from
                     6,7-dimethyl-8-(1-D-ribityl)lumazine"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase subunit alpha"
                     /protein_id="YP_864100.1"
                     /db_xref="GI:117923483"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="GeneID:4481547"
                     /translation="MFTGLIETVGQVAALRKGHGEWQLSVQSDLPMAEVKLGDSIAVS
                     GACLTVTQMAGRQFTVEVSQESVAKTTFAALQVGAAVNLERALRMGGRLDGHLVQGHV
                     DAVGWLESQQPRGGSMELWFRVPGEIGRYIIPKGSIAIDGISLTVNQVADGEDATRFS
                     INVIPLTQRKTTLGGLAVGGRVNVETDLLGRYVERLLRRGGNCAVKGSDHGITEAFLK
                     ERGFA"
     misc_feature    complement(181308..181895)
                     /locus_tag="Mmc1_0167"
                     /note="riboflavin synthase subunit alpha; Provisional;
                     Region: PRK09289"
                     /db_xref="CDD:236455"
     misc_feature    complement(181638..181889)
                     /locus_tag="Mmc1_0167"
                     /note="Lumazine binding domain; Region: Lum_binding;
                     pfam00677"
                     /db_xref="CDD:250049"
     misc_feature    complement(181335..181601)
                     /locus_tag="Mmc1_0167"
                     /note="Lumazine binding domain; Region: Lum_binding;
                     pfam00677"
                     /db_xref="CDD:250049"
     gene            complement(182103..183233)
                     /locus_tag="Mmc1_0168"
                     /db_xref="GeneID:4481548"
     CDS             complement(182103..183233)
                     /locus_tag="Mmc1_0168"
                     /EC_number="1.1.1.193"
                     /EC_number="3.5.4.26"
                     /note="KEGG: mta:Moth_0915 riboflavin biosynthesis protein
                     RibD;
                     TIGRFAM: riboflavin biosynthesis protein RibD;
                     PFAM: CMP/dCMP deaminase, zinc-binding; bifunctional
                     deaminase-reductase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /protein_id="YP_864101.1"
                     /db_xref="GI:117923484"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="InterPro:IPR004794"
                     /db_xref="InterPro:IPR011549"
                     /db_xref="GeneID:4481548"
                     /translation="MAKPDAGKDRAYMDHALRLAARGLGRTRPNPTVGCVIVKEDRII
                     GRGWHRKAGGPHAEVEALRMAGEAARGATAYVTLEPCSHHGRTPPCCEGLIKAGIRRV
                     VAAMEDPNPLVSGQGFQRLKQAGVVVQVGVREEAAQMLIRPFITRILHNRPMVTLKSA
                     ASLDGKTATRERHSQWITGEAARKRGHRLRDTHDVILTGIQTVLADDPRLTCRLKGGR
                     DPIRVVVDSSLKLSENAGVINPDSTAPVWVATTLRAPEEKRALFALLPGVEVIMCAED
                     DTGRVDLYDLMEKLAKREITSVLAEAGGVLSGALLDKRLVDRIALFMAPMLIGGREAS
                     GILDSLGAAKLTEAPRLDHVTLTSLDGDLLVEGCVVYGATEG"
     misc_feature    complement(182142..183197)
                     /locus_tag="Mmc1_0168"
                     /note="riboflavin biosynthesis protein RibD; Region:
                     eubact_ribD; TIGR00326"
                     /db_xref="CDD:232920"
     misc_feature    complement(182868..183197)
                     /locus_tag="Mmc1_0168"
                     /note="Riboflavin-specific deaminase. Riboflavin
                     biosynthesis protein RibD
                     (Diaminohydroxyphosphoribosylaminopyrimidine deaminase)
                     catalyzes the deamination of
                     2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone
                     5'-phosphate, which is an intermediate step in the...;
                     Region: Riboflavin_deaminase-reductase; cd01284"
                     /db_xref="CDD:238611"
     misc_feature    complement(order(182964..182966,182991..182996,
                     183060..183068))
                     /locus_tag="Mmc1_0168"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238611"
     misc_feature    complement(order(182964..182966,182991..182993,
                     183060..183062,183066..183068))
                     /locus_tag="Mmc1_0168"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238611"
     misc_feature    complement(182133..182780)
                     /locus_tag="Mmc1_0168"
                     /note="RibD C-terminal domain; Region: RibD_C; cl17279"
                     /db_xref="CDD:266607"
     gene            complement(183412..184680)
                     /locus_tag="Mmc1_0169"
                     /db_xref="GeneID:4481549"
     CDS             complement(183412..184680)
                     /locus_tag="Mmc1_0169"
                     /EC_number="2.1.2.1"
                     /note="PFAM: glycine hydroxymethyltransferase; aromatic
                     amino acid beta-eliminating lyase/threonine aldolase;
                     KEGG: rsp:RSP_0823 serine hydroxymethyltransferase
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="YP_864102.1"
                     /db_xref="GI:117923485"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="GeneID:4481549"
                     /translation="MNTADLKSFDPEVQSAIDEELGRQRHQIELIASENIVSPAVMAA
                     QGSVMTNKYAEGYPAKRYYGGCEFVDKVEVLAIERAKQLFGCAYANVQPHSGSQANMA
                     AFMAIAPAGSTILGMSLAHGGHLTHGAKVNFSGQIYNAVQYGLNGESERIDFDQVQAL
                     AMEHKPAIIVAGASAYSRIIDFAKFREICDAVGAKLVVDMAHFAGLVATGEHPSPFPH
                     ADIVTTTTHKTLRGPRGGMILTNDEELAKKINSKIFPGIQGGPLMHVIAAKAVAFKEA
                     LSPEFKIYTQQVRKNAVALAEVLVEGGLRIVSGGTDNHLMLVDLTSRDITGKDTEHAL
                     ERAGLTCNKNAIPNDPRSPFITSGVRLGTPAATTRGFDEEAFRAVGRLIVRVVDAVAA
                     SGGAGDPAIEAEVHKEVDALCQKFPIYADI"
     misc_feature    complement(183445..184653)
                     /locus_tag="Mmc1_0169"
                     /note="Serine-glycine hydroxymethyltransferase (SHMT).
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). SHMT
                     carries out interconversion of serine and glycine; it
                     catalyzes the transfer of hydroxymethyl...; Region: SHMT;
                     cd00378"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(183841..183843,183895..183897,
                     184270..184275,184378..184380,184399..184401,
                     184444..184446,184468..184473,184525..184527,
                     184579..184581,184594..184596,184621..184626,
                     184645..184647,184651..184653))
                     /locus_tag="Mmc1_0169"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(183601..183603,183979..183981,
                     183997..184002,184075..184077,184084..184086,
                     184159..184161,184309..184311,184390..184395,
                     184492..184494,184522..184524,184582..184584))
                     /locus_tag="Mmc1_0169"
                     /note="glycine-pyridoxal phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(183601..183603,183997..183999,
                     184309..184311,184582..184584))
                     /locus_tag="Mmc1_0169"
                     /note="active site"
                     /db_xref="CDD:99733"
     misc_feature    complement(183718..184569)
                     /locus_tag="Mmc1_0169"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(183649..183651,183919..183921,
                     184306..184308,184312..184314,184324..184326,
                     184495..184497,184516..184518))
                     /locus_tag="Mmc1_0169"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:99733"
     gene            complement(184748..185194)
                     /locus_tag="Mmc1_0170"
                     /db_xref="GeneID:4481550"
     CDS             complement(184748..185194)
                     /locus_tag="Mmc1_0170"
                     /EC_number="5.3.1.6"
                     /note="TIGRFAM: sugar-phosphate isomerases, RpiB/LacA/LacB
                     family; ribose 5-phosphate isomerase B;
                     PFAM: ribose/galactose isomerase;
                     KEGG: mag:amb2338 ribose 5-phosphate isomerase RpiB"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase"
                     /protein_id="YP_864103.1"
                     /db_xref="GI:117923486"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR003500"
                     /db_xref="InterPro:IPR004785"
                     /db_xref="GeneID:4481550"
                     /translation="MRIFFACDHGASELKQHLMAYLAKRDRVELVDLGCDGTTSVDYP
                     DYAATLCKAVLASAGDRGVLLCGTGIGISIAANRFAGIRAALCHDAYTARLCREHNDA
                     NVLVLGGRTTGPAVAEEMLDLWLDTPYAGGRHQRRLDKIESNAREV"
     misc_feature    complement(184769..185191)
                     /locus_tag="Mmc1_0170"
                     /note="Ribose/Galactose Isomerase; Region: LacAB_rpiB;
                     pfam02502"
                     /db_xref="CDD:251337"
     gene            185502..186671
                     /locus_tag="Mmc1_0171"
                     /db_xref="GeneID:4481551"
     CDS             185502..186671
                     /locus_tag="Mmc1_0171"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: mac:MA4452 glycosyltransferase (group I)"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_864104.1"
                     /db_xref="GI:117923487"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4481551"
                     /translation="MPPTKHPLSVAYVNSIDLPDNRRAHAMQMLKNGQAWSQCVEQFE
                     FITNVWWHNRNRLTVENMAAFYGLTHPFTLIPYPLRRLEQSQYRWLRELYFQLAAWRC
                     KRKRVDLVYTRTYPLLAYTLKLGIPTVVETHSPPGRNEEADAMLSLADHPNLVALTTI
                     SEPLAERYRAFGVPADKIMVLPDGVDLERFEPALTLAEARQQLGLPLNQSIATYVGHL
                     YEGRGIDTLLSAALKQPKVLFLIVGGYAKDMERWQHRAAQMGLENVRFEGFVANERVP
                     LYLWAGDVLVMPYGNACTTTEWMSPLKLFEYMAAGRPIIASDFPILREVLENGKNGLL
                     VPPDDGEALAAAMDALLADAPRRQALGAAALHQVRPYSWVNRVEQVINRFNRYGQ"
     misc_feature    185667..186659
                     /locus_tag="Mmc1_0171"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    185724..186644
                     /locus_tag="Mmc1_0171"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     gene            complement(186895..188607)
                     /locus_tag="Mmc1_0172"
                     /db_xref="GeneID:4481552"
     CDS             complement(186895..188607)
                     /locus_tag="Mmc1_0172"
                     /note="TIGRFAM: ribosomal protein S1;
                     PFAM: RNA binding S1 domain protein;
                     KEGG: mag:amb4261 ribosomal protein S1"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="YP_864105.1"
                     /db_xref="GI:117923488"
                     /db_xref="InterPro:IPR000110"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="GeneID:4481552"
                     /translation="MTDDLILDDIADEDFEALLEESFSKGVGREGSVVTGTIIQREGD
                     EFIIDVGLKSEGRLTIREFYDADGQLTIGVGDSVDVFVERCEDQNGLAVLSREKAKRE
                     EAWVLLEEAFNDGKTVDGRIMGKVKGGYTVDLGGLAAFLPGSQVDVRPVHDISRLQEE
                     TQPFDILKMDRRRGNIVVSRRTVIEKHRENARSALLETLHEGMVLDGIVKNITDYGAF
                     VDLGGLDGLLHITDMSWKRVKHPSAVVNVGDTVTVQVIKFNSDTQRISLGMKQLLIDP
                     WEGIGAKYPAGAKFSGHVTNITDYGSFVELEPGVEGLAHVSELTWTKKNIHPSKILEV
                     NQIVEVMVLDVDADRRRISLGIKQCQENPWEAFATSHPVGAMVKGEIKNITEFGLFVG
                     LEGDIDGLVHLSDITWDTNAGEEVLKDFQKGQEVEAMVLSLDPDKERISLGLKQAQPD
                     AWGQWVDANPKGNVVMGKVKEVLSSGVLVQLADEVDGHIRKAEFSQDDREGTNLTLET
                     EVECRVMQVDRQKRKISLSIKAMEVQQERDAIKEYASDSSSAATSSLGEALSQALEKA
                     NAAE"
     misc_feature    complement(186913..188571)
                     /locus_tag="Mmc1_0172"
                     /note="30S ribosomal protein S1; Reviewed; Region: rpsA;
                     PRK06299"
                     /db_xref="CDD:235775"
     misc_feature    complement(188317..188517)
                     /locus_tag="Mmc1_0172"
                     /note="S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec1_hs1;
                     cd05687"
                     /db_xref="CDD:240192"
     misc_feature    complement(order(188431..188433,188437..188439,
                     188467..188469,188491..188493))
                     /locus_tag="Mmc1_0172"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240192"
     misc_feature    complement(188065..188265)
                     /locus_tag="Mmc1_0172"
                     /note="S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec2_hs2;
                     cd04465"
                     /db_xref="CDD:239911"
     misc_feature    complement(order(188182..188184,188188..188190,
                     188215..188217,188239..188241))
                     /locus_tag="Mmc1_0172"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239911"
     misc_feature    complement(187804..188007)
                     /locus_tag="Mmc1_0172"
                     /note="S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec3; cd05688"
                     /db_xref="CDD:240193"
     misc_feature    complement(order(187921..187923,187927..187929,
                     187954..187956,187978..187980))
                     /locus_tag="Mmc1_0172"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240193"
     misc_feature    complement(187543..187758)
                     /locus_tag="Mmc1_0172"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(187663..187665,187669..187671,
                     187699..187701,187723..187725))
                     /locus_tag="Mmc1_0172"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(187279..187488)
                     /locus_tag="Mmc1_0172"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(187402..187404,187408..187410,
                     187438..187440,187462..187464))
                     /locus_tag="Mmc1_0172"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(187012..187224)
                     /locus_tag="Mmc1_0172"
                     /note="S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec6; cd05691"
                     /db_xref="CDD:240196"
     misc_feature    complement(order(187138..187140,187144..187146,
                     187174..187176,187198..187200))
                     /locus_tag="Mmc1_0172"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240196"
     gene            complement(188971..189648)
                     /locus_tag="Mmc1_0173"
                     /db_xref="GeneID:4481553"
     CDS             complement(188971..189648)
                     /locus_tag="Mmc1_0173"
                     /EC_number="2.7.4.14"
                     /note="KEGG: eca:ECA2592 cytidylate kinase;
                     TIGRFAM: cytidylate kinase;
                     PFAM: cytidylate kinase region"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="YP_864106.1"
                     /db_xref="GI:117923489"
                     /db_xref="InterPro:IPR003136"
                     /db_xref="InterPro:IPR011769"
                     /db_xref="InterPro:IPR011994"
                     /db_xref="GeneID:4481553"
                     /translation="MAERLRIAVDGPAGAGKGTVCRAVARRYQWAYLDTGAIYRAVAL
                     HALNSENFEETSLAQWAAQMDFRFEVDAQGDAHAFLEGTEVTNKLRDEQVGETASQVA
                     AMPAVRTALLDFQRNYGSPQSVILDGRDVGTVVLPDADLKIYLTASLQARAQRRTLEL
                     QGKGESVSMDRIKSRIEERDARDQSRATAPLAAAPDAQTVDTTYLSQTESIETVARLV
                     ASLLEKP"
     misc_feature    complement(188977..189648)
                     /locus_tag="Mmc1_0173"
                     /note="cytidylate kinase; Provisional; Region: cmk;
                     PRK00023"
                     /db_xref="CDD:234579"
     misc_feature    complement(189040..189633)
                     /locus_tag="Mmc1_0173"
                     /note="Cytidine monophosphate kinase (CMPK) catalyzes the
                     reversible phosphorylation of cytidine monophosphate (CMP)
                     to produce cytidine diphosphate (CDP), using ATP as the
                     preferred phosphoryl donor; Region: CMPK; cd02020"
                     /db_xref="CDD:238978"
     misc_feature    complement(order(189091..189093,189259..189264,
                     189325..189327))
                     /locus_tag="Mmc1_0173"
                     /note="CMP-binding site; other site"
                     /db_xref="CDD:238978"
     misc_feature    complement(order(189100..189102,189112..189114))
                     /locus_tag="Mmc1_0173"
                     /note="The sites determining sugar specificity; other
                     site"
                     /db_xref="CDD:238978"
     gene            complement(189641..190978)
                     /locus_tag="Mmc1_0174"
                     /db_xref="GeneID:4481554"
     CDS             complement(189641..190978)
                     /locus_tag="Mmc1_0174"
                     /EC_number="2.5.1.19"
                     /note="KEGG: gsu:GSU2606 3-phosphoshikimate
                     1-carboxyvinyltransferase;
                     TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase)"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="YP_864107.1"
                     /db_xref="GI:117923490"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="GeneID:4481554"
                     /translation="MSSTHPGRTIRSGATQNLSGTIRPAADKSISHRSVIFGALAEGE
                     THVKGMLEGEDVLRTITAFRTMGISIERCNEGEYRIQGQGLDGLKEPDDVLDMGNSGT
                     AMRLLCGLLASQPFHSILTGDHSLRSRPMGRVVQPLTKMGARIRGRDGGRLAPLAIEG
                     TELVPITYNSPIASAQVKSAIILAGLNTAGETTIIEPAVSRDHTERMLIAFGAEVTRD
                     GNQVTIEGWPNLQGQEIEVPADISAAAFPMVAALITPGSDIILENVGMNPTRTGILDL
                     LLAMGGNIQRLNEREVGGEPVADLQVRYSQLQGIEIDPTVVPRAIDEFPVFFVAAALA
                     QGQTLVQGAEELRVKESDRITAMANGLKALGAIIEERPDGALITGNPDGLAGGASVDS
                     FTDHRIAMSLLVAGLRCKESVLVQRCDNINTSFPSFSQLMNSLGFQLEDVSHG"
     misc_feature    complement(189659..190939)
                     /locus_tag="Mmc1_0174"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase;
                     Provisional; Region: PRK02427"
                     /db_xref="CDD:235037"
     misc_feature    complement(189674..190927)
                     /locus_tag="Mmc1_0174"
                     /note="EPSP synthase domain. 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EC
                     2.5.1.19) catalyses the reaction between
                     shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP)
                     to form...; Region: EPSP_synthase; cd01556"
                     /db_xref="CDD:238797"
     misc_feature    complement(order(190259..190270,190898..190909))
                     /locus_tag="Mmc1_0174"
                     /note="hinge; other site"
                     /db_xref="CDD:238797"
     misc_feature    complement(order(189710..189712,189788..189793,
                     189920..189922,189929..189934,189944..189946,
                     190013..190015,190379..190381,190388..190390,
                     190451..190459,190592..190594,190673..190678,
                     190682..190684,190880..190882,190892..190897))
                     /locus_tag="Mmc1_0174"
                     /note="active site"
                     /db_xref="CDD:238797"
     gene            complement(192502..193395)
                     /locus_tag="Mmc1_0175"
                     /db_xref="GeneID:4481555"
     CDS             complement(192502..193395)
                     /locus_tag="Mmc1_0175"
                     /EC_number="1.3.1.12"
                     /note="PFAM: prephenate dehydrogenase;
                     KEGG: gsu:GSU2607 prephenate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="YP_864108.1"
                     /db_xref="GI:117923491"
                     /db_xref="InterPro:IPR003099"
                     /db_xref="GeneID:4481555"
                     /translation="MSVLIKRLTLIGVGLIGASLAQALRKRDLVGEIVGVDRRRASLD
                     YALEQGIIDRVETHAARGVEGATLVLIATPVSTIVSMVEDCVAGLGRGVVVTDVGSVK
                     GRIVERCEALMPEGCAFVGGHPIAGREHSGVEAALASLFDGARTILTPSSVTPRWALE
                     LVTEMWESVGATVESMEPHWHDQVLAATSHLPHLMAYNVVNTLSDLEDHLRTEVFRYA
                     ASGFRDFTRIASSDPTMWRDICLENKDAILSILGRFKSDLEKLTKRVEEEDADGLYGI
                     FARSKDTRARILQENKILRGE"
     misc_feature    complement(192529..193395)
                     /locus_tag="Mmc1_0175"
                     /note="cyclohexadienyl dehydrogenase; Validated; Region:
                     PRK07502"
                     /db_xref="CDD:236034"
     misc_feature    complement(192574..193371)
                     /locus_tag="Mmc1_0175"
                     /note="prephenate dehydrogenase; Validated; Region:
                     PRK08507"
                     /db_xref="CDD:181452"
     gene            complement(193405..194511)
                     /locus_tag="Mmc1_0176"
                     /db_xref="GeneID:4481556"
     CDS             complement(193405..194511)
                     /locus_tag="Mmc1_0176"
                     /EC_number="4.2.1.51"
                     /EC_number="5.4.99.5"
                     /note="TIGRFAM: chorismate mutase;
                     PFAM: prephenate dehydratase; chorismate mutase; amino
                     acid-binding ACT domain protein;
                     KEGG: pca:Pcar_1887 chorismate mutase/prephenate
                     dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase / prephenate dehydratase"
                     /protein_id="YP_864109.1"
                     /db_xref="GI:117923492"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002701"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR010957"
                     /db_xref="GeneID:4481556"
                     /translation="MSHDPIDLNPSTLVELRDGIDAIDDRIHDLLMKRAELVMRVGEL
                     KGKGPAGTPFYRPEREAQIHRRLEGRHGGPLPVEAVHRIFREIISASLNLEKQLSVAY
                     LGPEATFTHEAALKQFGSAFTMFSTRTITEVFHEVEIGRANFGVVPVENSLEGVVIHT
                     LDRFVRSPLNICGEVLMPVELNLLARGGVLGEVRVIYGHFSALDQCAQWLSHYLPQVK
                     RVEVASTAEAAERARREEGAGAICGPFAANRYGLVVIAEHIEDQARLENRFLVVGRES
                     PAPSGADKTSIMVSFLDDPGFLHRILGVFAERGINLSRIESRPTQERAWDYLFFIDME
                     GHRQDEGVSAALEALGALSGVSVKILGSYPQHAL"
     misc_feature    complement(194248..194475)
                     /locus_tag="Mmc1_0176"
                     /note="chorismate mutase domain of proteobacterial
                     P-protein, clade 2; Region: CM_P2; TIGR01807"
                     /db_xref="CDD:130866"
     misc_feature    complement(193420..194226)
                     /locus_tag="Mmc1_0176"
                     /note="Prephenate dehydratase [Amino acid transport and
                     metabolism]; Region: PheA; COG0077"
                     /db_xref="CDD:223155"
     misc_feature    complement(193681..194214)
                     /locus_tag="Mmc1_0176"
                     /note="Prephenate dehydratase; Region: PDT; pfam00800"
                     /db_xref="CDD:250142"
     misc_feature    complement(193420..193662)
                     /locus_tag="Mmc1_0176"
                     /note="C-terminal ACT domain of the bifunctional
                     chorismate mutase-prephenate dehydratase (CM-PDT) enzyme
                     and the prephenate dehydratase (PDT) enzyme; Region:
                     ACT_CM-PDT; cd04905"
                     /db_xref="CDD:153177"
     misc_feature    complement(order(193555..193566,193615..193626))
                     /locus_tag="Mmc1_0176"
                     /note="putative L-Phe binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153177"
     gene            194853..196163
                     /locus_tag="Mmc1_0177"
                     /db_xref="GeneID:4481557"
     CDS             194853..196163
                     /locus_tag="Mmc1_0177"
                     /note="TIGRFAM: ammonium transporter;
                     PFAM: Rh family protein/ammonium transporter;
                     KEGG: sde:Sde_2065 ammonium transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="YP_864110.1"
                     /db_xref="GI:117923493"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR010256"
                     /db_xref="GeneID:4481557"
                     /translation="MMRFSSHLLKGGALFALLLITPTWAWAAEQGLDKADTAWILTTT
                     ALVLFMTLPGLALFYGGLVRSKNILSILMQCFAIACLVSVLWLAGGYSLAFEHGGPLN
                     GVIGSLQKAFFAGVAHNTVKGSLPEGVFAAFQMTFAIITPALVIGGFAERIRFAVILP
                     FTALWLLLVYIPVCHWVWGGGWMQAAGVMDFAGGVVVHITAGVAALVAALVLGPRNGF
                     QKTVMFPHNLTMTYAGAAMLWVGWFGFNGGSALTADGSAGWAILATHMGAAAGSLAWM
                     GMEWMRHGKPSVLGIVTGMVAGLGTVTPASGYISPFGGFAIGLIAGVVCYLATMMVKQ
                     RWKIDDSLDVFPVHGVGGMIGTLMTALFAAPLFGGHGLASNAQILPQLATQGVAVGVT
                     ALYTAVVTWLIFKGLAQVMQLRVSRDQETEGLDLVDHDERGYNL"
     misc_feature    194946..196160
                     /locus_tag="Mmc1_0177"
                     /note="Ammonia permease [Inorganic ion transport and
                     metabolism]; Region: AmtB; COG0004"
                     /db_xref="CDD:223083"
     gene            complement(196232..197314)
                     /locus_tag="Mmc1_0178"
                     /db_xref="GeneID:4481558"
     CDS             complement(196232..197314)
                     /locus_tag="Mmc1_0178"
                     /note="KEGG: ljo:LJ0641 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864111.1"
                     /db_xref="GI:117923494"
                     /db_xref="GeneID:4481558"
                     /translation="MARPSWYKYASSLTSLLIATLLMVQLWSRSEQLEPIPWLPPEVS
                     QEAQPSLPLQVVQLPAPPVQTAATAQLPTPTAAPTLPQQSTAAHPPMPPLKPETNPVA
                     HPLLPTAMLNPVTPVQTIKPLKPSPLAPLEVTVQAMPQSSPSAAPLEIPAEARHALKP
                     HPKPVTQEAMPRVTPETTLQPANPTPQPTEVQVQQGRVLLKLLEHGKGPSITLRWPNQ
                     QRQTLYRHMVQCRGMRSGVMDAQQHIFMPGGTPGVAWSINRDRYSGFMRLTNQVENQE
                     RLQLQEIRHYHGLESATTPIRLFPRRFDAALLGGLQHLIGPTYGTARSIEANYRLQQG
                     RLWVEAIKVDGGAVAGQIDLNLHPCL"
     misc_feature    complement(<196952..197167)
                     /locus_tag="Mmc1_0178"
                     /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
                     /db_xref="CDD:260222"
     gene            complement(197339..198001)
                     /locus_tag="Mmc1_0179"
                     /db_xref="GeneID:4483460"
     CDS             complement(197339..198001)
                     /locus_tag="Mmc1_0179"
                     /note="KEGG: rno:304601 bromodomain adjacent to zinc
                     finger domain, 2A (predicted)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864112.1"
                     /db_xref="GI:117923495"
                     /db_xref="GeneID:4483460"
                     /translation="MKYLLFNVVVGAALLYLFAGPSNLPSLPSKPTAQLPHDLDRVAD
                     RMIKNLDQRLQENLIQRPQTQPAVEKRQPKSVPTPPNLEREASQLAEPSAPLAVSPQV
                     TPVSPPLPEQPAPPLFKAAPAARAIATKPQVDPPSQTEPPARVAVALEPAVMQRRAEV
                     LAGTGVVIPPEMIVEHHTTPNKVAVKLAEGESLMSPHNRRRELRALANDMESLYIDIL
                     TQ"
     gene            complement(197982..198572)
                     /locus_tag="Mmc1_0180"
                     /db_xref="GeneID:4483461"
     CDS             complement(197982..198572)
                     /locus_tag="Mmc1_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864113.1"
                     /db_xref="GI:117923496"
                     /db_xref="GeneID:4483461"
                     /translation="MALPAPLQQGSAALSYLLGGVALALALATLATSLQVTDIIAWLK
                     QVFGVTFLVLMSILLVIALTAWIHVWRSAATPESDGVWLESGMQAANGVTTLALTYTL
                     LGISLGIGSLADQALTPETVQSIVGELTAHFSLAFMTTVVGLPLSAVLRAMLMVSHAH
                     NVACWQHLAVMSQPQPLTAILMDADEEEKHHEIPAV"
     gene            complement(198575..198955)
                     /locus_tag="Mmc1_0181"
                     /db_xref="GeneID:4483462"
     CDS             complement(198575..198955)
                     /locus_tag="Mmc1_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864114.1"
                     /db_xref="GI:117923497"
                     /db_xref="GeneID:4483462"
                     /translation="MTIQQTLAAMALLLVSTTAQGGTLDNLERERAILIGTLLSPEIT
                     YAERETKVNHSTRRLVDLERMVWRDSNLAKEGGPSVKKALDNFDLTFLVHASIEKDRL
                     VVDHWLEQLGLTSTTLSTARMGRR"
     misc_feature    complement(198812..>198886)
                     /locus_tag="Mmc1_0181"
                     /note="Atrophin-1 family; Region: Atrophin-1; pfam03154"
                     /db_xref="CDD:251763"
     gene            complement(198968..199864)
                     /locus_tag="Mmc1_0182"
                     /db_xref="GeneID:4483463"
     CDS             complement(198968..199864)
                     /locus_tag="Mmc1_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864115.1"
                     /db_xref="GI:117923498"
                     /db_xref="GeneID:4483463"
                     /translation="MNSLRRCKPVTLGTLLLMAALMGHAQAASDQDTAQWRPQISEKL
                     IRLPPNMMNNALERDYADSGLAMAISDVGAQVGLKRQTLTDLKQAVQKADGDLKVEMQ
                     HQYLAEKRQFVTLMQQHLDLRKKRQQIKLDTYQRLMQQLRTAKESTPKEVTELQTKQE
                     NLQKRFERSVSKVDMKIFGTPDGESMPSRYNTVYQANQQAMHKLLAALEAHPMNRELD
                     NHALEPESKQDFLRNLMVESEKEMALVSQERTILGYMAKMVALDALSLSEKVQDPDLL
                     DSDVPADAQITTSVDLFVSDEK"
     gene            complement(199864..200442)
                     /locus_tag="Mmc1_0183"
                     /db_xref="GeneID:4483464"
     CDS             complement(199864..200442)
                     /locus_tag="Mmc1_0183"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864116.1"
                     /db_xref="GI:117923499"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4483464"
                     /translation="MSKTVSPLSFGRAVALLLALTGLSGCASPGLPMGTLSPTEGVGF
                     RESRFAALEALQNYRQCKQEALTMDREARSSGQAARYLASARLFEQCETRLPPGSADV
                     ATEERMRAYAVGILDYIKAGDLEQAHVNLDKFRRTFKDQDLYLKGGASFVDSMEILLR
                     RTDPDQFPRYSLLNVDSTLKDEMRRLNHWSHN"
     misc_feature    complement(<199945..200235)
                     /locus_tag="Mmc1_0183"
                     /note="Outer membrane lipoprotein; Region: YfiO;
                     pfam13525"
                     /db_xref="CDD:205703"
     gene            complement(200822..202267)
                     /locus_tag="Mmc1_0184"
                     /db_xref="GeneID:4483465"
     CDS             complement(200822..202267)
                     /locus_tag="Mmc1_0184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864117.1"
                     /db_xref="GI:117923500"
                     /db_xref="GeneID:4483465"
                     /translation="MSIRVIIATTEGPVTVQRITLEDPDLQSVVCLNGTTRALPISGD
                     YDAFVRPPTGMIQDDFTQAAYRLDLSDTIDQGFSWQLGAYAAHLLFYHEELAQRDEPA
                     QAVWWLTGQVDRDHTVRGVEHVAEKFQESALLFRALVAQGIPIHLFLPTANQADIDLD
                     LLDELASPDLIQITTLEQVEQLPNPGKRIAAAASLPLTLGTPPRLPVHAPVLTQPQAK
                     ATPWLKGLLVVQLMVFAGLIWFAWQQGLPSWVVWAKSQDYAHRLQLQAALTTNQCDVC
                     QRLFHLYMDRQGGIQPIDPPQLSLERIVIQAPDSVRGCREMDHPPPGQAVQPQVSVLA
                     AQDETLPILMANRHLCQFKFRVVNGEETVHTRLWVIAKSDLPRSRNQTDEEGSRFWKM
                     ERALDAEETLLWNSPRVGPWIRTPLNYQVLILAARTPLESATTWLKESRRQARAAGQT
                     WDWHTAQQQLAKLGVHLMQVNQPLHPMARQL"
     gene            complement(202264..202779)
                     /locus_tag="Mmc1_0185"
                     /db_xref="GeneID:4483466"
     CDS             complement(202264..202779)
                     /locus_tag="Mmc1_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864118.1"
                     /db_xref="GI:117923501"
                     /db_xref="GeneID:4483466"
                     /translation="MKQSARDATTATLFTALSQLDTLRQPRDEHVERPIGYTQLMQYI
                     QGDGPTSLAVVRALKADAKLKASYHQLLQRRAMCYFPAVVAASSGEINERQTDGWKIR
                     WKTSRADANQIYLLIELKPHMERTPTKLTVEEERITLPEPVNGTIQLLVEANCAIMQG
                     LRNKDSKVYLH"
     gene            complement(202776..204407)
                     /locus_tag="Mmc1_0186"
                     /db_xref="GeneID:4483467"
     CDS             complement(202776..204407)
                     /locus_tag="Mmc1_0186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864119.1"
                     /db_xref="GI:117923502"
                     /db_xref="GeneID:4483467"
                     /translation="MNQGWASERMLLQEGISDHLLGLLSMVAETEQDGDIKFPPQTCH
                     ELQRMLVCRTYAQSMIELCYLLRAGHACGDHVTLFWEVGAARSQRFRHYFNERLPAQQ
                     VTAESSGVVIADQQDRFTVHYSRMPLLAALWEFLFSALDYAQLDESITTMLMHHGDSR
                     QATSQCANQLARLLYAFLKDHLPEAQQQRKFRRITQFIQNYTNNHTFAPDALDNSAIL
                     QFWQQFSLGHDEDGGDFKKFETVYHDFLNYRRALRAAIHQQALMHTHVLGTDRDAGEW
                     EPDSEQSAALWETLRELDEEASPLHHLNTPPCDEIKFFNNREQNLLKRIVEGNRDAND
                     LALSLLRCELFGHTQACIVQALRQKVEGADLLKTIAEINTPSYRQHQQSMQDIAHHLT
                     RVQYASLHLLLYHQEAESIRLILNLYPDLDLSKGREHHTESVGDEGSMDGVAQLRSIL
                     EQQGVWQSVQREAARAYKGIARQGFRDNEMDSPTICAGHAQAAPLLEQMDKLLSRFLT
                     TLHHLFPDENEADTLFAADRAAFTRQFRRMYGGES"
     gene            complement(204404..204901)
                     /locus_tag="Mmc1_0187"
                     /db_xref="GeneID:4483468"
     CDS             complement(204404..204901)
                     /locus_tag="Mmc1_0187"
                     /note="PFAM: lytic transglycosylase, catalytic;
                     KEGG: gsu:GSU1826 lytic murein transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase, catalytic"
                     /protein_id="YP_864120.1"
                     /db_xref="GI:117923503"
                     /db_xref="InterPro:IPR000189"
                     /db_xref="InterPro:IPR008258"
                     /db_xref="GeneID:4483468"
                     /translation="MIRSLLILICLMFSFSQPLLASPKQQRQQIQQLIIEEAKNLNIP
                     ISLALAVAHVESYFDPQVESHKGACGVMQIMPATAMGEYGIPKNMLWNPKINVRLGLH
                     FLQRLLQRYKGRVNLALSYYNGGSRVGDLPHAHIIPATRPYVAKVRHWQKQYQYKLYH
                     GLDLL"
     misc_feature    complement(204458..>204790)
                     /locus_tag="Mmc1_0187"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(204446..204766)
                     /locus_tag="Mmc1_0187"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(204536..204538,204593..204595,
                     204677..204679,204737..204739))
                     /locus_tag="Mmc1_0187"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(204737..204739)
                     /locus_tag="Mmc1_0187"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(205097..205366)
                     /locus_tag="Mmc1_0188"
                     /db_xref="GeneID:4483469"
     CDS             complement(205097..205366)
                     /locus_tag="Mmc1_0188"
                     /note="KEGG: dme:CG10910-PB CG10910 gene product from
                     transcript CG10910-RB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864121.1"
                     /db_xref="GI:117923504"
                     /db_xref="GeneID:4483469"
                     /translation="MGTRALGETTHGPWALGETTHGPWALGETTHGPWALGETTHGPW
                     ALGETTHGPWALGETTHGPWALGETTHGPWALGETTHGPWALGYP"
     gene            complement(205704..206516)
                     /locus_tag="Mmc1_0189"
                     /db_xref="GeneID:4483470"
     CDS             complement(205704..206516)
                     /locus_tag="Mmc1_0189"
                     /note="PFAM: lytic transglycosylase, catalytic;
                     KEGG: chy:CHY_0404 transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase, catalytic"
                     /protein_id="YP_864122.1"
                     /db_xref="GI:117923505"
                     /db_xref="InterPro:IPR008258"
                     /db_xref="GeneID:4483470"
                     /translation="MKMRRGGHLLMRGVVVAGMALVVVMPIRGQAATRQEVKEMVVQE
                     AMRQDVPSTLALAVAKVGSDFQGLAQSKQDAQGVMQLPPNLVERLMVRVTDLSQDQLQ
                     RPQVNIRYGVTYLKLLLKQYGENWEKALLHYLSGERPDRVSGGMVLEKEQETVLSMLR
                     WEKRYRDQMSVWQAATGVEVEKLTEQVSVLSRDLRAAREQSRVEDEDWYAPPPSMRGR
                     RGPPGHRHGFRGRGSHPHPPPPPHWRGGAAGDAADFWYGSGLKGGRAGMQWN"
     misc_feature    complement(206076..>206411)
                     /locus_tag="Mmc1_0189"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(206064..206357)
                     /locus_tag="Mmc1_0189"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(206118..206120,206175..206177,
                     206271..206273,206331..206333))
                     /locus_tag="Mmc1_0189"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(206331..206333)
                     /locus_tag="Mmc1_0189"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(206550..206840)
                     /locus_tag="Mmc1_0190"
                     /db_xref="GeneID:4483471"
     CDS             complement(206550..206840)
                     /locus_tag="Mmc1_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864123.1"
                     /db_xref="GI:117923506"
                     /db_xref="GeneID:4483471"
                     /translation="MKKLMLTIAMAAAMGAMMVPVKQAEAASIYFVNNYGNDKQSRWE
                     GKHNRHNQMIQRSVRHSLVESTRNPMWRDAVVKIVRERGSISRVVVILPQGF"
     gene            complement(206837..207253)
                     /locus_tag="Mmc1_0191"
                     /db_xref="GeneID:4483472"
     CDS             complement(206837..207253)
                     /locus_tag="Mmc1_0191"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864124.1"
                     /db_xref="GI:117923507"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="GeneID:4483472"
                     /translation="MDNHTTNNAMTEIALALAMGFFSIMVLAMVSMGGGVGSANKIAG
                     AVMAASDNAQTPKAVVEVQEQDRMILYYNGHFFDQNMHQVKPETLPQGGRTILALAPE
                     TSMTQALKLRGLFGQRDVIVSTLDTRWIRALQEKTP"
     misc_feature    complement(207071..>207244)
                     /locus_tag="Mmc1_0191"
                     /note="S-AdoMet dependent tetrapyrrole methylases; Region:
                     TP_methylase; cl00304"
                     /db_xref="CDD:260339"
     gene            207565..208800
                     /locus_tag="Mmc1_0192"
                     /db_xref="GeneID:4483473"
     CDS             207565..208800
                     /locus_tag="Mmc1_0192"
                     /note="KEGG: cps:CPS_3260 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864125.1"
                     /db_xref="GI:117923508"
                     /db_xref="GeneID:4483473"
                     /translation="MYRFAKAGWCSLFILLLLYNPAAMAAPLAPYHIYMDADWSGANP
                     SSQAIEWGIRTALDERNNTIAGHPVKIVRANHRGNNRRHLRNQQIFLDDARALLVYSG
                     LHSPPLLANKKFINDHAILTLNPWAAAGPITRSLAPNWIFRLSIDDAVAGQVIVHHAL
                     TKRGFKKLVLIAEDTSWGRFNHQNMSKKANEYGMEELPVIWSNWGISKAAAKIILRQA
                     ASMGADAVLLVVNPAESITFATAMAELEPQRRRPIQSHWGVSAGSFSQKVGENVLKVL
                     DLEYVQTRFSFLNGMLSEHAKQVLARAMRLFPDAIKTPQHIRPPAGFKHAYDLTRILL
                     AAADQVQLSGDVKQDRLLLHHALEHLQTPVQGLIKTYHMPFSPPKSDTSDDHEALHIH
                     DFTMATFDVLGNVQIQQEP"
     misc_feature    207658..208752
                     /locus_tag="Mmc1_0192"
                     /note="Type I periplasmic ligand-binding domain of
                     uncharacterized ABC (ATPase Binding Cassette)-type active
                     transport systems that are predicted to be involved in
                     transport of amino acids, peptides, or inorganic ions;
                     Region: PBP1_ABC_ligand_binding_like_2; cd06335"
                     /db_xref="CDD:107330"
     misc_feature    order(207871..207879,207940..207948,208093..208095,
                     208255..208257,208333..208335)
                     /locus_tag="Mmc1_0192"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107330"
     gene            208802..211576
                     /locus_tag="Mmc1_0193"
                     /db_xref="GeneID:4483474"
     CDS             208802..211576
                     /locus_tag="Mmc1_0193"
                     /note="KEGG: tbd:Tbd_1456  diguanylate
                     cyclase/phosphodiesterase (GGDEF & EAL domains) with
                     PAS/PAC sensor(s);
                     TIGRFAM: PAS sensor protein; diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; histidine kinase,
                     HAMP region domain protein; PAS fold-3 domain protein;
                     hypothetical protein; PAS fold domain protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor-containing diguanylate cyclase"
                     /protein_id="YP_864126.1"
                     /db_xref="GI:117923509"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4483474"
                     /translation="MECPPYRLSLSKRFGLVIGMALLVVALLLGTMLAQGMDRNFEQQ
                     LQHLHELHLNRLAQQLRQYIQSRLTVLADMAANPLTIQGVLQPETSLLNTIDWLQNSR
                     LIGESFPLILMDYQGQILHQTVGDEQPAPTAVRAVLGGKQTQIQYLEGDHLNGDHQLW
                     LITPVRWQASIEGALAVRIPLQHISPLTAQQGHFNHDGIRLWQGNRLLFSQGQMENGY
                     SSRKILGELGLTIELVMDQKPLIKARSKLFRETLIVGILLLLLLSVTLYYWGQKRLVR
                     PLMALSRQVDAVTKGDDPAPPMGTKMGTTIVEIIQLGEKFDHMHKEITATRRHLESLV
                     NERTQALQIELQERTRTAAELRLLNDLQEAILESADAMIIATDAAGTVIKFNKAAQHK
                     LGYADHEVIYRLTLDAFHDPMELQHRHLPVTEGDTQNLSIPLQTLFSRAAQNRTDERE
                     WRYRRQDGTTFPVRLSITQVWDVESNNRRGFLVVGMDITELKSFQQALLRNQANLAHA
                     QAIAHLGSWQWELENGRMHWSDETFRIFGEPLQSFEPTFEDILSRTHPQDMKSLEQMV
                     TRALANPEIPFEMEARLRRANGDLRSVVMLGEVTYDQNRKPIRVSGTVQDITERKKAE
                     DSLQLAKQIIECTSEAIVITDAQGIITDINPAYEEITGYSRGEVIGQSPAITQSGRHD
                     PTFYQQLWHLLQQTGHWEGEMWDRRKNGELFPKWLTINALHNLYGQVSHYVGIFLDIT
                     KQRGEIERSKQNVFYDPLTKLPNRILFQDRLEHILAVAAHKQERIGLFFIDLDHFKQV
                     NINIGHDVGDLLLVEVGKRLRRHLPPSDTVAHLVGDKFAIILPHSRTRTELAQLAETI
                     LHLFDESFLIRDHNLSIGCTIGIAVSPADGTVYPELARNSNTALYRTKGLTRGRFAFY
                     SEEISSSPMP"
     misc_feature    209888..210295
                     /locus_tag="Mmc1_0193"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    209906..210265
                     /locus_tag="Mmc1_0193"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(209954..209956,209966..209968,209984..209986,
                     210023..210034,210158..210160,210173..210175)
                     /locus_tag="Mmc1_0193"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(210014..210016,210026..210028,210050..210052,
                     210107..210112,210194..210196,210200..210202)
                     /locus_tag="Mmc1_0193"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    210365..210652
                     /locus_tag="Mmc1_0193"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    210374..210643
                     /locus_tag="Mmc1_0193"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    order(210383..210385,210395..210397,210413..210415,
                     210458..210469,210548..210550,210563..210565)
                     /locus_tag="Mmc1_0193"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(210449..210451,210461..210463,210485..210487,
                     210494..210499,210584..210586,210590..210592)
                     /locus_tag="Mmc1_0193"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    210710..211018
                     /locus_tag="Mmc1_0193"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    210713..211024
                     /locus_tag="Mmc1_0193"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    order(210758..210760,210770..210772,210788..210790,
                     210827..210838,210914..210916,210929..210931)
                     /locus_tag="Mmc1_0193"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(210818..210820,210830..210832,210854..210856,
                     210863..210868,210950..210952,210956..210958)
                     /locus_tag="Mmc1_0193"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    211061..211537
                     /locus_tag="Mmc1_0193"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(211172..211174,211301..211303)
                     /locus_tag="Mmc1_0193"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(211187..211189,211196..211201,211211..211213,
                     211223..211225,211289..211291,211295..211306)
                     /locus_tag="Mmc1_0193"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(211277..211279,211364..211366)
                     /locus_tag="Mmc1_0193"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            211950..215048
                     /locus_tag="Mmc1_0194"
                     /db_xref="GeneID:4483475"
     CDS             211950..215048
                     /locus_tag="Mmc1_0194"
                     /note="TIGRFAM: hemerythrin-like metal-binding protein;
                     PFAM: histidine kinase, HAMP region domain protein;
                     chemotaxis sensory transducer; hemerythrin HHE cation
                     binding domain protein;
                     KEGG: dde:Dde_0703 methyl-accepting chemotaxis sensory
                     transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_864127.1"
                     /db_xref="GI:117923510"
                     /db_xref="InterPro:IPR002063"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR012312"
                     /db_xref="InterPro:IPR012827"
                     /db_xref="GeneID:4483475"
                     /translation="MKLKTKLITPVILLLVVTALVVLQVSSTALQQNTHILLDEQISA
                     KMVSVDQNIERMSNTALLASAIIANLPQVKEAYTLQTSDEAAARKLLAEHMAPIKKTV
                     EQITGMKQFRVHFHLPPVRSFLRIWNGTGGDDLSSFRNTVQQINVQGKPLKGIEIGRG
                     GFVLRGIAPIMNDAGVQVGSLETLLPMAEVMKKSKVLATEELAILLHDRYLSIAKKLE
                     KSNPKRAGKFVYTGSTKGFLADLVEPEALLSAMQSDQKRAHKQHTLAYHSIRDFSGAP
                     VGVAVYQLDHRKVLANQQQMITRLIVIILILMLFAGLAYALLIARFVKRIFHIAEEIG
                     GITGGDVTRRLAIATKPDELGAIGGNFNKMVHSLASTLRRVSLQAESLTAAVRQLGEV
                     KTVLTEDATAIRSRANQTDEETQHQVEVVAKIHQAVKETNTYMDNIALQSGDLAHSMD
                     EVANDAESVSSNVTTMAAAAEQMSMNVGGMQRNIEQVSQSMVSVNTAVEELRHALGGV
                     AQRCQHARSESDRASQQSDETREAIEHLSGYTKEIGKVVELINAIAEQTNMLALNAAI
                     EAAGAGEAGKGFAVVANEVKELATQTSSATQSIADQINAIQKQTRVVYDATGDVEQIV
                     QNINSANMEIAEAVAMQTLAITEINHSVEAVREASNTTSGMAGELASAATEVAQSASM
                     AAGGVERIANSAAASAHATHEVTAASERAKQQIEQLFLVAQEVSTGVTNVEQNMSEVK
                     DLSRYMEASVLQFGTLVDMVSNSTENLNTTMIALNWGEAPFDVEGVKKAHLNWLTRLS
                     HVIMRRTAMRAEEVTDAHHCELGKWMDREGQEQFGQTPVWQEAVKVHERIHELAKEVV
                     KASNAGNLEQANKLFADFNAYRINLFENLDAIFVGPEVDAEPIAVVWKPNMSVGVQIF
                     DQDHRRLVSYINRLELAHRAGQSKTALERVLRALTDYTLIHFRREEKMMTESNYPGVQ
                     AHKAQHTKLEDQVADYNRRMLQEESHITEEVLTFLKGEFLDHIMRTDHEYSDHFRSKG
                     II"
     misc_feature    <213138..213380
                     /locus_tag="Mmc1_0194"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    213252..213992
                     /locus_tag="Mmc1_0194"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    213279..214019
                     /locus_tag="Mmc1_0194"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    order(213300..213305,213312..213317,213324..213326,
                     213333..213338,213342..213347,213354..213356,
                     213363..213365,213384..213386,213393..213395,
                     213405..213410,213417..213422,213429..213431,
                     213438..213443,213531..213536,213546..213548,
                     213552..213557,213564..213566,213573..213578,
                     213585..213590,213597..213599,213606..213608,
                     213615..213620,213627..213629,213639..213641,
                     213648..213650,213669..213671,213681..213683,
                     213690..213692,213699..213704,213711..213713,
                     213720..213725,213732..213737,213741..213746,
                     213753..213758,213804..213809,213816..213818,
                     213825..213830,213849..213851,213858..213863,
                     213867..213872,213879..213884,213891..213893,
                     213900..213905,213912..213914,213942..213947,
                     213951..213956,213963..213968,213972..213977,
                     213984..213986,213993..213998,214005..214007,
                     214014..214019)
                     /locus_tag="Mmc1_0194"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    213615..213716
                     /locus_tag="Mmc1_0194"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     misc_feature    214308..214523
                     /locus_tag="Mmc1_0194"
                     /note="Chemoreceptor zinc-binding domain; Region: CZB;
                     pfam13682"
                     /db_xref="CDD:257985"
     misc_feature    214683..215021
                     /locus_tag="Mmc1_0194"
                     /note="Hemerythrin; Region: Hemerythrin; cd12107"
                     /db_xref="CDD:213982"
     misc_feature    order(214701..214703,214812..214814,214824..214826,
                     214869..214871,214881..214883,214989..214991,
                     215004..215006)
                     /locus_tag="Mmc1_0194"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:213982"
     gene            complement(215224..215565)
                     /locus_tag="Mmc1_0195"
                     /db_xref="GeneID:4483476"
     CDS             complement(215224..215565)
                     /locus_tag="Mmc1_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864128.1"
                     /db_xref="GI:117923511"
                     /db_xref="GeneID:4483476"
                     /translation="MHKFTLAKFLARHALIGFFMSAILVTAMVYWDFQHMGTLILSSA
                     APALVLGVLTFFVGLTLASAQMAIAVMLLAEPEDNGTRGKFIGLVVDWLTPPRPMVPV
                     PVKANRHPPQR"
     gene            complement(216041..216388)
                     /locus_tag="Mmc1_0196"
                     /db_xref="GeneID:4483477"
     CDS             complement(216041..216388)
                     /locus_tag="Mmc1_0196"
                     /note="PFAM: sulfate transporter/antisigma-factor
                     antagonist STAS;
                     KEGG: psb:Psyr_3452 sulfate transporter/antisigma-factor
                     antagonist STAS"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma-factor antagonist"
                     /protein_id="YP_864129.1"
                     /db_xref="GI:117923512"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="GeneID:4483477"
                     /translation="MLTLHKEVQEGVVILILEGRFDVSSIETFQEAYADQPPGTIFKI
                     HLDKVTYIDSAAFGLFHALKQHLGNLGRVMLYNPSDEVTHAIQVLGAHRSFEIMRFTT
                     HKPLMHHGDDDGF"
     misc_feature    complement(216098..216379)
                     /locus_tag="Mmc1_0196"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist) domain of anti-anti-sigma factors, key
                     regulators of anti-sigma factors by phosphorylation;
                     Region: STAS_anti-anti-sigma_factors; cd07043"
                     /db_xref="CDD:132914"
     misc_feature    complement(order(216116..216118,216122..216127,
                     216137..216139,216200..216205,216212..216220,
                     216224..216232,216236..216238,216299..216301,
                     216317..216325,216329..216331))
                     /locus_tag="Mmc1_0196"
                     /note="anti sigma factor interaction site; other site"
                     /db_xref="CDD:132914"
     misc_feature    complement(216227..216229)
                     /locus_tag="Mmc1_0196"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:132914"
     gene            complement(216566..217792)
                     /locus_tag="Mmc1_0197"
                     /db_xref="GeneID:4483443"
     CDS             complement(216566..217792)
                     /locus_tag="Mmc1_0197"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864130.1"
                     /db_xref="GI:117923513"
                     /db_xref="GeneID:4483443"
                     /translation="MCDYPSIHTEPACFGAERFSMLRVVLRYTLLLLVMVVALLLYMA
                     QSPFPDGVLRVALDAPMDNYSRPMTSLWQKNRYFAWRSSQGMLFIGQRQQDGQFEATQ
                     LGDTLPHQRQPILHVVQSGPHAGIVVVAYHDAQGHLLVQQTRRPADTRAWNPPQLVVD
                     EEVTHINLLENPAGELLLVYQQPLGEQNQIFIRFSHDGGRQWGSATLLAHHSGTQKDQ
                     LLVAGTPLASGYQISLFMLQPQAAAQSLHLLQGVIPTGSRSWQPIENKPLTKILATQP
                     NTHYTLQDLRVNGAWLRLLWRDDTLGVGHWLGWHQGEVHLHNLGAVAAAPCGMTLPQN
                     PLEVTLLRKAQVQQISLQDNTMQVVHVAPAQLGKGCHMYGIPDGEDLDLLLSHQAAPN
                     RPSALLGLSWRRLEQP"
     gene            217909..219450
                     /locus_tag="Mmc1_0198"
                     /db_xref="GeneID:4483444"
     CDS             217909..219450
                     /locus_tag="Mmc1_0198"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type;
                     SMART: ATPase AAA;
                     KEGG: gme:Gmet_0339 sigma54 specific transcriptional
                     regulator with PAS sensor, fis family"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent trancsriptional regulator"
                     /protein_id="YP_864131.1"
                     /db_xref="GI:117923514"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4483444"
                     /translation="MDDAEFLEGLLQLEAELEQRPAAGERHDYTMLTSFYLESLPRAM
                     HCDAVQLYLLEANQWYRMLANPLHGEPITLESGSTIPACIESHQALITRQPGHQARLC
                     MPLVSRVRRRVLGVIELLRFGEQAQFTAADLTRLEPGAENLCQALDNLLVTGALVTQP
                     GQPSQPPPPVDVTIRSVGVVAESAVMREVFTLANTLSAVPVNVFISGENGTGKEVVSR
                     YIHDNSTEGEQPFVAVNCAAIPESLAESEFFGYEKGAFTGAVGSRKGHFEAANGGVLF
                     LDEIADLPLSIQPKFLRALQEQEGQRLGGQKSVPYHFRVISATNKDIRQEVAAGRFRE
                     DLFYRLFAVDIHIPPLRERREEILPLARAFLRDINQRFGKKVPGLNPEVAERFERYHW
                     PGNVRQLRREMERLVALTPDGASIGLAACSPELRHSSPVPPALESSTLPLSGSLLTPT
                     AAVFPLHPHLPMAQQMVLFERHLIETALQQHNHNRTHAAQQLGITRQWLLKRLRYYEQ
                     LDQTT"
     misc_feature    218017..219417
                     /locus_tag="Mmc1_0198"
                     /note="anaerobic nitric oxide reductase transcription
                     regulator; Provisional; Region: PRK05022"
                     /db_xref="CDD:235331"
     misc_feature    218017..218355
                     /locus_tag="Mmc1_0198"
                     /note="GAF domain; Region: GAF; cl17456"
                     /db_xref="CDD:266697"
     misc_feature    218497..218955
                     /locus_tag="Mmc1_0198"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    218527..218550
                     /locus_tag="Mmc1_0198"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(218530..218553,218740..218742,218866..218868)
                     /locus_tag="Mmc1_0198"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    218728..218745
                     /locus_tag="Mmc1_0198"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    218923..218925
                     /locus_tag="Mmc1_0198"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    219313..219426
                     /locus_tag="Mmc1_0198"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(219479..221020)
                     /locus_tag="Mmc1_0199"
                     /db_xref="GeneID:4483445"
     CDS             complement(219479..221020)
                     /locus_tag="Mmc1_0199"
                     /note="PFAM: metal-dependent phosphohydrolase, HD sub
                     domain;
                     SMART: metal-dependent phosphohydrolase, HD region;
                     KEGG: dsy:DSY2161 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_864132.1"
                     /db_xref="GI:117923515"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:4483445"
                     /translation="MDRSWHTTTDTPYSRPKQRLSIPAMTAALHSQRPAAEKAYRLDD
                     TLHHAKLVLTRDVVLDGITYLTAGSDLESRTIVRLLNLGIDQVYAQPRIAERIKQCAS
                     RLDAMFDATRAVIFAEGVKSTRDALELLKRKGRLDLQPFKEQIGSLLEEIMDHYTEFA
                     AESIKELSEHDEPTVVHGVETALLCVELAKGLQWPKERLIQAGLAGMLHDVGKAAVSK
                     EILSHQGPLTDLQRQEVERHALIGYLMLSNNEQLHDLPAFCAGAHHESFQSGMPGYGI
                     LSDFSELQGDPRQRYTPQEQALAQLVCIADVYSALRQGYTLKGPVSPLETLIEMNRMA
                     ASGRFNPEFYRVWYTTFKRQHRLLLQKGLMIAMPPQLEGALHRADGTPFVLPQHEARI
                     SFEEIGRLQILPKLLAIGCKLPELKRHNGITCHLLERAGVALDTAQLQEMGITLHKPV
                     HYNLVLVDTDHVEQIQCLVIKQGDSLKDLHLAVGHKRLDNIQQQLLELRNLPIDFKPL
                     IGCPV"
     misc_feature    complement(220085..220507)
                     /locus_tag="Mmc1_0199"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(220103..220105,220391..220396,
                     220490..220492))
                     /locus_tag="Mmc1_0199"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(220391..220393)
                     /locus_tag="Mmc1_0199"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(221242..221682)
                     /locus_tag="Mmc1_0200"
                     /db_xref="GeneID:4483446"
     CDS             complement(221242..221682)
                     /locus_tag="Mmc1_0200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864133.1"
                     /db_xref="GI:117923516"
                     /db_xref="GeneID:4483446"
                     /translation="MFTFDICNIDGIGLPLAVVKGVGRLQRTTKPRSQPMFRQLWHQA
                     RQTIAQGCCVWHALVMALAVMVLGQGTPAVSAPPQPLATQRALYATTLVSRLYDPMLS
                     QRGVVGEGRWHHRNPSLYGEAQRRDVPRHTPPLYTGVEPANRHR"
     gene            222331..222588
                     /locus_tag="Mmc1_0201"
                     /db_xref="GeneID:4483447"
     CDS             222331..222588
                     /locus_tag="Mmc1_0201"
                     /note="PFAM: protein of unknown function DUF29;
                     KEGG: rru:Rru_A3570 protein of unknown function DUF29"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864134.1"
                     /db_xref="GI:117923517"
                     /db_xref="InterPro:IPR002636"
                     /db_xref="GeneID:4483447"
                     /translation="MGCLMRWEHQPEKRSLMWRLAISNLRNQMESTLQENESDLMDRL
                     DLNAVYRQLKPAIAREARTQVPDSCPYSVDDLVDPYFWPNE"
     misc_feature    <222340..222579
                     /locus_tag="Mmc1_0201"
                     /note="Domain of unknown function DUF29; Region: DUF29;
                     pfam01724"
                     /db_xref="CDD:250818"
     gene            222753..223202
                     /locus_tag="Mmc1_0202"
                     /db_xref="GeneID:4483448"
     CDS             222753..223202
                     /locus_tag="Mmc1_0202"
                     /note="KEGG: tbd:Tbd_1515 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864135.1"
                     /db_xref="GI:117923518"
                     /db_xref="GeneID:4483448"
                     /translation="MTLIPNFPHDGVITINRVLLKPQYSADDLQERVAELCENVKTYH
                     STTGFVGGMVTMNSGKISNEGSDVGQAVVSPLQGREALIITFWRSYAEHESSHRSETF
                     QPLFAKVLELCENGNEEIAYDMLWAGQAYDAETAQAAQAQKARYAMA"
     gene            223407..224483
                     /locus_tag="Mmc1_0203"
                     /db_xref="GeneID:4483449"
     CDS             223407..224483
                     /locus_tag="Mmc1_0203"
                     /note="PFAM: Sel1 domain protein repeat-containing
                     protein;
                     KEGG: nmu:Nmul_A0104 Sel1-like repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein"
                     /protein_id="YP_864136.1"
                     /db_xref="GI:117923519"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="GeneID:4483449"
                     /translation="MYRWMLILMLCIPRGLYGAALPWQEVQSAAVGGHVEAQRMLGQF
                     YLEGEGGVEKDPKRAGYWLEKAARGGDGLAQSLYGYLLSQGLGRAVDEEGAVYWYRLA
                     AAQGEPKAMIALALKYRAGLGVKRDARQAVQLFRQAAELGDGRAQYYLGDHLARGEGI
                     PRDGAQAAQWYERAARSGSLLAALALGQMLEQGKGVQADGAMARHWYEQAAQGGHAEA
                     QFRLALMWEEGRGGVRDVAVAVDWYRKAAAQGDTRGAVNLGYLLAHGVGAPRDEQQAV
                     ALYTQAAQGGSATAMYNLGVRYSMGSGVKQDLIAAYQWFHLAWQQHYKGADAAREQVA
                     MQLKGAQIAQARAQAAQWLSDKGR"
     misc_feature    223509..223619
                     /locus_tag="Mmc1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    223563..224279
                     /locus_tag="Mmc1_0203"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    223728..223835
                     /locus_tag="Mmc1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    223842..223943
                     /locus_tag="Mmc1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    223950..224051
                     /locus_tag="Mmc1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    224052..224159
                     /locus_tag="Mmc1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    224268..224360
                     /locus_tag="Mmc1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            224619..225653
                     /locus_tag="Mmc1_0204"
                     /db_xref="GeneID:4483450"
     CDS             224619..225653
                     /locus_tag="Mmc1_0204"
                     /note="PFAM: Sel1 domain protein repeat-containing
                     protein;
                     KEGG: noc:Noc_2705 Sel1-like repeat protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein"
                     /protein_id="YP_864137.1"
                     /db_xref="GI:117923520"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="GeneID:4483450"
                     /translation="MLLRILTIPLMITLLLFGAALAEAQTPSAEALPVELQGLKTRAQ
                     DGDHEAQYRWGLILAEGKGVPQDLNGAYSWFYTSATAGHAAAQFHLANMYLTGKGTEQ
                     DDQAAFDWFQKSARQGHPLSQYNLGLMYFKQRGPDQDKDAPLKWFTRAANQNFPLAQF
                     NLGVMYFQQNRAPINYVESFMWLDLAARNGMDEAEKLRTILGRRLSDDELVQAEASIQ
                     RWIESYGDVRGAGRSVIAAQRQASGKVILASLSRGMEYLKKRFFTTPANQNAYDQFQE
                     VLKVDSRNGSAQEGIARIADGYMDLVDRDIGLKHWKKARNYLNRAEEILKKGYGDSKR
                     LERLQTSLSQ"
     misc_feature    <224733..>225209
                     /locus_tag="Mmc1_0204"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    224760..224867
                     /locus_tag="Mmc1_0204"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    224868..224975
                     /locus_tag="Mmc1_0204"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    224976..225080
                     /locus_tag="Mmc1_0204"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    225084..225188
                     /locus_tag="Mmc1_0204"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            225892..226920
                     /locus_tag="Mmc1_0205"
                     /db_xref="GeneID:4483451"
     CDS             225892..226920
                     /locus_tag="Mmc1_0205"
                     /note="SMART: extracellular solute-binding protein, family
                     3;
                     KEGG: bja:blr4446 ABC transporter amino acid-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_864138.1"
                     /db_xref="GI:117923521"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:4483451"
                     /translation="MIRLVWIVGVLLLVVVGAPAQAAPASDTLDKVRARGLLNCGVMT
                     GTPAFSQQQPDGAWHGFFADWCRALAVAVLDDARAVHFIQVTPATRFKALTELQVDVV
                     MSNTTWTLSREYQYQVRFPAIYLYDGQAIATRKDTRWHTLAQANQATVCVEPNSTSHA
                     NLQEYAQRNNLNFNYLALNQQGIITAFLEHRCDLITDDRIALTANLKTTASNDQDYVV
                     FAETLSREPLAPMVRADDERWQRIVRMVVQALLVADEKGVSRDALKQNRERLSDPEVQ
                     RLLGSEDDPGQFVGLSRGWARRMIEAVGNYGELFARHLGAQSSLQMPRLLNRPWSRGG
                     LFYAPPFR"
     misc_feature    226003..226692
                     /locus_tag="Mmc1_0205"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    226003..226641
                     /locus_tag="Mmc1_0205"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     misc_feature    order(226027..226029,226150..226152,226225..226227,
                     226360..226362,226483..226485)
                     /locus_tag="Mmc1_0205"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(226432..226434,226444..226446,226462..226464)
                     /locus_tag="Mmc1_0205"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    226567..226584
                     /locus_tag="Mmc1_0205"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            226901..229216
                     /locus_tag="Mmc1_0206"
                     /db_xref="GeneID:4483452"
     CDS             226901..229216
                     /locus_tag="Mmc1_0206"
                     /note="PFAM: response regulator receiver; ATP-binding
                     region, ATPase domain protein domain protein; histidine
                     kinase, HAMP region domain protein; histidine kinase A
                     domain protein domain protein;
                     KEGG: pae:PA1611 probable sensor/response regulator
                     hybrid"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic sensor hybrid histidine kinase"
                     /protein_id="YP_864139.1"
                     /db_xref="GI:117923522"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4483452"
                     /translation="MLPPSVKKHLLGYTIARRLRRSIALLVLLVLVMSLLALLALYKF
                     QWGFQQTWQHDQVQLLIAADLNRQSERVGHIADTLLLAADRQSLEVQNELLENQLTLF
                     QQLTLTLRTAGRQAGLVHRVEQVYQSLGDSVRQLYRLQGRILALQNAKSHKIQQIMQH
                     YTQLQSTLLDQPSLGHYPQSQDRVLIGHLLWAGEARHEVLFEKRKAQVDHALANLREK
                     LEHYPQQREQWQPMLETLNSMVQNYLAQIPQWLLADRQRQGVMVENRRYITQFAETTQ
                     ALYDAYRQQVNNQARQQQSMMRWSIIIVVTLTLISLIILYLLVRYLLRDVLGRFAALH
                     DTMSSHAQGKSVPIVATGEDEISRMARAFALFVYKRAEAEQALSQAVEQAQRADRAKG
                     IFLATMSHEIRTPLHGIIGTSRQLNRMPLDRQVAHKAQVIEQASQALLGILNDVLDFS
                     KIDTEQLVLEEVVFDLPRMLQELYAVVHSQAEEKGLQLHLQLQEPLPRACRGDQTRLR
                     QILNNLLSNAIKFTQQGEVTLQVALTGETDPAPWVAFAVADTGIGIDEAHLERLFEPF
                     KQMDESINRRFGGTGLGLAISAKLAEAMGGSIRAKRRTEGGSLFTLMIPLRQVPIEQL
                     PKPAQSHMEAADAMPGLKILLAEDDPINQEVAIGILQEDGHQVHCANNGQQAYEMAQQ
                     QAYDLILMDLRMPIMDGLQATTKIRAAHTGLNHATPIFALTADVLKDSLQACRTAGMD
                     EVLTKPIHLQHLRYMLERVQPQHLSPPQERP"
     misc_feature    227093..229177
                     /locus_tag="Mmc1_0206"
                     /note="TMAO reductase sytem sensor TorS; Region:
                     TMAO_torS; TIGR02956"
                     /db_xref="CDD:234070"
     misc_feature    228062..228253
                     /locus_tag="Mmc1_0206"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(228080..228082,228092..228094,228104..228106,
                     228113..228115,228125..228127,228134..228136,
                     228182..228184,228194..228196,228203..228205,
                     228215..228217,228224..228226,228236..228238)
                     /locus_tag="Mmc1_0206"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    228098..228100
                     /locus_tag="Mmc1_0206"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    228419..228742
                     /locus_tag="Mmc1_0206"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(228437..228439,228449..228451,228458..228460,
                     228539..228541,228545..228547,228551..228553,
                     228557..228562,228641..228652,228698..228700,
                     228704..228706,228719..228724,228728..228730)
                     /locus_tag="Mmc1_0206"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    228449..228451
                     /locus_tag="Mmc1_0206"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(228551..228553,228557..228559,228641..228643,
                     228647..228649)
                     /locus_tag="Mmc1_0206"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    228830..229177
                     /locus_tag="Mmc1_0206"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(228839..228844,228971..228973,228995..228997,
                     229067..229069,229124..229126,229133..229138)
                     /locus_tag="Mmc1_0206"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    228971..228973
                     /locus_tag="Mmc1_0206"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(228980..228985,228989..228997)
                     /locus_tag="Mmc1_0206"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    229133..229141
                     /locus_tag="Mmc1_0206"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(229340..229681)
                     /locus_tag="Mmc1_0207"
                     /db_xref="GeneID:4483453"
     CDS             complement(229340..229681)
                     /locus_tag="Mmc1_0207"
                     /note="PFAM: Uncharacterized conserved protein UCP025560;
                     KEGG: son:SO2062 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864140.1"
                     /db_xref="GI:117923523"
                     /db_xref="InterPro:IPR008309"
                     /db_xref="GeneID:4483453"
                     /translation="MKLTVFLRRFVPFMLAMLLTTALQASPLDEAKQAGYLGEQGDGY
                     VGLVTPSAPSSAKQLMQEINLKRRDKYREIASKNNISLRSVEGVAGQKLIERADPGTY
                     VLSPSGGWLRR"
     misc_feature    complement(229343..229630)
                     /locus_tag="Mmc1_0207"
                     /note="Protein of unknown function (DUF1318); Region:
                     DUF1318; pfam07027"
                     /db_xref="CDD:254027"
     gene            complement(229710..229898)
                     /locus_tag="Mmc1_0208"
                     /db_xref="GeneID:4483454"
     CDS             complement(229710..229898)
                     /locus_tag="Mmc1_0208"
                     /note="KEGG: cch:Cag_1043 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864141.1"
                     /db_xref="GI:117923524"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4483454"
                     /translation="MRSPLLLTLLPVALLLGCSPRVSVEAPDKPITINLNVKIEHEVR
                     IKVEKDVDKLLDQSNDLF"
     misc_feature    complement(229716..>229850)
                     /locus_tag="Mmc1_0208"
                     /note="YnbE-like lipoprotein; Region: Lipoprotein_19;
                     pfam13617"
                     /db_xref="CDD:257930"
     gene            complement(230064..233459)
                     /locus_tag="Mmc1_0209"
                     /db_xref="GeneID:4483455"
     CDS             complement(230064..233459)
                     /locus_tag="Mmc1_0209"
                     /note="KEGG: rru:Rru_A1629 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864142.1"
                     /db_xref="GI:117923525"
                     /db_xref="GeneID:4483455"
                     /translation="MTQRFLSCAMVRFIPRRFNGAYSGNIGVMVSVQTVGRKSLRVLL
                     FTLTGLALLVSILLLVRLPLLNALLPHLLQQQGLPPLPVQITQLDLNRLVVGPTRSQD
                     GTLAWQRIELLYTPSLLLHGTLTALRLEGLQITLQQDAQGAIQWPMAQNQAPAQPSRA
                     EPFQLPTLPIDHVEIVHSQLQLNTPTGLLSAQLQGQLEHRLDHLHTLLQLSLPGLDMT
                     LKGALSLFPPYGVELQSDLKLDHFQPPLLPIPYAGSQLTGLAGLRLDGPLQALLEGSQ
                     WPRLQAQHQLRIAHAHHPGHLLLKGQSRLQGGPQGNLTLSGTLAGAALQAWTTNLPLP
                     PQSQIKGYSAYHLTASVEDWLKQGVVRQGWSRFGLQLNHPHQGEIALTGELTQPAGSD
                     AFKLHGQWAFNRLRGWQTLFQQPAATQLDGTMRYAVGGKFPLHAAWRPTLTLYPEFQL
                     TALQPGAATGNLTATLTAQPEPQGMGLTLHPDTQVTLQHPLPPSLQTWAKSLGSDGRW
                     VRIQAQLPQPLQLHWNGHQGLHLEGALQSNLALSAGGQLHATLSGSAQTQLDQPTQQL
                     RFNLEQLEVQLKQLEWHALQINKLQLHGHGAGRLADYQGELQLESHLDGTLPGGSRLK
                     QGRVAFKLPFSGGEDHLHAALSHCMSLEYATFTPSAGLVLEGQQSPLCIHAPKLHFNW
                     QQPTQPRLDLELIFPEHRTDLLIQQEKTPQLVQIRTPHMTLALTGSPTQWHASSTLLG
                     GRFKHKGQDLLVRDLDLQLQASADKGKITAHGTIAKVILRPMAATGQIAPFQYQGKLL
                     VQNDHLTLDGRLADLKGILNWDLRVNHSLPTGVGNAALVMTPLLLRAQGIQPKDLLRM
                     LKGKLEGVEGEVSLQSHLNWGAAERSDLTLRLHGVGMQTRPARLEGLDLTLELASLRP
                     PKSRQPHRLHIDLLDVGLPVRNIEAELLLRPDGVLVISWLKIPFANGWIKANHATFNL
                     KDAHHELLLEVENVDLAEMAKLVKLPGFTATGQLYGRMPVKMVGGRLLLDHATLFTHG
                     GGIIANQTLSAEALKAGGEQPSIVAKAMENLHYKQLTVTMDGDLAGALQVKVAAEGKN
                     PDLYQGHALILNLSVEGALGDLFNREMEGFDIPAMLKREGILQ"
     misc_feature    complement(230085..230693)
                     /locus_tag="Mmc1_0209"
                     /note="Dicarboxylate transport; Region: DctA-YdbH;
                     pfam11739"
                     /db_xref="CDD:256586"
     gene            233691..234956
                     /locus_tag="Mmc1_0210"
                     /db_xref="GeneID:4483456"
     CDS             233691..234956
                     /locus_tag="Mmc1_0210"
                     /note="KEGG: cbu:CBU_0937 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864143.1"
                     /db_xref="GI:117923526"
                     /db_xref="GeneID:4483456"
                     /translation="MTKKITVWVSGALFGTIPLPCMAAELPTVAEMWNIVLQQQQQME
                     QMHRQYQEVMVEQQLQLELLKQQIAQATLLMDQGQGGNTATSSGTSATGWTNRLTIGG
                     QVRVQASSTEHNGTSMSTLEHGSNIKVRLVELDVDAKINKWVKASTQLKYEHDGATAF
                     NVDQATITVGDSERYPMTLTVGKMTLPFGSYASSAIADPLTKELGEIVDAAALVAVKM
                     RGFTADFYLFNGPSQKQGDENSIDQWGGDLSYRYERGVFTAEVALHYVNSVENAGGIS
                     TAIAKVDSMTDMENYSAAWGLHGALTWQDTTLLGEYVQLMDAISSSTGSTGWNNSQLK
                     PSAWHGEISYTLPIGGKASNIALSYSGSDGAQAVGLMAQRVALHASVEVIENTAVQME
                     WSRDHDYDSSEGGSGNSADTTTLRLRVKF"
     misc_feature    234054..>234347
                     /locus_tag="Mmc1_0210"
                     /note="Phosphate-selective porin O and P; Region:
                     Porin_O_P; cl19535"
                     /db_xref="CDD:267888"
     gene            complement(235057..235353)
                     /locus_tag="Mmc1_0211"
                     /db_xref="GeneID:4483457"
     CDS             complement(235057..235353)
                     /locus_tag="Mmc1_0211"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864144.1"
                     /db_xref="GI:117923527"
                     /db_xref="GeneID:4483457"
                     /translation="MDGYAVVHEGHGVLGAGQDQAAAIAMARRHTDLTLDEAQLRHHF
                     DAIYGELYLLPATEALVQAVTTSQPLHTFKIRQFGLGWIVDLTGEGEDEGEEEA"
     gene            235613..236113
                     /locus_tag="Mmc1_0212"
                     /db_xref="GeneID:4483458"
     CDS             235613..236113
                     /locus_tag="Mmc1_0212"
                     /note="PFAM: protein of unknown function DUF336;
                     KEGG: tcx:Tcr_1731 protein of unknown function DUF336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864145.1"
                     /db_xref="GI:117923528"
                     /db_xref="InterPro:IPR005624"
                     /db_xref="GeneID:4483458"
                     /translation="MKKQIVIALAAAAILAQTPVYAGEEAAVVPLKKMTLKTASTIAH
                     KVIEACRLKGVQIGVTVMDRDGIPQAILRDTVAPPITLTISKGKAYAAAMFRVPSSQL
                     SQRAQSPIGRVPGVVMSAGAIPLEVGGIFLGSVGVSGAPSGETDEACAKEGAQGVLDE
                     LEMSMM"
     misc_feature    235715..236083
                     /locus_tag="Mmc1_0212"
                     /note="Domain of unknown function (DUF336); Region:
                     DUF336; cl01249"
                     /db_xref="CDD:260854"
     gene            complement(236260..236514)
                     /locus_tag="Mmc1_0213"
                     /db_xref="GeneID:4483459"
     CDS             complement(236260..236514)
                     /locus_tag="Mmc1_0213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864146.1"
                     /db_xref="GI:117923529"
                     /db_xref="GeneID:4483459"
                     /translation="MVYLLPIPVELYVRSLYGDGHNIGPENGNALSSRMTHGSICNAV
                     TTFITLIDGNQFADLMVRYSVGCLDEEILYIKKIDASFFS"
     misc_feature    complement(236263..>236373)
                     /locus_tag="Mmc1_0213"
                     /note="Restriction endonuclease [Defense mechanisms];
                     Region: Mrr; COG1715"
                     /db_xref="CDD:224629"
     gene            complement(236782..236994)
                     /locus_tag="Mmc1_0214"
                     /db_xref="GeneID:4483766"
     CDS             complement(236782..236994)
                     /locus_tag="Mmc1_0214"
                     /note="KEGG: mac:MA4541 Mrr restriction system protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Mrr restriction system protein"
                     /protein_id="YP_864147.1"
                     /db_xref="GI:117923530"
                     /db_xref="GeneID:4483766"
                     /translation="MRHVLELAAEGEVRIGDAVERIANRFGLTDEEKRTLLPSGKQAV
                     ISKRVQWASLISYKRGWFQRHAGRIL"
     misc_feature    complement(236806..236994)
                     /locus_tag="Mmc1_0214"
                     /note="Mrr N-terminal domain; Region: Mrr_N; pfam14338"
                     /db_xref="CDD:258511"
     gene            complement(237085..237648)
                     /locus_tag="Mmc1_0215"
                     /db_xref="GeneID:4483767"
     CDS             complement(237085..237648)
                     /locus_tag="Mmc1_0215"
                     /note="PFAM: regulatory protein, MarR; transcriptional
                     regulator TrmB; transcriptional regulator PadR family
                     protein;
                     KEGG: pha:PSHAa2967 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="TrmB family transcriptional regulator"
                     /protein_id="YP_864148.1"
                     /db_xref="GI:117923531"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR002831"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="GeneID:4483767"
                     /translation="MSVAPQQVTNRVLMTLRKIIRAIDMHSRYLVAQHDLTGPQAIIL
                     SEILQRGGITGAELAKQVHLSKGTISGILARLESKGLITRLRDEGDRRRFWLQATPKA
                     EQLLAQAPPLLQQSFVQKFNALAEHEQLGILTTLLHISDMMGADSLEAAQLLSTTPLL
                     VEVSRSEAIEGIRMDKEEPPTIEEEWE"
     misc_feature    complement(237238..237600)
                     /locus_tag="Mmc1_0215"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(237331..237522)
                     /locus_tag="Mmc1_0215"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(237331..237339,237343..237348,
                     237409..237411,237499..237501,237508..237513))
                     /locus_tag="Mmc1_0215"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(237346..237348,237478..237480,
                     237487..237489))
                     /locus_tag="Mmc1_0215"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(237367..237375,237388..237393,
                     237397..237399,237415..237420,237424..237429,
                     237436..237441,237445..237456,237481..237489))
                     /locus_tag="Mmc1_0215"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            237795..239591
                     /locus_tag="Mmc1_0216"
                     /db_xref="GeneID:4483768"
     CDS             237795..239591
                     /locus_tag="Mmc1_0216"
                     /EC_number="6.3.5.4"
                     /note="KEGG: sme:SMb20481  asparagine synthetase
                     (glutamine amidotransferase) protein;
                     TIGRFAM: asparagine synthase (glutamine-hydrolyzing);
                     PFAM: glutamine amidotransferase, class-II; asparagine
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="YP_864149.1"
                     /db_xref="GI:117923532"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR006426"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="GeneID:4483768"
                     /translation="MCGICGVMYFQPQTPQPAMLEKMVEKLHQRGPDGGGIEIDGQLG
                     LGHRRLKVIDLSENGHQPMQDDALGLTIVFNGCIYNYQALRQSLLELGYSFFSTSDTE
                     VILKAYHAWGWQCVQRFNGMFAFAIYERQSGRVVLARDRLGIKPLYIHQDKSHLRFAS
                     SIPSLLAGGGITTTLDPIALHHFLSFHSVVPAPRTLLQQVQKLPPATVRIVEKNGSET
                     NHTYWNLQMGPQAGDAERTEAEWQQLLDQALRAAVSRRLVADVPVGLLLSGGLDSSLM
                     AGLLVESGQLSRGGLSTFSIGFEQAGGEEGDEFQYSDIVAAHFGTDHHKIFIETNNLP
                     ELLRETVRAMSEPMVSHDAVGFYLLSREVAKHVKVVQSGQGADEVFAGYHWYPKVDAG
                     QDAFQDYRKAFFDRSHEECCEMVHRDIAAAWQQDYSSAFVESWFAHPHSGTAAVDKAL
                     HLDQNIMLVDDPVKRVDNMTMAWGLEARVPFLDHELVELAARIPGHLKLQQGGKGILK
                     EVARPIIPHAVIDRAKGYFPVPALKHMDGPVLKLAKEVLTSPRATQRGLIQPSYINRL
                     LDHPTQHITPLHGSKLWQLTLLELWLQTHDIH"
     misc_feature    237795..239579
                     /locus_tag="Mmc1_0216"
                     /note="asparagine synthase family amidotransferase;
                     Region: trio_amidotrans; TIGR03104"
                     /db_xref="CDD:234108"
     misc_feature    237798..238466
                     /locus_tag="Mmc1_0216"
                     /note="Glutamine amidotransferases class-II (GATase)
                     asparagine synthase_B type.  Asparagine synthetase B
                     catalyses the ATP-dependent conversion of aspartate to
                     asparagine. This enzyme is a homodimer, with each monomer
                     composed of a  glutaminase domain and a...; Region: AsnB;
                     cd00712"
                     /db_xref="CDD:238364"
     misc_feature    order(237798..237800,237939..237941,238017..238025,
                     238092..238094)
                     /locus_tag="Mmc1_0216"
                     /note="active site"
                     /db_xref="CDD:238364"
     misc_feature    order(237843..237845,237867..237869,237876..237878,
                     237885..237899,237936..237938)
                     /locus_tag="Mmc1_0216"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238364"
     misc_feature    238530..239384
                     /locus_tag="Mmc1_0216"
                     /note="The C-terminal domain of Asparagine Synthase B.
                     This domain is always found associated n-terminal
                     amidotransferase domain. Family members that contain this
                     domain catalyse the conversion of aspartate to asparagine.
                     Asparagine synthetase B  catalyzes the...; Region:
                     Asn_Synthase_B_C; cd01991"
                     /db_xref="CDD:238949"
     misc_feature    order(238590..238598,238680..238688,238869..238871,
                     238908..238916)
                     /locus_tag="Mmc1_0216"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238949"
     misc_feature    order(238590..238598,238680..238688,238869..238871,
                     238908..238916)
                     /locus_tag="Mmc1_0216"
                     /note="Molecular Tunnel; other site"
                     /db_xref="CDD:238949"
     gene            239600..241366
                     /locus_tag="Mmc1_0217"
                     /db_xref="GeneID:4483769"
     CDS             239600..241366
                     /locus_tag="Mmc1_0217"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: sme:SMb20482 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_864150.1"
                     /db_xref="GI:117923533"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="GeneID:4483769"
                     /translation="MAADQSDTRLFVQATLASLKNWGEPHDSTAAMLDEAVIDCGWGK
                     LVFGQTFSDNQALCQAMRAEQPGQRNVALYLRDPHVVLSLYPQELFLDPSHTYRLALT
                     QDPWQDFTPPAALSILPIRGEQDMAVVRQLYETRRMVPPRAGFRLDGQEGCAPLFLIA
                     IDEQSEQIVGVVNGVDHRCAFNDPENGSSLWALAVDRKTAIGGVGEALVRALAHHFWQ
                     QGRGYMDLSVMHDNEQAIALYNKLGFKQIPVYCLKNKNPINERLFSGPAPEANLSIYS
                     RIIVDEARRRGISVEVLDQSLELFRLKLGGRTVLCRESLSSLTSATAMTVCDNKRLTS
                     RLLKSAGLQVPEQMVVGKGERVENFLARHGAVVVKPVRGEQGRGISVDVRDLTSLEQA
                     IAKAQQEGDGEQVLLERLVVGDDLRIIVIGHEVVAAAVRKPPMIRGDGHSNIAALIQR
                     QSRRRAAATEGESRIPLDGETQRCVQEAGLEMHSILDKGQQLLVRRAANLHTGGTIHD
                     VTEQLHPALREAAEQASMVLDMPLVGLDFLVPDVQGPDYVIIEANERPGLANHEPQPT
                     AKRFIDMLFPQTTLPRCVSTEA"
     misc_feature    239693..241342
                     /locus_tag="Mmc1_0217"
                     /note="GNAT-family acetyltransferase TIGR03103; Region:
                     trio_acet_GNAT"
                     /db_xref="CDD:132147"
     misc_feature    240083..240334
                     /locus_tag="Mmc1_0217"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     misc_feature    240575..241276
                     /locus_tag="Mmc1_0217"
                     /note="Sugar-transfer associated ATP-grasp; Region:
                     ATPgrasp_ST; cl19204"
                     /db_xref="CDD:267557"
     misc_feature    240578..>240895
                     /locus_tag="Mmc1_0217"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            241753..242256
                     /locus_tag="Mmc1_0218"
                     /db_xref="GeneID:4483770"
     CDS             241753..242256
                     /locus_tag="Mmc1_0218"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864151.1"
                     /db_xref="GI:117923534"
                     /db_xref="GeneID:4483770"
                     /translation="MPWFKILLLLSMVGLVMPAQAATRHKIYYEQGPYTVRQYKVDGK
                     RVCKLEITFSKKGNAMAYLGLFNSPHFFGELFTERRTVGEAKSNLRIGFDGKRKMRIN
                     FAKESAGREEVWRWRYFEVPADLLNQAAKGRSMQLAFYNGSHMFEFELSLKGSSKAIR
                     MLKRCDR"
     gene            242270..242689
                     /locus_tag="Mmc1_0219"
                     /db_xref="GeneID:4483771"
     CDS             242270..242689
                     /locus_tag="Mmc1_0219"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864152.1"
                     /db_xref="GI:117923535"
                     /db_xref="GeneID:4483771"
                     /translation="MRSRSLPKRSIACPVGLWQKCRRGSMAATLVLASLIPIALLSGC
                     VNGLIGAQRPVAHGPDAQPTVVVVPQRPTHCQTLDMVEGAGAASGQGRQGALEDVKRL
                     ARLRGGNHIWIVQEQQSTYTLNHYVTAEIFKCPIPKK"
     gene            242740..243831
                     /locus_tag="Mmc1_0220"
                     /db_xref="GeneID:4483772"
     CDS             242740..243831
                     /locus_tag="Mmc1_0220"
                     /note="PFAM: peptidase M20; peptidase M42 family protein;
                     KEGG: eba:ebA5273 conserved hypothetical protein,
                     predicted peptidase M42 family"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M42 family protein"
                     /protein_id="YP_864153.1"
                     /db_xref="GI:117923536"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR008007"
                     /db_xref="GeneID:4483772"
                     /translation="MSDQHASNAPIINTDYLLETLLTLLTIPSPSGMTDKVVRWVCHE
                     LTQLGVEYELTHRGAIRATLPGKDEKRVRGVVAHLDTLGAMVRELKGNGRLSVSPIGH
                     WNGRFAEGARVTLMAESGRHMRGTLLPLKASGHVYNEAIDSQPAGWDYVELRLDERAQ
                     CVADLMKLGVHVGDYVAVDSAPEVSASGFVNARHLDDKAGVAAMLAAVRTIMAQDITL
                     PAPVYVMFTISEEVGVGASHILHGDISELVSVDNGTLAPGQNTCEFGVTIAMKDSSGP
                     FDYHLTHHLLDLCKEHAIMHSRDVFRYYRSDAAAALEAGNDIRTALVCFGLDASHGYE
                     RIHMDSLHALAALLFYYMNHQLPVPDRGM"
     misc_feature    242818..243795
                     /locus_tag="Mmc1_0220"
                     /note="M42 Peptidase, Endoglucanase-like subfamily;
                     Region: M42_glucanase_like; cd05657"
                     /db_xref="CDD:193533"
     misc_feature    order(242830..242838,242851..242853,242863..242865,
                     242899..242904,242911..242913,242992..243000,
                     243031..243033,243067..243075,243106..243111,
                     243115..243117,243193..243195,243199..243207,
                     243253..243258,243286..243288,243292..243294,
                     243304..243306,243310..243312,243442..243444,
                     243451..243456,243523..243531,243547..243549,
                     243595..243597,243637..243639,243673..243675,
                     243721..243726,243733..243735,243742..243744)
                     /locus_tag="Mmc1_0220"
                     /note="putative oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193533"
     misc_feature    order(242971..242973,243325..243327,243427..243432,
                     243439..243441,243490..243501,243640..243642,
                     243649..243654,243727..243732)
                     /locus_tag="Mmc1_0220"
                     /note="putative active site [active]"
                     /db_xref="CDD:193533"
     misc_feature    order(242971..242973,243325..243327,243427..243432,
                     243490..243492,243730..243732)
                     /locus_tag="Mmc1_0220"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193533"
     gene            244268..245017
                     /locus_tag="Mmc1_0221"
                     /db_xref="GeneID:4483773"
     CDS             244268..245017
                     /locus_tag="Mmc1_0221"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864154.1"
                     /db_xref="GI:117923537"
                     /db_xref="GeneID:4483773"
                     /translation="MESRENSPQEHGLSQDDIDALRMLAERYVQIKVFIAYAEEIQVD
                     HKADILVYKELRDGMDHLMRVLYHRLSAQSADIEDLDGYRDINIGKSIGHLYRAAFDA
                     LDATILSLREHISANLSGYTMETVSDVIPNYYMLKIKLNQLTKQAADRRGKKDIGRIT
                     DDTFDQYVQDVDELKKLHESVLYAGQELCEHKKSLKIKKWKDIIWSLFLVIFGVIFGI
                     AVKAGYDYLQPTHVESTKQAVQESNFSSKIE"
     gene            245558..246703
                     /locus_tag="Mmc1_0222"
                     /db_xref="GeneID:4483774"
     CDS             245558..246703
                     /locus_tag="Mmc1_0222"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: pfo:Pfl_2616 GCN5-related N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_864155.1"
                     /db_xref="GI:117923538"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:4483774"
                     /translation="MNSCVMSRVRPATLEDLSALVALERACFSRDRISRRSFRHFIQR
                     AHAVFLVAVEENHTLSGYGVLLLRRGAQLARIYSLAVAPEMRGGGRAKLLLKALEEAA
                     LEHRTAWVRLELHQDNEAAIALYQNRGYRPFERFIDKDEGFAEAVRMEKSLLRNLEPG
                     DTPWPYYAQSLPFTCGPASLMMAMGGFFPELALDRSLELQLWRESTTIFMTSGHGGCG
                     PHGLAVAALHRGYEVRIHTSVGKDLFVDSVRHPDKKSVIRLVESNFIDVLHQHDVNVQ
                     EEPMTLEEISAALEAGWAVLVLISAYRLSGSKAPHWVIVAAINHGFVYVHEPDLDDEK
                     GQTSTECIGIPIPCEAFVGMMSYGKARQQAAVLLRPPRMESITVDEN"
     misc_feature    245570..246016
                     /locus_tag="Mmc1_0222"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    245705..245896
                     /locus_tag="Mmc1_0222"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(245792..245800,245828..245833)
                     /locus_tag="Mmc1_0222"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    246047..246670
                     /locus_tag="Mmc1_0222"
                     /note="Peptidase_C39 like family; Region: DUF3335;
                     pfam11814"
                     /db_xref="CDD:256642"
     gene            246803..247960
                     /locus_tag="Mmc1_0223"
                     /db_xref="GeneID:4483775"
     CDS             246803..247960
                     /locus_tag="Mmc1_0223"
                     /note="KEGG: reu:Reut_A1920 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864156.1"
                     /db_xref="GI:117923539"
                     /db_xref="GeneID:4483775"
                     /translation="MDHTVPLSLYRPLPVVESLTERLFPATSYQQLREHFLAAAKGCP
                     HRHMAYVHPLRGSRGEELAMDVVRLGHAQCHATLVITSACHGVEGPAGSALQSDLLRH
                     ALLENLPAGVEILLIHGLNPYGFSWGRRVDEKGVDLNRNFVDFASPLPFNQDYNALAE
                     AILPRELNPASLQHAQAQRTAYRQQHGEIRYDHGVAAGQYSDPHGLFYGGVEPSWSRQ
                     TLEKIWQHFGLTQRVKIAVVDIHTGIGPHGYGELICDLPPGGVGSQRAQRWYGASVTH
                     PVLGGSASGVRYGLTDYGWLAAFGERLSFVTLEFGTGPFDTLLQVLQGDHWCHRQKLA
                     TNHPTMQHWRKQLEDFFNPPSASWQEMVIWRGRQVIRQTLEALADPSRPTT"
     misc_feature    246878..247726
                     /locus_tag="Mmc1_0223"
                     /note="Peptidase M14-like domain; uncharacterized
                     subfamily; Region: M14-like_6; cd06233"
                     /db_xref="CDD:133091"
     misc_feature    order(247055..247057,247064..247066,247190..247192,
                     247217..247222,247358..247363,247415..247417,
                     247661..247663)
                     /locus_tag="Mmc1_0223"
                     /note="putative active site [active]"
                     /db_xref="CDD:133091"
     misc_feature    order(247055..247057,247064..247066,247358..247360)
                     /locus_tag="Mmc1_0223"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:133091"
     gene            247999..248808
                     /locus_tag="Mmc1_0224"
                     /db_xref="GeneID:4483776"
     CDS             247999..248808
                     /locus_tag="Mmc1_0224"
                     /note="KEGG: ana:alr7352 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864157.1"
                     /db_xref="GI:117923540"
                     /db_xref="GeneID:4483776"
                     /translation="MSKEVHYDLSNEESLIAQASYLGQRIQPLATGTKYPWQPPMTVN
                     PEGGLVVLYRFGVAVAFHTSPPRFEGLVEQLGDRLEPSEENQLHEETLVLQRTTTAEQ
                     AGLLSHGKMLLSSFDTDRLKLIADVLAKSVLLAVYEEQVSQTLEKMEPLGLAMRKGHT
                     FPRREHGLVQHIGEALHVQNRMVGLAQIGEKPEMLWDRPDMEALFNRMEREYEIHERQ
                     AILERKLGLIQNTAQTLLELHQTRHALFLEWAIVVLIVIEVVFTVQEHFFK"
     misc_feature    248146..248667
                     /locus_tag="Mmc1_0224"
                     /note="Uncharacterized ACR, YagE family COG1723; Region:
                     DUF155; pfam02582"
                     /db_xref="CDD:251392"
     gene            complement(248953..249198)
                     /locus_tag="Mmc1_0225"
                     /db_xref="GeneID:4483777"
     CDS             complement(248953..249198)
                     /locus_tag="Mmc1_0225"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864158.1"
                     /db_xref="GI:117923541"
                     /db_xref="GeneID:4483777"
                     /translation="MDMSKIVTRLKNLFDSSKSKKKQQCDDMQEVLKKLKKKEKKLQQ
                     QIADENSDKKKKRLEKDLRVLQSHWKKADKICRSIKN"
     gene            complement(249241..251067)
                     /locus_tag="Mmc1_0226"
                     /db_xref="GeneID:4483778"
     CDS             complement(249241..251067)
                     /locus_tag="Mmc1_0226"
                     /note="PFAM: Na+/Pi-cotransporter;
                     KEGG: tdn:Tmden_1943 Na+/Pi-cotransporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/Pi-cotransporter"
                     /protein_id="YP_864159.1"
                     /db_xref="GI:117923542"
                     /db_xref="InterPro:IPR003841"
                     /db_xref="GeneID:4483778"
                     /translation="MLRKIFLPIIYLLLAYGFWLSPDFKEIAAGVAIFLFGMISMEEG
                     FRVFSGGILEKILRHTTNRTWKSLGFGIVSTTIMQSSSLVSVITISFVSAGLLGLQEG
                     IGIIFGANLGTTTGAWLVAGLGLKVKISAYAMPMLVFGIIGIFQSTKAGRGLGYILVG
                     LGLLFLGIHYMKEGFETFKSAFDLARFAVGGWQGLLLFTGIGILATVVMQSSHATLVL
                     IITALAAGQITYENALALAIGANIGTTITAIIGSLTANAAGKRLAMAHLIFNILTGLL
                     AILLMSQLIFMVDKTSALVGIAADNYTLKLAVFHTLFNLLGLMVMLPWLRFLVTFLES
                     RLKDQKHALATPHYLHQANRTIPVAFLESIRMEIIHLYDNAVSISIQALNFTPQDFKD
                     PMDACDLAKIRRQVVATDMDQYYEQRIKGLYGTIIEFSSTPDFIMSAQMSSRLFDQRI
                     ACRRVVEAVKDVKHMRKNLVRYADGDNLAIRDEYDKIRGQMLDLFRSLHEIRQEAATQ
                     NDALTVLSLDTLRVRIEESDVLANDVLDSLIREKRITDTMATSLMNDSAYAYDIAKRL
                     IQVAETVFLPFNEERLREAEQAISLSDDELEAVMDHGGKPTQ"
     misc_feature    complement(250051..250983)
                     /locus_tag="Mmc1_0226"
                     /note="Na/Pi-cotransporter; Region: NaPi_cotrn_rel;
                     TIGR00704"
                     /db_xref="CDD:233096"
     misc_feature    complement(250546..250971)
                     /locus_tag="Mmc1_0226"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     misc_feature    complement(<250240..250566)
                     /locus_tag="Mmc1_0226"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     gene            251457..252734
                     /locus_tag="Mmc1_0227"
                     /db_xref="GeneID:4483779"
     CDS             251457..252734
                     /locus_tag="Mmc1_0227"
                     /note="PFAM: GAF domain protein;
                     KEGG: dps:DP2625 similar to serine/threonine protein
                     phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF sensor protein"
                     /protein_id="YP_864160.1"
                     /db_xref="GI:117923543"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="GeneID:4483779"
                     /translation="MDDTRLPLRPFTTHKLIKGITYPEAVSFRDLVVTGPPGSGKSTL
                     IAYLDGWSEEGVVDLTQKGWWKQPVLHMRPREVHFLIPFVGFERAVPVYELKSLDHPD
                     FLEIDLFRLVLPPRKQGPLATDFRNRFLFEFLLPDAEVMYQRRQQRAKARSHTVEEDL
                     SLAQVRLELSIYQQLAQFMHQEGMRVLVRTEVDAPPMVIDSPQCATQPINKLSAQELL
                     QTLDKVQLRQRVFNRSWNERSNRDLMALFVEMVPTILQVEECAIFIRQQDSEALWLVS
                     SNAEEKTTARCKSQKSLGCDLVSQVIHTGLHQVFELGEGQQKPAQDGELEMRNALCVP
                     IPHLSRAGASGAILVRNTTDGRAFRAEDRNFLERLAQHLQTASETLFLRRQLSNFSEL
                     LGQKVETTQWLRMIIALLSMLVLAETALLMILH"
     misc_feature    <251541..>251639
                     /locus_tag="Mmc1_0227"
                     /note="HprK-related kinase A; Region: HprK_rel_A;
                     TIGR04352"
                     /db_xref="CDD:213965"
     misc_feature    252177..252584
                     /locus_tag="Mmc1_0227"
                     /note="GAF domain; Region: GAF_3; pfam13492"
                     /db_xref="CDD:257816"
     gene            253221..253904
                     /locus_tag="Mmc1_0228"
                     /db_xref="GeneID:4483780"
     CDS             253221..253904
                     /locus_tag="Mmc1_0228"
                     /note="PFAM: protein of unknown function DUF47;
                     KEGG: cbu:CBU_0015 conserved hypothetical protein
                     TIGR00153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864161.1"
                     /db_xref="GI:117923544"
                     /db_xref="InterPro:IPR002727"
                     /db_xref="GeneID:4483780"
                     /translation="MGTTNPLASLLGRSPFKPMQEHMRKVVLCAQLVPALFDALEQDD
                     RETLNQVKASIFELEHQADALKNDLRAHLPNSLFMPVARRDLLELLEVQDAIADSAQE
                     IAGMLTLRVDLVPPAGMCGAFKALAQHCVRTCEKAGEAIEQLDELLETGFGGRESERV
                     QRLLGEVGTLESETDKLGIALCQSLFEREKDLNPVITIMLYQMIREIGELADNAEKVG
                     DRLRLLIAR"
     misc_feature    253233..253901
                     /locus_tag="Mmc1_0228"
                     /note="Phosphate transport regulator (distant homolog of
                     PhoU) [Inorganic ion transport and metabolism]; Region:
                     COG1392"
                     /db_xref="CDD:224310"
     misc_feature    253245..253901
                     /locus_tag="Mmc1_0228"
                     /note="TIGR00153 family protein; Region: TIGR00153"
                     /db_xref="CDD:232846"
     gene            253939..255207
                     /locus_tag="Mmc1_0229"
                     /db_xref="GeneID:4483781"
     CDS             253939..255207
                     /locus_tag="Mmc1_0229"
                     /note="PFAM: phosphate transporter;
                     KEGG: dps:DP2628 probable phosphate permease"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter"
                     /protein_id="YP_864162.1"
                     /db_xref="GI:117923545"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="GeneID:4483781"
                     /translation="MEIIQEHGTIFMFLAIIFGLYMCWGIGANDVANAMGTSVGSGAI
                     TVKQAILIAAVFEFAGAFIAGGQVTKTIRKGIIDPAPIANNPELLVYGMLAALLAAAI
                     WLMIASSKGWPVSTTHTIVGAIVGFAVVGIGPDAVKWQKISTVAASWIVSPIVGGGIA
                     YMLMISIRKLILNTDNPFQSARKWGPLYVFMVGFITALVTLWKGLKHLKLDFSMAESF
                     FISALIGLIVAYMGKRMIDKVKLDVEADREYHFASVEKVFMPMMVFTACAMAFAHGSN
                     DVANGIGPLAAVVSIVQSGGEVAQKASLPVWILVLGGVGIVIGLATMGHKVMQTIGTK
                     ITELTPTRGYCATLASAVTVVLASKTGMPVSTTQIAVGAVMGVGFARGIGALDMRVIG
                     GIFLSWLVTLPAGGLLAAAIFFIIKGIFGS"
     misc_feature    254014..255165
                     /locus_tag="Mmc1_0229"
                     /note="Phosphate transporter family; Region: PHO4;
                     pfam01384"
                     /db_xref="CDD:250576"
     gene            complement(255293..256429)
                     /locus_tag="Mmc1_0230"
                     /db_xref="GeneID:4483782"
     CDS             complement(255293..256429)
                     /locus_tag="Mmc1_0230"
                     /note="KEGG: dps:DP2625 similar to serine/threonine
                     protein phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864163.1"
                     /db_xref="GI:117923546"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="GeneID:4483782"
                     /translation="MRLQQGQSLLLGRDQPYQQALFEWDATVATRHAELHLTATELHI
                     RELHTDYGLTIAPAQCEPHSTADTLLTNLLQPFSQPLTPLPATAALELLEQVNAQRSQ
                     EPYHPLNRFGQPGALLELPPHVQPILVGDLHARVENLLTILQWDGLLSGIASGQQALI
                     ILGDAVHSELDGEMENMESSMLMMDLILRLKSLFPNGVFYLRGNHDSFLASVSKGGVP
                     QGKLWQHALLEQRGEAYVAAMQHLYEHLPLVAVGQAFLCCHAAPPRAKVTRSMITDAY
                     AYPGLVKELLWNRIRTQYLLHGYSKRDIHRFRKSMGCTPQTPFIVSHNPMDRRQSHWT
                     NACDIPLYHIFFSGLTSDIGLFVGVGHEMIPLTLPCQSMVHAHP"
     misc_feature    complement(<255563..256051)
                     /locus_tag="Mmc1_0230"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    complement(order(255653..255655,255815..255820,
                     255938..255940,256031..256033,256037..256039))
                     /locus_tag="Mmc1_0230"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    complement(order(255653..255655,255818..255820,
                     255938..255940,256031..256033,256037..256039))
                     /locus_tag="Mmc1_0230"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            complement(256577..258040)
                     /locus_tag="Mmc1_0231"
                     /db_xref="GeneID:4483783"
     CDS             complement(256577..258040)
                     /locus_tag="Mmc1_0231"
                     /note="KEGG: dsy:DSY0277 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864164.1"
                     /db_xref="GI:117923547"
                     /db_xref="GeneID:4483783"
                     /translation="MNQHNREQATVPTPMIDEIKTQSFGVFGVDNAIVDFLQEIGFQA
                     IFNRRGWSKRTGKDLPTLIMLLILHPLLKVPSIHLFCRDHFLSVFAVGKDTFYRLLQR
                     QFPWRNAHWALIKKLLPQWRTLDLGPGYLVADTTVKEKRGDRIEGVCWHHDHNTGRSV
                     AGFEAAHLVWVNKQGTLPLDAALRFSKRPLISNLLHILSYRFDCRSHLGRRYREAAKM
                     SKLDQTVDMVARAIQAGIPAQYFLADAWYSSVKFVKKILDLGVVPLIRWKRNNTKFLF
                     QGERLTSAELYTRFAKGKIRKAKGSKRFKGTFLDAEHPEIGLIRLFFVRLIDPKTGSK
                     EWAVFLTTDRSMGLSNMIEHYANRWGIEVFYKESKQHLGFLNESVRSFEAVIACLHLA
                     AMRHAVLSSMVAIKGSQRDQLAHNLAALTYARKLWHTFRAIFNDALGRTSILENHQKN
                     EVIELFEQEVEAWLSKALMLDPLGSQRQILAETNCET"
     misc_feature    complement(257192..257761)
                     /locus_tag="Mmc1_0231"
                     /note="DDE superfamily endonuclease; Region: DDE_5;
                     cl17874"
                     /db_xref="CDD:266901"
     misc_feature    complement(256859..>257323)
                     /locus_tag="Mmc1_0231"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(258503..261853)
                     /locus_tag="Mmc1_0232"
                     /db_xref="GeneID:4481680"
     CDS             complement(258503..261853)
                     /locus_tag="Mmc1_0232"
                     /note="KEGG: dar:Daro_3549 PAS;
                     TIGRFAM: PAS sensor protein;
                     PFAM: response regulator receiver; ATP-binding region,
                     ATPase domain protein domain protein; histidine kinase A
                     domain protein domain protein; MASE1 domain protein; PAS
                     fold-3 domain protein; hypothetical protein; PAS fold
                     domain protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor hybrid histidine kinase"
                     /protein_id="YP_864165.1"
                     /db_xref="GI:117923548"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR007895"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4481680"
                     /translation="MSKLNEILMVAVVYFITARLGQLLAISPGNVTPVWLPSGICLAW
                     VLLRGRHLWPGIFLGAFAGNIWAYFDTNTLSAILKSILAGSANGLGDVIAIVGAAWMI
                     NTISPATALFNNSKNTTIFLIYGGIIGPFISASIGIFGLLLTGNILPNDAFFSLITWW
                     TGDAMGVLFITPVILELYHLKNIQTIRPNRDVILHFVLFLSITTTVFFLSSNQDPSIW
                     IVFLAPMLVWATLRFSQVILFSELFILSTISIVATATQHGPLLILDDLASTLIHLQVF
                     LGSVALSVFYLNSVNRELRASKHNLELNVIERTKDLQVLNSNLLKEIRSRQHAEDSLK
                     ESQKALLEAQNIAQVGNWTWTIETNTLSWTDEIYRIFGLIPQETPPTYQAFLSAIHPE
                     DRLFVQNAVNQALEQLNTPYQVEHRIIRPNGDLRTVVELGRVERDQQGTPFRMIGTVQ
                     DITARKQTEALLLSSEIRFRSLFDSMNEGGALHAMVFNEHGNPIDYRILEVNKAYTEI
                     LGITKEQAEGRLATEIYGQTSPPYLELYNRVVKTGQSLRFETEYSPMVRNFEISVFSP
                     GENQFATVFTDITERKKTLQKLNGALDELEKKSNFLQSLVQNLPDLIWMKDPEGVFLT
                     CNPAFERFVGSQEQQIKGKTDYDFVDQKLADFFRMNDLLAIEKGGPVINQEWVTFAAD
                     GHKALLETTKTPMFDKQGRIIGVLGVAHDITATKQAEQDLIHAKEKAEAAYQAKSEFL
                     ATMSHEIRTPMNVIIGLSDILMETPIDHEQRDHLLRLQKANKTLLDLVDSILDLSRIE
                     ANQISLKQEPLNLALMVEETMSMMSIVADQKGLRLESQVTQATDDYWSLGDESRIRQI
                     LVNLIGNAVKFTEKGSIWVTLELFTDTLERTLVRLCVKDTGIGIGPEHLETIFDKFTQ
                     VDSSYARRYSGTGLGLAITRRIIQLMGGKVWVESNPSQGSLFCVELPFIPVQPIALKE
                     DTTLQNDVNRSTNRPLRILLAEDSEDNQMLVQTYLRRTHHELVIVMDGQQAVDAACSK
                     PFDLILMDIQMPIMDGYQATGIIRDDQHRHNKPHTPILALTAHALDEDVAKSLAAGCD
                     GHLTKPIRKAKFLQCIERYQPITFLDES"
     misc_feature    complement(260939..261832)
                     /locus_tag="Mmc1_0232"
                     /note="MASE1; Region: MASE1; cl17823"
                     /db_xref="CDD:266863"
     misc_feature    complement(260498..260800)
                     /locus_tag="Mmc1_0232"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(260507..260773)
                     /locus_tag="Mmc1_0232"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    complement(order(260585..260587,260600..260602,
                     260681..260692,260735..260737,260753..260755,
                     260765..260767))
                     /locus_tag="Mmc1_0232"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(260558..260560,260564..260566,
                     260651..260656,260663..260665,260687..260689,
                     260699..260701))
                     /locus_tag="Mmc1_0232"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(260090..260461)
                     /locus_tag="Mmc1_0232"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(260219..260452)
                     /locus_tag="Mmc1_0232"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    complement(258986..260071)
                     /locus_tag="Mmc1_0232"
                     /note="phosphate regulon sensor kinase PhoR; Region:
                     phoR_proteo; TIGR02966"
                     /db_xref="CDD:234074"
     misc_feature    complement(259718..260029)
                     /locus_tag="Mmc1_0232"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(259805..259807,259820..259822,
                     259901..259912,259949..259951,259967..259969,
                     259979..259981))
                     /locus_tag="Mmc1_0232"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(259778..259780,259784..259786,
                     259868..259873,259883..259885,259907..259909,
                     259919..259921))
                     /locus_tag="Mmc1_0232"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(259466..259654)
                     /locus_tag="Mmc1_0232"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(259481..259483,259493..259495,
                     259502..259504,259514..259516,259523..259525,
                     259535..259537,259583..259585,259592..259594,
                     259604..259606,259613..259615,259625..259627,
                     259637..259639))
                     /locus_tag="Mmc1_0232"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(259619..259621)
                     /locus_tag="Mmc1_0232"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(258974..259297)
                     /locus_tag="Mmc1_0232"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(258986..258988,258992..258997,
                     259010..259012,259016..259018,259064..259075,
                     259154..259159,259163..259165,259169..259171,
                     259175..259177,259256..259258,259265..259267,
                     259277..259279))
                     /locus_tag="Mmc1_0232"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(259265..259267)
                     /locus_tag="Mmc1_0232"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(259067..259069,259073..259075,
                     259157..259159,259163..259165))
                     /locus_tag="Mmc1_0232"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(<258551..258889)
                     /locus_tag="Mmc1_0232"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(258533..258883)
                     /locus_tag="Mmc1_0232"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(258572..258577,258584..258586,
                     258641..258643,258716..258718,258740..258742,
                     258869..258874))
                     /locus_tag="Mmc1_0232"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(258740..258742)
                     /locus_tag="Mmc1_0232"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(258716..258724,258728..258733))
                     /locus_tag="Mmc1_0232"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(258569..258577)
                     /locus_tag="Mmc1_0232"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(262431..262507)
                     /locus_tag="Mmc1_R0002"
                     /note="tRNA-Arg4"
                     /db_xref="GeneID:4481681"
     tRNA            complement(262431..262507)
                     /locus_tag="Mmc1_R0002"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:4481681"
     gene            complement(262544..264322)
                     /locus_tag="Mmc1_0233"
                     /db_xref="GeneID:4481682"
     CDS             complement(262544..264322)
                     /locus_tag="Mmc1_0233"
                     /note="KEGG: mag:amb1535 response regulator containing a
                     CheY-like receiver domain and a GGDEF domain;
                     TIGRFAM: PAS sensor protein; diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; cyclic
                     nucleotide-binding; hypothetical protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="YP_864166.1"
                     /db_xref="GI:117923549"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000238"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4481682"
                     /translation="MAVVAHYAGEHYAEQILFRNIHWEELASVLCTCPVKSMQPGEVL
                     LDPKHPNETIYLVIEGRLSIHLKDLETPPIASIGQGSFVGELSIMDEKYPTAFVVVEH
                     PSQLLMLSRVHLKQLIDCSSTFVFNLLQVFSHRMRFSTEALIESHFVRTVPDIIYRLD
                     AQGHFIYLNESIEKLGYTMQELLSQHFSVLVSVEDLDSVSFDSVVVRHPQATPSSGTG
                     VQPKLFDERRSGDRKTTGLELKLCTRDTESTQRSIIHAEVSCTGIQVESLVSGVRDYH
                     GTIGIIRDVTERKQFMTQLSEQKAQMEAIFNTIADALLVTDVYGIIQSANHSASEIFG
                     YSQGELLGCSIGMLLEAEQHEDAVVSRWTALAGHRKEVKVRRKGEQIFEAEMSVSQVF
                     LEDRILYTGIIRDITERKEAERRITYQANYDALTGIPNRSYFQQLLNQSIQRAAAEGK
                     RLAIIFIDLDRFKWVNDNLGHGAGDELLRLSSKRAASCLKGRDTVARLGGDEFVAILE
                     HVGDTEQAFAVSKRVLESLNRPFMLDGKEVYISGSMGVAIYPQDATQPEELLTRADEA
                     MYCSKRAGRNACHFVTGESFQMEKKY"
     misc_feature    complement(<263837..264292)
                     /locus_tag="Mmc1_0233"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(263966..264274)
                     /locus_tag="Mmc1_0233"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(264035..264043,264068..264073))
                     /locus_tag="Mmc1_0233"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(263969..263977)
                     /locus_tag="Mmc1_0233"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(263462..263866)
                     /locus_tag="Mmc1_0233"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(<263726..263866)
                     /locus_tag="Mmc1_0233"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(263744..263755,263792..263794,
                     263807..263809,263819..263821))
                     /locus_tag="Mmc1_0233"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(263075..263425)
                     /locus_tag="Mmc1_0233"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(263105..263398)
                     /locus_tag="Mmc1_0233"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(263186..263188,263201..263203,
                     263270..263281,263318..263320,263336..263338,
                     263348..263350))
                     /locus_tag="Mmc1_0233"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(263159..263161,263165..263167,
                     263240..263245,263252..263254,263276..263278,
                     263288..263290))
                     /locus_tag="Mmc1_0233"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(262595..263062)
                     /locus_tag="Mmc1_0233"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(262820..262822,262949..262951))
                     /locus_tag="Mmc1_0233"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(262817..262828,262832..262834,
                     262898..262900,262910..262912,262922..262927,
                     262934..262936))
                     /locus_tag="Mmc1_0233"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(262757..262759,262844..262846))
                     /locus_tag="Mmc1_0233"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(264386..265483)
                     /locus_tag="Mmc1_0234"
                     /db_xref="GeneID:4481683"
     CDS             complement(264386..265483)
                     /locus_tag="Mmc1_0234"
                     /note="TIGRFAM: A/G-specific adenine glycosylase;
                     PFAM: helix-hairpin-helix motif; HhH-GPD family protein;
                     KEGG: pca:Pcar_0322 mutator MutT protein"
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific DNA-adenine glycosylase"
                     /protein_id="YP_864167.1"
                     /db_xref="GI:117923550"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR005760"
                     /db_xref="GeneID:4481683"
                     /translation="MTLPHLPADLAQRLLAYYDEYGRDLPWRQQQDLYRIWLSEIMLQ
                     QTGVKTVMPYYEKFLSHFPSITQLAAASQEQVLAQWQGLGYYRRARMLHQAAQQVVQQ
                     HGGLFPEEITQVQALPGIGPSTAAAILAIGRNQAHTILDGNVMRVLARLLTLELPVDS
                     TPGKQRLWQVARQLTSQQRPGDYAQAIMDLGATLCTRSQPACSRCPWGGACAARQHGS
                     WAEYPKKREKKPKPHHYQCMWVLLDTQQRIFLRKRPLEGLLGGLWEPLGEPLLETPPL
                     GNLVQRASHHLTALGIQGQPLLEAQPVDHIFTHFRLTVYPILVVAASGAPILNDANWW
                     PLAQLDQRPIATLHRKVNENAVGLVELSLNG"
     misc_feature    complement(264431..265465)
                     /locus_tag="Mmc1_0234"
                     /note="A/G-specific DNA glycosylase [DNA replication,
                     recombination, and repair]; Region: MutY; COG1194"
                     /db_xref="CDD:224115"
     misc_feature    complement(264911..265384)
                     /locus_tag="Mmc1_0234"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(265220..265222,265334..265336,
                     265343..265351))
                     /locus_tag="Mmc1_0234"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(265112..265135)
                     /locus_tag="Mmc1_0234"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(264920..264922,264932..264934,
                     265103..265105))
                     /locus_tag="Mmc1_0234"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    complement(265061..265063)
                     /locus_tag="Mmc1_0234"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    complement(264419..264787)
                     /locus_tag="Mmc1_0234"
                     /note="DNA glycosylase (MutY in bacteria and hMYH in
                     humans) is responsible for repairing misread  A*oxoG
                     residues to C*G by removing the inappropriately paired
                     adenine base from the DNA backbone. It belongs to the
                     Nudix hydrolase superfamily and is important...; Region:
                     DNA_Glycosylase_C; cd03431"
                     /db_xref="CDD:239523"
     misc_feature    complement(order(264557..264562,264569..264571,
                     264707..264715))
                     /locus_tag="Mmc1_0234"
                     /note="DNA binding and oxoG recognition site [nucleotide
                     binding]"
                     /db_xref="CDD:239523"
     gene            complement(265489..265998)
                     /locus_tag="Mmc1_0235"
                     /db_xref="GeneID:4481684"
     CDS             complement(265489..265998)
                     /locus_tag="Mmc1_0235"
                     /note="KEGG: dar:Daro_0068 heptaprenyl diphosphate
                     synthase component I"
                     /codon_start=1
                     /transl_table=11
                     /product="heptaprenyl diphosphate synthase component I"
                     /protein_id="YP_864168.1"
                     /db_xref="GI:117923551"
                     /db_xref="GeneID:4481684"
                     /translation="MKTSLTPLRRDLLIGYLAVAAVAAHMLEATLPGLGPWFKPGLAN
                     VFTVVAFFYLDREAAIWVALIRVLGGSLAMGAFLTPSFFLSGAGMLGAIVVMLLPPLP
                     GMGAVGLSILMALAHMCAQVAAAHLLFVQHSGLFYLLPWFLLGAWCTGWFNGVLAHGL
                     LHTLRQHKV"
     misc_feature    complement(265519..265950)
                     /locus_tag="Mmc1_0235"
                     /note="Heptaprenyl diphosphate synthase component I;
                     Region: Hpre_diP_synt_I; pfam07456"
                     /db_xref="CDD:254210"
     gene            complement(265995..266402)
                     /locus_tag="Mmc1_0236"
                     /db_xref="GeneID:4481685"
     CDS             complement(265995..266402)
                     /locus_tag="Mmc1_0236"
                     /note="KEGG: dar:Daro_0069 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864169.1"
                     /db_xref="GI:117923552"
                     /db_xref="GeneID:4481685"
                     /translation="MAHPLLTSLSWIRRATTPTDGLIAFSTLGMILYFLVAASSQGTD
                     RLEIYKENQLLQSLSLNQTTEIQVAGRLGPVTIEIKPGAARLREFDSPRMIGTRSGWI
                     RGGGEMAICLPCGLFIRIPARQTPPHGLDAVAQ"
     misc_feature    complement(266034..266273)
                     /locus_tag="Mmc1_0236"
                     /note="NGN-insert domain found between N-terminal domain
                     (D1) and C-terminal KOW domain (DIII) repeats of some
                     N-Utilization Substance G (NusG) N-terminal (NGN); Region:
                     NGN-insert_like; cd09910"
                     /db_xref="CDD:197364"
     gene            complement(266384..267391)
                     /locus_tag="Mmc1_0237"
                     /db_xref="GeneID:4481686"
     CDS             complement(266384..267391)
                     /locus_tag="Mmc1_0237"
                     /note="PFAM: ApbE family lipoprotein;
                     KEGG: pca:Pcar_0035 membrane-associated lipoprotein
                     involved in thiamine biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="ApbE family lipoprotein"
                     /protein_id="YP_864170.1"
                     /db_xref="GI:117923553"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR003374"
                     /db_xref="GeneID:4481686"
                     /translation="MSRTWSTLLLLVSLLLSGCSEKVENTTQLRMGTWVSISTLGQHG
                     AAVEAAFAEMGRLEKALSSHDPNSPISRINQGSVNQWHPLDDETAQLLERGLIIQKAS
                     LNRFHMGLYHLSQLWGFMSETPLSQPPALPLREMWRQQATPNLEHAFSLSKQPDTTTL
                     RINNPAFGLDLGAIAKGYAIDRAIAVLRAHGVENAIVNAGGDLRVIGSKFGQPWRIGI
                     QDPTDKERVIARSDLQGDRAMVTSGDYERFFIYQGRRYHHILDPMSGEPADYGWRSVS
                     VQAADAETADALSTALFTMDLAQGKRLLEQFPGCQALWVDQQGEHQQSEGFIGQWLTP
                     S"
     misc_feature    complement(266447..267232)
                     /locus_tag="Mmc1_0237"
                     /note="ApbE family; Region: ApbE; pfam02424"
                     /db_xref="CDD:251284"
     gene            complement(267388..268134)
                     /locus_tag="Mmc1_0238"
                     /db_xref="GeneID:4481687"
     CDS             complement(267388..268134)
                     /locus_tag="Mmc1_0238"
                     /note="PFAM: protein of unknown function DUF558;
                     KEGG: son:SO0832 conserved hypothetical protein TIGR00046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864171.1"
                     /db_xref="GI:117923554"
                     /db_xref="InterPro:IPR006700"
                     /db_xref="GeneID:4481687"
                     /translation="MSTTPRLYTPQPLCAGQPVTLDREAQRYLLKVLRLGEGDALYLF
                     NGEGGAWSAHITQTSGPLQVTPQQFEPEPMAPLNLTLVQGLSRSGPMELVIQKGVELG
                     LQQLIPLQSARSVARAKGEHKLERWQRIAIEAAEQCRRSRLLQFQPVCDWSQLAGSLP
                     EQGPRILFWEDHRHHTPSLRQWAATLEQAPTQITLLIGPEGGLSAEEVTHATTNLGFQ
                     TCSLGPRVLRTETAALAAITALQALLGDMA"
     misc_feature    complement(267442..268125)
                     /locus_tag="Mmc1_0238"
                     /note="16S ribosomal RNA methyltransferase RsmE;
                     Provisional; Region: PRK11713"
                     /db_xref="CDD:236959"
     gene            268300..268854
                     /locus_tag="Mmc1_0239"
                     /db_xref="GeneID:4481688"
     CDS             268300..268854
                     /locus_tag="Mmc1_0239"
                     /note="PFAM: chorismate lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate lyase"
                     /protein_id="YP_864172.1"
                     /db_xref="GI:117923555"
                     /db_xref="InterPro:IPR007440"
                     /db_xref="GeneID:4481688"
                     /translation="MQTPRFQLLQGWQEATALSRAEVADADLCAALTHTGSLTRFLEG
                     RYGHPVDVTVRQQVTAPLAKAPLSALWDKTLALQAHTLLIRDAWVNHAGPMLVYAHSQ
                     IDWDHLDQAERVAIRNGQIPLGGLYLANGAQVNRAHLQISRVTVAGLERVGEAPLWCR
                     RSLFTVDGRPNARILELFVPVDHG"
     misc_feature    268405..268839
                     /locus_tag="Mmc1_0239"
                     /note="Chorismate lyase; Region: Chor_lyase; cl01230"
                     /db_xref="CDD:242378"
     gene            268847..269722
                     /locus_tag="Mmc1_0240"
                     /db_xref="GeneID:4481689"
     CDS             268847..269722
                     /locus_tag="Mmc1_0240"
                     /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
                     PFAM: UbiA prenyltransferase;
                     KEGG: vvy:VV0121 4-hydroxybenzoate polyprenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="YP_864173.1"
                     /db_xref="GI:117923556"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="GeneID:4481689"
                     /translation="MAEHWIERLSWPLLRESLLLMRVHRPIGTYLLMWPALWGVVAAA
                     HPAPPNPVLLALFALGAWVMRSAGCVANDLADRNFDPHVARTKQRPLAAGRISVRAAV
                     VLLVLLLGVALLLALQLNLLTLKLAVAGALLAVTYPLTKRIVAIPQFYMGAAFGWAAV
                     MAWAATAGALAPGAWLLFATTLVWAAGYDTLYGMMDREDDLKIGVKSTAILFGQRDLF
                     WVAILYVLTVLLLLVTGWQLQMQWPYYGTVAGAALHMVWQIQHARSRQAEVLMEAFLS
                     NQWLGMLIGVGLWLG"
     misc_feature    268907..269719
                     /locus_tag="Mmc1_0240"
                     /note="4-Hydroxybenzoate polyprenyltransferase; Region:
                     PT_UbiA_COQ2; cd13959"
                     /db_xref="CDD:260122"
     misc_feature    order(269072..269074,269084..269086,269432..269434,
                     269444..269446)
                     /locus_tag="Mmc1_0240"
                     /note="putative active site [active]"
                     /db_xref="CDD:260122"
     gene            270077..271006
                     /locus_tag="Mmc1_0241"
                     /db_xref="GeneID:4481690"
     CDS             270077..271006
                     /locus_tag="Mmc1_0241"
                     /note="PFAM: response regulator receiver;
                     KEGG: dar:Daro_0110 response regulator receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_864174.1"
                     /db_xref="GI:117923557"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="GeneID:4481690"
                     /translation="MSKAQILLVDDQPINLEILSEYLRDEGYRLCIARDGQEAWELLE
                     KNPLNFHALLLDRMMPRMDGMEVLARMKQHDELRMVPVIMQTAKASQEEIVEGLEGGA
                     HYYLTKPYRKEMLRAIVRTAVDDYNNYRAIRDRSREAQDKAVDSVLSMRLMDSGQFRF
                     QTIKQAQDLAALLSHSCPDPERVVLGLSELLINAVEHGNLGITYEDKSRLLKNRDDWW
                     QEVHRRQSLPENCQKWGRIRFTKSEDRLEILIQDEGNGFDWRGFLEFDQARAFDSHGR
                     GIAMAKMLSFDRLEYHDPGNTVVVRVNLPPKSE"
     misc_feature    270095..270442
                     /locus_tag="Mmc1_0241"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(270104..270109,270242..270244,270266..270268,
                     270332..270334,270389..270391,270398..270403)
                     /locus_tag="Mmc1_0241"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    270242..270244
                     /locus_tag="Mmc1_0241"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(270251..270256,270260..270268)
                     /locus_tag="Mmc1_0241"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    270398..270406
                     /locus_tag="Mmc1_0241"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    270572..270979
                     /locus_tag="Mmc1_0241"
                     /note="Histidine kinase-like ATPase domain; Region:
                     HATPase_c_2; pfam13581"
                     /db_xref="CDD:257897"
     gene            271172..273028
                     /locus_tag="Mmc1_0242"
                     /db_xref="GeneID:4481691"
     CDS             271172..273028
                     /locus_tag="Mmc1_0242"
                     /note="TIGRFAM: UbiD family decarboxylases;
                     PFAM: carboxylyase-related protein;
                     KEGG: vpa:VP2997 3-polyprenyl-4-hydroxybenzoate
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="YP_864175.1"
                     /db_xref="GI:117923558"
                     /db_xref="InterPro:IPR002830"
                     /db_xref="GeneID:4481691"
                     /translation="MGHDPKHFKDLSSFCDFLESQGELVRIREEVDPHLEMTEISTRL
                     LAEQGPAVLYERVSGYAMPVLNNLFGTERRVGLAIGADLHQLEELGELLAYLRQPDPP
                     TGGVGGLLGTARKLSSVRHMPTRSKKSAPWQQVVYQGAAVDLTRLPIQGCWPGDVAPL
                     ITWPVVITRGADQGAVNLGIYRMQLLGKNRLIMRWLKHRGGAQHSRSYRKPMPVAVAI
                     GCDPGTILAAVTPVPDTLSEYAFAGLLMEQSVTVVTGQESGLPIPYSAEIVLEGTVDL
                     NDLADEGPYGDHTGYYNEVERFPVFTVQRISMRRNAIYLSTHTGRPPDEPSVLALALN
                     RVFVPLLKKQFPEISAFHLPAEACSYRVAVIAINKQYAGHAFRMMAGVWGFLRQFLYT
                     KYLIVVDSSVDCHNWDAVMAAVGRHVDARRDLQQLTNTPIDYLDFASPVAGLGGKLGL
                     DATRKSGAELQVVPHPAVWPEAEALQQWAEAAQQRHAGEIVQIHLRAACAMAVVSMHK
                     TAAGQSGTLAKQLLAAWHPGAPRQIWLMDEDVDVTLWDDLWWVVSTRSDAGRDLYRDE
                     IHGGFVMDATHKWPGETQREWGRVLRMDQPTIDRVSEKWPRLGLPGTGKPIW"
     misc_feature    271193..272554
                     /locus_tag="Mmc1_0242"
                     /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
                     Region: UbiD; cl00311"
                     /db_xref="CDD:260344"
     gene            273114..273668
                     /locus_tag="Mmc1_0243"
                     /db_xref="GeneID:4481692"
     CDS             273114..273668
                     /locus_tag="Mmc1_0243"
                     /note="PFAM: redoxin;
                     KEGG: aba:acid345_3927 thioredoxin-like"
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin domain-containing protein"
                     /protein_id="YP_864176.1"
                     /db_xref="GI:117923559"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR011594"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:4481692"
                     /translation="MRRTLLFTLFVLACIGIALVTLLKEAPPPSTASPEPAASATPSQ
                     PAWLQHPLTTLGEETLTLGDFKGKLLLVNFWASWCPPCLAEIPELVQAQNDFGDKGFQ
                     VVGILFQDRADTASLKAFVQRKRINYPVIKDDPGKIQQLSQEMGGVFALPMSLLIDRD
                     GKIVKTHTGQLHYRDLENWLKPRL"
     misc_feature    273258..273620
                     /locus_tag="Mmc1_0243"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    order(273348..273350,273357..273359)
                     /locus_tag="Mmc1_0243"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            273699..274052
                     /locus_tag="Mmc1_0244"
                     /db_xref="GeneID:4481693"
     CDS             273699..274052
                     /locus_tag="Mmc1_0244"
                     /note="PFAM: CutA1 divalent ion tolerance protein;
                     KEGG: noc:Noc_1056 CutA1 divalent ion tolerance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CutA1 divalent ion tolerance protein"
                     /protein_id="YP_864177.1"
                     /db_xref="GI:117923560"
                     /db_xref="InterPro:IPR004323"
                     /db_xref="GeneID:4481693"
                     /translation="MSTAQGIIVWCSVPDQASANTLSQRLVEQKLAACVHTLPQGRST
                     YRWLGKVEHQSEHLLMIKSHPRCETALIEAICANHPYEVPEIILTRIDAGLPAYMQWL
                     AQSVEQNPLSPEQEP"
     misc_feature    273717..274019
                     /locus_tag="Mmc1_0244"
                     /note="CutA1 divalent ion tolerance protein; Region:
                     CutA1; cl00584"
                     /db_xref="CDD:260513"
     gene            274053..274793
                     /locus_tag="Mmc1_0245"
                     /db_xref="GeneID:4481694"
     CDS             274053..274793
                     /locus_tag="Mmc1_0245"
                     /note="PFAM: cytochrome C biogenesis protein,
                     transmembrane region;
                     KEGG: rpa:RPA4472  c-type cytochrome biogenesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein, transmembrane
                     region"
                     /protein_id="YP_864178.1"
                     /db_xref="GI:117923561"
                     /db_xref="InterPro:IPR003834"
                     /db_xref="GeneID:4481694"
                     /translation="MPDVTLLTAFGAGFLSFISPCVLPLVPAYLSYMSGISVDEMKAA
                     GAQGNHKVAMHAALHSLAFVLGFSLVFVGLGATASALGQLMFDYMEYLSKIGGVLIVI
                     FGLHFMGLFRISFLNFEARFNPDRKPPGMWGAFFIGLAFAFGWTPCVGPILAGILALS
                     AGQDTVHEGIVLLVAYSAGLGLPFILAGLAINRFLVFFKKVRQHMHKVEIVAGGLLVI
                     IGVLIFFGNMTVISSLLLQIFPGLGELG"
     misc_feature    274059..274721
                     /locus_tag="Mmc1_0245"
                     /note="Cytochrome c biogenesis protein [Posttranslational
                     modification, protein turnover, chaperones]; Region: CcdA;
                     COG0785"
                     /db_xref="CDD:223856"
     gene            275258..276753
                     /locus_tag="Mmc1_R0003"
                     /db_xref="GeneID:4481695"
     rRNA            275258..276753
                     /locus_tag="Mmc1_R0003"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:4481695"
     gene            276952..279725
                     /locus_tag="Mmc1_R0004"
                     /db_xref="GeneID:4481696"
     rRNA            276952..279725
                     /locus_tag="Mmc1_R0004"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:4481696"
     gene            279929..280043
                     /locus_tag="Mmc1_R0005"
                     /db_xref="GeneID:4483565"
     rRNA            279929..280043
                     /locus_tag="Mmc1_R0005"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:4483565"
     gene            280268..280702
                     /gene="rplM"
                     /locus_tag="Mmc1_0246"
                     /db_xref="GeneID:4483566"
     CDS             280268..280702
                     /gene="rplM"
                     /locus_tag="Mmc1_0246"
                     /note="in Escherichia coli this protein is one of the
                     earliest assembly proteins in the large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="YP_864179.1"
                     /db_xref="GI:117923562"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="GeneID:4483566"
                     /translation="MKSFVAKPSTIERKWYVIDATDMVVGRLASEVAKRLRGKHKPTY
                     TPFMDCGDNIIIVNAEKVRFTGNKRNDKVYYWHSRFPGGLKSITADKELSGNHPERVL
                     EKAIKGMLPKNVLGRQMFRKLNVYKGSEHPHTAQQPEELKLG"
     misc_feature    280310..280654
                     /gene="rplM"
                     /locus_tag="Mmc1_0246"
                     /note="Ribosomal protein L13.  Protein L13, a large
                     ribosomal subunit protein, is one of five proteins
                     required for an early folding intermediate of 23S rRNA in
                     the assembly of the large subunit. L13 is situated on the
                     bottom of the large subunit, near the...; Region:
                     Ribosomal_L13; cd00392"
                     /db_xref="CDD:238230"
     misc_feature    order(280337..280339,280343..280348,280355..280357,
                     280364..280366,280376..280378,280460..280462,
                     280466..280468,280553..280558,280574..280582,
                     280586..280594,280598..280606,280610..280612,
                     280616..280618,280628..280630,280637..280642)
                     /gene="rplM"
                     /locus_tag="Mmc1_0246"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238230"
     misc_feature    280556..280558
                     /gene="rplM"
                     /locus_tag="Mmc1_0246"
                     /note="L3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238230"
     gene            280715..281107
                     /locus_tag="Mmc1_0247"
                     /db_xref="GeneID:4483567"
     CDS             280715..281107
                     /locus_tag="Mmc1_0247"
                     /note="PFAM: ribosomal protein S9;
                     KEGG: rsp:RSP_0021 30S ribosomal protein S9"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="YP_864180.1"
                     /db_xref="GI:117923563"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="GeneID:4483567"
                     /translation="MAQETFNATGKRKESVARVRIVPGSGKVTINQKPMDVYFGRPVL
                     RMVVNQPFSVTEMENKFDVLVNVHGGGVSGQAGAIKHGISKALVDYDEALRPALKKAG
                     FLTRDARTVERKKYGRHKARKSTQFSKR"
     misc_feature    280715..281104
                     /locus_tag="Mmc1_0247"
                     /note="30S ribosomal protein S9; Reviewed; Region: rpsI;
                     PRK00132"
                     /db_xref="CDD:178888"
     gene            281241..282290
                     /locus_tag="Mmc1_0248"
                     /db_xref="GeneID:4483568"
     CDS             281241..282290
                     /locus_tag="Mmc1_0248"
                     /EC_number="1.2.1.38"
                     /note="KEGG: pca:Pcar_1898
                     N-acetyl-gamma-glutamyl-phosphate reductase;
                     TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase;
                     PFAM: semialdehyde dehydrogenase, NAD - binding;
                     semialdehyde dehydrogenase, dimerisation region"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="YP_864181.1"
                     /db_xref="GI:117923564"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="GeneID:4483568"
                     /translation="MGRTLRVAILGATGYTGGELIRLLHRHPGAELSFVSSERFAGQS
                     IAKVYTHLQAVGHLICQPMDAKKACEAADFIFCALPHVTSMEVVPELLQRGAKVVDLS
                     ADFRLKSAETYAHWYGTQHLAPELLPQAAYGLPELFRESIKGANLVANPGCYPTSVQL
                     PLFPLLQEGMIDPALVIADSKSGVSGAGRSPAQGTLFAELSEGFKAYKVEAHRHIPEM
                     EQNLALAAGKEIKIRFTPHLLPQSRGILSTCYLRPTSGVNAQRVRDTLMTRYRDEPFV
                     TVLPHGDMPATSDVRGSNACHMGVTEDLRSGWLIIVSVIDNLVKGASGAAVQNFNLMT
                     GWDETTALDSLPMFP"
     misc_feature    281253..282287
                     /locus_tag="Mmc1_0248"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase, common
                     form; Region: argC; TIGR01850"
                     /db_xref="CDD:233597"
     misc_feature    281256..281675
                     /locus_tag="Mmc1_0248"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    281724..282200
                     /locus_tag="Mmc1_0248"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            282439..282696
                     /locus_tag="Mmc1_0249"
                     /db_xref="GeneID:4483569"
     CDS             282439..282696
                     /locus_tag="Mmc1_0249"
                     /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
                     protein;
                     KEGG: par:Psyc_0327  4Fe-4S ferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="YP_864182.1"
                     /db_xref="GI:117923565"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4483569"
                     /translation="MALIINEDCTNCDVCLPECPNEAITDGSDVDSDIYYIHPDLCSE
                     CKGSFDEPQCVSVCPVECIEQDPDHVESEEELLAKHEAIHG"
     misc_feature    282439..282642
                     /locus_tag="Mmc1_0249"
                     /note="Ferredoxin [Energy production and conversion];
                     Region: COG1146"
                     /db_xref="CDD:224069"
     gene            282884..283771
                     /locus_tag="Mmc1_0250"
                     /db_xref="GeneID:4483570"
     CDS             282884..283771
                     /locus_tag="Mmc1_0250"
                     /note="PFAM: YicC N-terminal domain protein; domain of
                     unknown function DUF1732;
                     KEGG: mca:MCA3026 conserved hypothetical protein
                     TIGR00255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864183.1"
                     /db_xref="GI:117923566"
                     /db_xref="InterPro:IPR005229"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR013527"
                     /db_xref="InterPro:IPR013551"
                     /db_xref="GeneID:4483570"
                     /translation="MPNSMTGIGRSEASVQGMRLAWRLRSVNQRFLEMNLRLPDLFLD
                     AEPRFRQRLRGHFARGSVEATLTMQQDGPSQVKMQLDRERLGQILAAEKNMRELDGSH
                     RGELSMDRLLSWPGVLKELPVAWDSQQLEEIWHQADSLLESACEEMTQFRGREGAALA
                     QGILERLHELEQLAQQIEADLPRVREILEKRLHEKLAQIAENPADPARMAQEVGYLLT
                     KVDVSEELERLSIHIREMRDTLELSEPVGRRLDFLCQELNRESNTLCSKPQDPTISRI
                     GVDMKVAIEKIREQVQNLE"
     misc_feature    282884..283768
                     /locus_tag="Mmc1_0250"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11820"
                     /db_xref="CDD:236993"
     misc_feature    282893..283366
                     /locus_tag="Mmc1_0250"
                     /note="YicC-like family, N-terminal region; Region:
                     YicC_N; pfam03755"
                     /db_xref="CDD:252148"
     misc_feature    283511..283768
                     /locus_tag="Mmc1_0250"
                     /note="Domain of unknown function (DUF1732); Region:
                     DUF1732; pfam08340"
                     /db_xref="CDD:254742"
     gene            283786..284409
                     /locus_tag="Mmc1_0251"
                     /db_xref="GeneID:4483571"
     CDS             283786..284409
                     /locus_tag="Mmc1_0251"
                     /EC_number="2.7.4.8"
                     /note="KEGG: nar:Saro_1003 guanylate kinase;
                     PFAM: guanylate kinase;
                     SMART: guanylate kinase/L-type calcium channel region"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_864184.1"
                     /db_xref="GI:117923567"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="GeneID:4483571"
                     /translation="MLQTRGFALIVSAPSGTGKTTLTRHLMATQPNIALSVSTTTRGA
                     RPGEEEGTHYFFVDKNRFETRIEQGCFLEWAEVFGNYYGTDRGFVKEHIEAGHVVLLD
                     IDWQGARQIRDNMDAHDVVSIFIAPPAQDKLEIRLRGRKTDSEEVIQKRMQQAAAEFS
                     HWDEFDYVVVNDDLAQAKVELSAVLVAERLRRGRMQATIQPILKTFA"
     misc_feature    283810..284349
                     /locus_tag="Mmc1_0251"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    283810..284316
                     /locus_tag="Mmc1_0251"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    order(283822..283824,283840..283842,283888..283890,
                     283909..283911,283918..283920,283945..283947,
                     284014..284016,284029..284031)
                     /locus_tag="Mmc1_0251"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    order(283822..283824,283840..283842)
                     /locus_tag="Mmc1_0251"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            284490..284855
                     /locus_tag="Mmc1_0252"
                     /db_xref="GeneID:4483572"
     CDS             284490..284855
                     /locus_tag="Mmc1_0252"
                     /note="TIGRFAM: DNA-directed RNA polymerase subunit omega;
                     PFAM: RNA polymerase Rpb6;
                     KEGG: mlo:mlr7753 RNA polymerase omega subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="YP_864185.1"
                     /db_xref="GI:117923568"
                     /db_xref="InterPro:IPR003716"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="GeneID:4483572"
                     /translation="MARVTVDDCVQHVSNRFELVILAAKRARQLAKGAEPEVSVDRDK
                     NTVVALREIAESKLNMDDLRRMEETVVEEEVVDEVIRFEIADLAVSDDLADGDAANDL
                     QGEEDDLGLGLDEAEDLGF"
     misc_feature    284490..284684
                     /locus_tag="Mmc1_0252"
                     /note="DNA-directed RNA polymerase subunit omega;
                     Reviewed; Region: rpoZ; PRK00392"
                     /db_xref="CDD:234744"
     gene            284969..287230
                     /locus_tag="Mmc1_0253"
                     /db_xref="GeneID:4483573"
     CDS             284969..287230
                     /locus_tag="Mmc1_0253"
                     /EC_number="2.7.6.5"
                     /note="KEGG: mag:amb2253 guanosine polyphosphate
                     pyrophosphohydrolase/synthetase;
                     TIGRFAM: RelA/SpoT family protein;
                     PFAM: amino acid-binding ACT domain protein; TGS domain
                     protein; RelA/SpoT domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="(p)ppGpp synthetase I SpoT/RelA"
                     /protein_id="YP_864186.1"
                     /db_xref="GI:117923569"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004811"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="GeneID:4483573"
                     /translation="MQGWDTIYEGVISYHAEADLSPLKRVVDLFEEIQWPAETIDRDS
                     PIHPLVIAKTLLKMRMDVASLACALLVHPYSQRRFELDTVKQRFGDDIAFLLEGISRI
                     SLLSLRTPEKKQKETTIEEPEEGASLEDGPPTPRSVGEMIGEIHHGTILVRDENQAEG
                     FRKLVLAMAKDIRVILIRLVLCLHQLRLAMRMGPVASVANLSHEVMEIYAPIAHRLGV
                     YWLKNELEDLAFRMQWPGQYDAIRAKVLERRKGGEDVVQKVIAILGDKLVSHHIQGQV
                     FGREKHLYSVWSKINRKQITLDDMFDLIAYRIIVPNKEDCYRTLGMIHSEFKPIPGRF
                     KDYVAIPKRNGYQSLHTVVFGPFGNRIEIQIRTEKMHQIAESGVAAHWSYKGKGGGGN
                     STTGYAWLKDLLALQESVDDPGQFVENVRFDLFPEEIYVFTPNGEIITLPSKATPVDF
                     AYAVHSQVGNSCQGAKINGRIVPLKTPLVTGDTISIITGKNREPNPNWLQFVVTSKAK
                     YWIGRFVKEKQRQQSIGLGREILEREGRKVGSSITEKQLRVVLETFRCENIDDLYYNI
                     GISRVSALQVVHKLFPGSAPAFTERKNQVARAGVERRGDKLALTGALEGIAVQAARCC
                     SPLPGDVVVGIINTGRGITLHRISCNNLKSMEDQPERWVEDINWGGDKLLAHTARIRA
                     MVSNRRGLLTPISQVITEAKANLLDVHVQDRDRDPCMVVLEVEVINHDHLERVLANLR
                     SVPEVRSVDRMNA"
     misc_feature    285104..287221
                     /locus_tag="Mmc1_0253"
                     /note="Guanosine polyphosphate
                     pyrophosphohydrolases/synthetases [Signal transduction
                     mechanisms / Transcription]; Region: SpoT; COG0317"
                     /db_xref="CDD:223394"
     misc_feature    285107..285625
                     /locus_tag="Mmc1_0253"
                     /note="HD domain; Region: HD_4; pfam13328"
                     /db_xref="CDD:257658"
     misc_feature    285737..286093
                     /locus_tag="Mmc1_0253"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    order(285803..285805,285809..285811,285872..285877,
                     285887..285889,285971..285973,285977..285979,
                     285992..285994,285998..286000,286004..286006,
                     286016..286018,286052..286054,286058..286060,
                     286064..286066,286088..286093)
                     /locus_tag="Mmc1_0253"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    order(285803..285805,285971..285973,285977..285979,
                     285992..285994,285998..286000,286004..286006,
                     286016..286018,286052..286054,286058..286060,
                     286088..286090)
                     /locus_tag="Mmc1_0253"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    order(285872..285874,286052..286054)
                     /locus_tag="Mmc1_0253"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    286253..286432
                     /locus_tag="Mmc1_0253"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    287006..287218
                     /locus_tag="Mmc1_0253"
                     /note="ACT  domain found C-terminal of the RelA/SpoT
                     domains; Region: ACT_RelA-SpoT; cd04876"
                     /db_xref="CDD:153148"
     gene            287331..287723
                     /locus_tag="Mmc1_0254"
                     /db_xref="GeneID:4483574"
     CDS             287331..287723
                     /locus_tag="Mmc1_0254"
                     /note="TIGRFAM:  endoribonuclease L-PSP;
                     PFAM: endoribonuclease L-PSP;
                     KEGG: sye:Syncc9902_0877 YjgF-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_864187.1"
                     /db_xref="GI:117923570"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="GeneID:4483574"
                     /translation="MHQKIAIATPHAPQAIGPYSQAIQQNGWLYISGQIALDPTTGVV
                     VGQGDVGAETHRVMQNLAAILEAAGGGFKDVVKCQIFLADMDDFATVNEIYASYLSEP
                     FPARATVQVAKLPKGVKVEIDATAFVGG"
     misc_feature    287385..287708
                     /locus_tag="Mmc1_0254"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    order(287385..287390,287397..287399,287403..287405,
                     287412..287414,287418..287420,287424..287429,
                     287550..287552,287556..287561,287565..287567,
                     287571..287573,287604..287606,287613..287615,
                     287640..287663,287691..287693,287697..287699,
                     287703..287705)
                     /locus_tag="Mmc1_0254"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    order(287385..287387,287592..287594,287604..287606,
                     287646..287648,287691..287693)
                     /locus_tag="Mmc1_0254"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            287772..288101
                     /locus_tag="Mmc1_0255"
                     /db_xref="GeneID:4483575"
     CDS             287772..288101
                     /locus_tag="Mmc1_0255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864188.1"
                     /db_xref="GI:117923571"
                     /db_xref="InterPro:IPR001400"
                     /db_xref="GeneID:4483575"
                     /translation="MRPLTLVGLVMALLVGIVPQARAGQGLYCLHGDAGIHCVYASFT
                     ACMAAAAGSHGECKLNQNGMLKPVGGAPYCIAEKWRVHCIYPSMESCMVQAMARRAQC
                     VPNPNQH"
     misc_feature    287772..288026
                     /locus_tag="Mmc1_0255"
                     /note="Protein of unknown function (DUF3551); Region:
                     DUF3551; pfam12071"
                     /db_xref="CDD:256833"
     gene            288105..289238
                     /locus_tag="Mmc1_0256"
                     /db_xref="GeneID:4483576"
     CDS             288105..289238
                     /locus_tag="Mmc1_0256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864189.1"
                     /db_xref="GI:117923572"
                     /db_xref="GeneID:4483576"
                     /translation="MVTETPPISHRLDRLLTRFVVGVALLLLFGLGVRMMPLFKVKVG
                     EVTSLLSDTGLEVSFEVCMPLYGPAPDRDDLRVREAVRGRIMQTMRREASVKDPAYWR
                     VSTLDLHGAKGNNRCQVVLAVLTPRPAGLAPVGGRGVDELFEVGRVLRMALHEGSGNV
                     AHLDRTTGRWEGIIPELGRGIARQDRAEGEVLFVEMKSVDALLDAVRFGIADVAEGHI
                     AYTEERDEQFYLSNAYLDTGLMLGSFESEDAQKLVEKRNINNGRIKLVVVKQSLAAEL
                     ARGRFPRAVIHYVESVEGIPQKVHWLRERFQNPLNRILFLTDEIIALGWHETVPLALN
                     NTPLLTEDHYILATWNAALQAQANHYLQNHPIQESYRIAVRGK"
     misc_feature    288606..>289079
                     /locus_tag="Mmc1_0256"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(288696..288698,288774..288776,288918..288920,
                     289056..289058)
                     /locus_tag="Mmc1_0256"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(288981..288983,289014..289016,289038..289040)
                     /locus_tag="Mmc1_0256"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     gene            complement(289295..290020)
                     /locus_tag="Mmc1_0257"
                     /db_xref="GeneID:4483577"
     CDS             complement(289295..290020)
                     /locus_tag="Mmc1_0257"
                     /note="PFAM: DNA repair protein RadC;
                     KEGG: det:DET1462 DNA repair protein, RadC family"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="YP_864190.1"
                     /db_xref="GI:117923573"
                     /db_xref="InterPro:IPR001405"
                     /db_xref="GeneID:4483577"
                     /translation="MAQENPKKTTKTKLHGGHRDRLRNRFAQEGLDGFEDHQILELAL
                     FYALPRRDTNPIAHRLMQRFGSLSAVMEADPVDLATVEGMGETAALFITMLPALTRRY
                     QHDAATRNKTPLNRADNVRDYLVPLMAGRTEEVFYVLCLDAQCRLLFPALVTEGTIRQ
                     AHVHPRQVVELVIRHKAAHVILAHNHPSGNPKASQDDILLTSHLMQALNPIDVQVLDH
                     LIIAGEKVFSFASAGMMPKQRVR"
     misc_feature    complement(289316..289969)
                     /locus_tag="Mmc1_0257"
                     /note="hypothetical protein; Reviewed; Region: PRK00024"
                     /db_xref="CDD:178801"
     misc_feature    complement(<289754..>289852)
                     /locus_tag="Mmc1_0257"
                     /note="H3TH domains of structure-specific 5' nucleases (or
                     flap endonuclease-1-like) involved in DNA replication,
                     repair, and recombination; Region:
                     H3TH_StructSpec-5'-nucleases; cl14815"
                     /db_xref="CDD:265460"
     misc_feature    complement(289331..289669)
                     /locus_tag="Mmc1_0257"
                     /note="Mov34/MPN/PAD-1 family; Region: MPN_DUF2466;
                     cd08071"
                     /db_xref="CDD:163702"
     misc_feature    complement(order(289430..289432,289439..289441,
                     289463..289465,289469..289471,289619..289621))
                     /locus_tag="Mmc1_0257"
                     /note="MPN+ (JAMM) motif; other site"
                     /db_xref="CDD:163702"
     misc_feature    complement(order(289430..289432,289463..289465,
                     289469..289471))
                     /locus_tag="Mmc1_0257"
                     /note="Zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:163702"
     gene            290259..291641
                     /locus_tag="Mmc1_0258"
                     /db_xref="GeneID:4483578"
     CDS             290259..291641
                     /locus_tag="Mmc1_0258"
                     /note="KEGG: sat:SYN_00640 replicative DNA helicase;
                     TIGRFAM: replicative DNA helicase;
                     PFAM: DnaB domain protein helicase, N-terminal domain
                     protein; DnaB domain protein helicase, C-terminal domain
                     protein;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="primary replicative DNA helicase"
                     /protein_id="YP_864191.1"
                     /db_xref="GI:117923574"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007692"
                     /db_xref="InterPro:IPR007693"
                     /db_xref="InterPro:IPR007694"
                     /db_xref="GeneID:4483578"
                     /translation="MEPLNSGSPLGQDPDAPKKRATWSREAEQSVLGAILLDNHVMDS
                     VADALDVDDFYMGAHRKIYQAMLDLLERGEPLDPVVIRQYLERSDELDSVGGPVYLAE
                     LLNTVPTAANAKAYARMVRDKALLRGLAQTATEVVERCHTSEAPVDQILEEAEQKIFQ
                     LGESKDSRRSTYHDMRSIMVPVFEKIELLMEQQKAVTGVATGFIDLDQQLAGCQPSDL
                     IILAGRPSMGKTALAMNIAANAALHHREAVGVFSLEMSKEQLAMRMLASEARMDAQAM
                     RIGKIATSDYQKLTNTATLLSEAPIYIDDTPAISITALRAKARRLKRDKGLKLIVVDY
                     LQLMRGSSNTDNRVQEISQISQGLKAIAKEMSVPVIALSQLSRSVEQRPDKRPILSDL
                     RESGSIEQDADVVMFVFREEYYKREDIDLKGKAEVIIAKQRNGPVGVVKLAFQNQFTR
                     FENFANRQEY"
     misc_feature    290328..291626
                     /locus_tag="Mmc1_0258"
                     /note="replicative DNA helicase; Region: DnaB; TIGR00665"
                     /db_xref="CDD:233080"
     misc_feature    290328..290624
                     /locus_tag="Mmc1_0258"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:250122"
     misc_feature    290871..291596
                     /locus_tag="Mmc1_0258"
                     /note="DnaB helicase C terminal domain. The hexameric
                     helicase DnaB unwinds the DNA duplex at the  chromosome
                     replication fork. Although the mechanism by which DnaB
                     both couples ATP hydrolysis to translocation along DNA and
                     denatures the duplex is unknown, a...; Region: DnaB_C;
                     cd00984"
                     /db_xref="CDD:238484"
     misc_feature    290928..290948
                     /locus_tag="Mmc1_0258"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    order(290943..290948,291255..291257,291378..291380,
                     291486..291488,291555..291557,291588..291590)
                     /locus_tag="Mmc1_0258"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238484"
     misc_feature    291246..291257
                     /locus_tag="Mmc1_0258"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    order(291270..291275,291294..291302,291375..291401,
                     291483..291488,291525..291530)
                     /locus_tag="Mmc1_0258"
                     /note="DNA binding loops [nucleotide binding]"
                     /db_xref="CDD:238484"
     gene            293060..294250
                     /locus_tag="Mmc1_0259"
                     /db_xref="GeneID:4483579"
     CDS             293060..294250
                     /locus_tag="Mmc1_0259"
                     /EC_number="5.1.1.1"
                     /note="KEGG: pca:Pcar_2234 alanine racemase;
                     TIGRFAM: alanine racemase;
                     PFAM: alanine racemase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_864192.1"
                     /db_xref="GI:117923575"
                     /db_xref="InterPro:IPR000821"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR011079"
                     /db_xref="GeneID:4483579"
                     /translation="MLPPTLAYTTANPMQWTHRPTWLEIDLAALRHNLRQARTATGPQ
                     VAHFPVIKADGYGIGAIAVAHTLEEEADGFCVALVEEAEQLRTAGINKRIMLFSGLYP
                     GLEERAIRARVEPFLSDEINLNALWQAAKCYGPISVHIKIDSGMARLGYHPEHVPSLL
                     DQLAHMPELKLAGLVSHMACADDRHSPITNAQLATLSPILEHPLVKQTQAQLSLANSA
                     TILGHPNAHYQWVRPGIMIYGASPFFPHTNAANEGLQPVVRWVTHIQRIHTLEKGKSL
                     GYGHTFTATRPTRIAQLPVGYADGYNRLWSNKGSVLIAGQHCPVVGIVCMDQIAVDIS
                     DLQGEVKQWDEAVLLGKQHNAEITLENWATELKTIPYEILTRIGPRVPRRYRDGSILS
                     GSFG"
     misc_feature    293111..294217
                     /locus_tag="Mmc1_0259"
                     /note="alanine racemase; Reviewed; Region: alr; PRK00053"
                     /db_xref="CDD:234600"
     misc_feature    293117..294217
                     /locus_tag="Mmc1_0259"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Alanine Racemase; Region: PLPDE_III_AR; cd00430"
                     /db_xref="CDD:143481"
     misc_feature    order(293207..293209,293213..293215,293225..293227,
                     293348..293350,293480..293482,293501..293503,
                     293588..293590,293705..293710,293753..293764,
                     293891..293893,293948..293950,294032..294037,
                     294170..294172)
                     /locus_tag="Mmc1_0259"
                     /note="active site"
                     /db_xref="CDD:143481"
     misc_feature    order(293207..293209,293213..293215,293225..293227,
                     293348..293350,293501..293503,293588..293590,
                     293705..293710,293753..293764,294170..294172)
                     /locus_tag="Mmc1_0259"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    order(293213..293218,293288..293290,293297..293302,
                     293411..293416,293495..293506,293588..293590,
                     293594..293596,293852..293863,293867..293869,
                     293879..293884,293888..293896,293933..293935,
                     293948..293950,293966..293968,294038..294043,
                     294158..294163,294170..294175,294197..294199)
                     /locus_tag="Mmc1_0259"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    order(293213..293215,293225..293227,293501..293503,
                     293588..293590,293891..293893,293948..293950,
                     294032..294037,294170..294172)
                     /locus_tag="Mmc1_0259"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143481"
     misc_feature    order(293213..293215,293891..293893)
                     /locus_tag="Mmc1_0259"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143481"
     gene            295056..296051
                     /locus_tag="Mmc1_0260"
                     /db_xref="GeneID:4483580"
     CDS             295056..296051
                     /locus_tag="Mmc1_0260"
                     /note="SMART: extracellular solute-binding protein, family
                     3;
                     KEGG: bja:blr5802 ABC transporter substrate-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_864193.1"
                     /db_xref="GI:117923576"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:4483580"
                     /translation="MERRLLRVALVLVAVVTGSVYYTYHKTPGALDPVGTLSIAASKT
                     LSPTLVWLAHDKGFFQKAGLEVTLIPAATGKVAGESLLNGQADLAAATEFLALRMVNT
                     QADLRVLGTLAFVHQMKLIALKEKGIRSAVDLKGKKIGVRLGTNGEYFLERLLALNGL
                     DQQAIQRVDLKPQEMAARLAQGEVDGVMIWPPLVQQIEGQLGDRVVSFDGQPEQDYYY
                     VLMGLESWLQKNPLKAERVMLALTQAEAWFKANPQEGVAYMAGLFALPPALLEKALAD
                     YHLAVTLPQSLLTMLEAEARWLSSVGLSRRMDNYLQIMSPGPLKKVAPSMVTITP"
     misc_feature    295164..295964
                     /locus_tag="Mmc1_0260"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    295221..295721
                     /locus_tag="Mmc1_0260"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(295275..295277,295368..295370,295491..295493,
                     295623..295625)
                     /locus_tag="Mmc1_0260"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(295572..295574,295584..295586,295602..295604)
                     /locus_tag="Mmc1_0260"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    295692..295709
                     /locus_tag="Mmc1_0260"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            296065..298911
                     /locus_tag="Mmc1_0261"
                     /db_xref="GeneID:4483581"
     CDS             296065..298911
                     /locus_tag="Mmc1_0261"
                     /note="PFAM: response regulator receiver; ATP-binding
                     region, ATPase domain protein domain protein; histidine
                     kinase, HAMP region domain protein; histidine kinase A
                     domain protein domain protein;
                     KEGG: sat:SYN_00226 signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic sensor hybrid histidine kinase"
                     /protein_id="YP_864194.1"
                     /db_xref="GI:117923577"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4483581"
                     /translation="MNIRSIVFLFGFSGSAILAAGIWSFSVSYGEVTALFQRQNIISQ
                     ITDQGYRLALLTNEVLLQREIRAEQQWLSLYRMLEQFLEKNAAQLTPVQSYVQGIQHS
                     LQNLHQLFERVTEGFKIGPLEGNAYQAQQRLYLLQMSQISIRIAELQTRLGELTNISN
                     DAAEKTAGSSYEGVLFQFGLFLFALILYAVLAILFFYTRLLEPLNRLHKGIQRIQQGD
                     VKHRPSHRVMDELGALFAAFSHLLDELQIAITYRKNNEEHLRQLLKLNEEASHLSERE
                     LCDRGLGIVVSLTQSEVGYLHMVHSDQETLTRVTWNHPRMALGHALDDALVFLNQAGV
                     LTDWAAREKPIIQNNKPNFQDDQEVSADRFTFFRHLSVPVIEGNNVRMVMGVGNKAED
                     YNQNDVRQLQTVANEVGKFVQRRRSEIALRIASDEALKANRAKSDFLAVMSHEIRTPM
                     NAIMGMTELLEETELTTIQRNYLSICRSSGQNLLQLINDILDISKVEAGRMEVAVAPF
                     HLHRIIHDANQVILFRAQEKGLNQIVYIDPAVPTILLGDQARIRQILINFLGNSVKFT
                     QSGTIATLVTTRAHANKEDQLVIHVVDTGIGIEQSEQEAIFKAFHQVDSSNQRQQGGT
                     GLGLAICLKLVALMQGSVSLSSRAGKGSTFTLTLPLTVAPAEQIQSLKVERGLTGYHM
                     VIWHTHPISTLYIEEMFKERGAKVRSCNQSMTLANCAIQGDAVLATTDMMIIHYHEED
                     KTNPLELINTIRSEQSLHEIPVLVYGRCYDPALLKQLNQLGVRFLPESLMQDVLCEQI
                     VTELSKRPRSAVTSGQGGTLPMHILLVDDSPDNIFLIQAFLKKTSYQISTVYNGKEAV
                     EYVMQADTPPDLILMDIQMPIMDGYAATRQIRLLEQQQGQSRIPIIALTAHAMAEEAE
                     KLKAAGCDLHMAKPVSKRILLEVLGRYHEKMAYS"
     misc_feature    296662..296802
                     /locus_tag="Mmc1_0261"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(296662..296667,296674..296679,296683..296688,
                     296695..296700,296704..296706,296752..296757,
                     296761..296766,296773..296778,296782..296787,
                     296794..296799)
                     /locus_tag="Mmc1_0261"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    296875..297291
                     /locus_tag="Mmc1_0261"
                     /note="GAF domain; Region: GAF_2; pfam13185"
                     /db_xref="CDD:257553"
     misc_feature    297358..297549
                     /locus_tag="Mmc1_0261"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(297376..297378,297388..297390,297400..297402,
                     297409..297411,297421..297423,297430..297432,
                     297478..297480,297490..297492,297499..297501,
                     297511..297513,297520..297522,297532..297534)
                     /locus_tag="Mmc1_0261"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    297394..297396
                     /locus_tag="Mmc1_0261"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    297715..298038
                     /locus_tag="Mmc1_0261"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(297733..297735,297745..297747,297754..297756,
                     297835..297837,297841..297843,297847..297849,
                     297853..297858,297937..297948,297994..297996,
                     298000..298002,298015..298020,298024..298026)
                     /locus_tag="Mmc1_0261"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    297745..297747
                     /locus_tag="Mmc1_0261"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(297847..297849,297853..297855,297937..297939,
                     297943..297945)
                     /locus_tag="Mmc1_0261"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    298531..298890
                     /locus_tag="Mmc1_0261"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(298540..298545,298678..298680,298702..298704,
                     298777..298779,298834..298836,298843..298848)
                     /locus_tag="Mmc1_0261"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    298678..298680
                     /locus_tag="Mmc1_0261"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(298687..298692,298696..298704)
                     /locus_tag="Mmc1_0261"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    298843..298851
                     /locus_tag="Mmc1_0261"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            299087..299884
                     /locus_tag="Mmc1_0262"
                     /db_xref="GeneID:4483582"
     CDS             299087..299884
                     /locus_tag="Mmc1_0262"
                     /note="PFAM: sporulation domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation domain-containing protein"
                     /protein_id="YP_864195.1"
                     /db_xref="GI:117923578"
                     /db_xref="InterPro:IPR007730"
                     /db_xref="GeneID:4483582"
                     /translation="MGALFRVDFTGLSSPNIGSLQKIEAIEIMDQSSSWLRIFGLLAL
                     MLFMFHPPQEGWSKNVAMPTEGGQNVPPVVTVAHGLHTVLLASTSRQDEAVATHLAVQ
                     KIGLQQVWCRKQPDMRPPQIQVIAGPYSTTTQAQQLRDWVARRTGIQGMLRVTQYPEV
                     VPDAQTRLKTCGESGRRLPVNAPSTAAEGDYIVLVGAFGSQQNGTLVLENLLHKNIPA
                     RMKMVGQGERSRFNIMVGPFKDKWDAEDVVRLIKDETGLTAQYQQIH"
     misc_feature    299645..299845
                     /locus_tag="Mmc1_0262"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            299982..301340
                     /locus_tag="Mmc1_0263"
                     /db_xref="GeneID:4482316"
     CDS             299982..301340
                     /locus_tag="Mmc1_0263"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_864196.1"
                     /db_xref="GI:117923579"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004504"
                     /db_xref="GeneID:4482316"
                     /translation="MAKAKEQFVCTECGAEYSQWQGKCHTCQAWNSLKAFTPAKKGAR
                     AAHPTLGVAMEPITLDSVAGGEAPRIQIGISELDRVLGGGLVSGAAILIGGDPGIGKS
                     TLLMGALAKLSTSLRVLYVSGEESLIQLKLRAERMGVDGANFWVFMENRLEAVEEAVN
                     KQQPDVLVVDSIQTIAGDEIPSAAGTVTQVRECASRMIQWAKRRNMALFLIGHVTKEG
                     QIAGPRILEHMVDTVLYFEGERGHSYRILRAVKNRFGAANEIGVFEMRENGLAQVTNP
                     SELFLAERVGGAAGSVVYAGLEGTRPVLIEIQSLVTPSPLPQPRRNTVGIDTNRLAML
                     IAVLEKRLGLGLFNHDIFLNVAGGFRINEPSADLAVTLSLYAALRNISLDPGMVVLGE
                     VGLAGEVRAVSHATTRLKEAQKLGFTRCILPKKSMKGVPDGLGITLHPVALIEDAIAL
                     LA"
     misc_feature    299982..301334
                     /locus_tag="Mmc1_0263"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    300003..301112
                     /locus_tag="Mmc1_0263"
                     /note="Sms (bacterial radA) DNA repair protein. This
                     protein is not related to archael radA any more than is to
                     other RecA-like NTPases. Sms has a role in recombination
                     and recombinational repair and is responsible for the
                     stabilization or processing of...; Region: Sms; cd01121"
                     /db_xref="CDD:238541"
     misc_feature    300264..300287
                     /locus_tag="Mmc1_0263"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238541"
     misc_feature    order(300267..300269,300279..300287,300339..300341,
                     300345..300347,300489..300494)
                     /locus_tag="Mmc1_0263"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238541"
     misc_feature    300480..300491
                     /locus_tag="Mmc1_0263"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238541"
     misc_feature    <301008..301253
                     /locus_tag="Mmc1_0263"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            301458..302108
                     /locus_tag="Mmc1_0264"
                     /db_xref="GeneID:4482317"
     CDS             301458..302108
                     /locus_tag="Mmc1_0264"
                     /note="PFAM: colicin V production protein;
                     KEGG: son:SO3065 colicin V production protein"
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V production protein"
                     /protein_id="YP_864197.1"
                     /db_xref="GI:117923580"
                     /db_xref="InterPro:IPR003825"
                     /db_xref="GeneID:4482317"
                     /translation="MIWFDYLLIFILGSVLLLAANRGFFREVFALIGWVLAFIATTFL
                     SGRLAAHLGHYVADAEMVRIMAISLVFISTLMAVWGIGYLLNWAIAPAQLNWQDRILG
                     MSFGLVRGMLVILIGFSTVMAFGGPPQGVMKRSVLAQHFAQGAWRLSILQPSDSMLRV
                     QGDERPTRIQTVPVPTWEADERTLEAWLHRPLEAPPAELPAPIMIHKQVEKVTRLF"
     misc_feature    301467..301892
                     /locus_tag="Mmc1_0264"
                     /note="Colicin V production protein; Region: Colicin_V;
                     pfam02674"
                     /db_xref="CDD:251465"
     gene            302282..303712
                     /locus_tag="Mmc1_0265"
                     /db_xref="GeneID:4482318"
     CDS             302282..303712
                     /locus_tag="Mmc1_0265"
                     /EC_number="2.4.2.14"
                     /note="TIGRFAM: amidophosphoribosyltransferase;
                     PFAM: glutamine amidotransferase, class-II;
                     phosphoribosyltransferase;
                     KEGG: pca:Pcar_1326 amidophosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="YP_864198.1"
                     /db_xref="GI:117923581"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR002375"
                     /db_xref="InterPro:IPR005854"
                     /db_xref="GeneID:4482318"
                     /translation="MFDPTDEHFHDECGVFGVYNHAEAANLTYLGLYALQHRGQESGG
                     IVSVQDRIFHTTRGQGLVADVFKQRELDALEGDKAIGHVRYSTTGGSANSRNLQPLVV
                     DTADGGLAIAHNGNLVNGTEMRRMLERRGSIFQSTMDTEVIVHLTALSRENTFSDRLV
                     EALKQVQGAYALVAMDENQIIVVRDPHGLRPLVLGKVGEKGIVVSSETCALNLIEAQF
                     WRDVEPGEMVVISPDGIRSYFPFQKQKRSFCVFEYIYFARPDSNLDGINVYNARKAIG
                     AKLAEESPVEADVIIPVPDSGVPSALGFSQASGIPFELGIIRNHYVGRTFIEPQQQIR
                     HFGVKIKLNANPHIFKGKRVVLVDDSVVRGTTSRKIVKMVRAAGAREVHVRISSPPTT
                     NPCFYGIDTPTRQELLASSHTVSEMCSYITADSLCYISLEGLYSALNAKRVDYCDACF
                     SGEYPIPFPNQVGDQQLTLLKESFYK"
     misc_feature    302285..303676
                     /locus_tag="Mmc1_0265"
                     /note="amidophosphoribosyltransferase; Provisional;
                     Region: PRK09123"
                     /db_xref="CDD:236384"
     misc_feature    302318..303073
                     /locus_tag="Mmc1_0265"
                     /note="Glutamine amidotransferases class-II (GN-AT)_GPAT-
                     type. This domain is found at the N-terminus of  glutamine
                     phosphoribosylpyrophosphate (Prpp) amidotransferase
                     (GPATase) . The glutaminase domain catalyzes amide
                     nitrogen transfer from glutamine to the...; Region:
                     GPATase_N; cd00715"
                     /db_xref="CDD:238367"
     misc_feature    order(302318..302320,302393..302398,302531..302533,
                     302621..302626,302696..302698)
                     /locus_tag="Mmc1_0265"
                     /note="active site"
                     /db_xref="CDD:238367"
     misc_feature    order(302366..302371,302378..302380,302399..302401,
                     302585..302587,302702..302704,302711..302716,
                     302723..302728)
                     /locus_tag="Mmc1_0265"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238367"
     misc_feature    303110..303439
                     /locus_tag="Mmc1_0265"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(303161..303163,303167..303169,303353..303361,
                     303365..303379)
                     /locus_tag="Mmc1_0265"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            304016..304429
                     /locus_tag="Mmc1_0266"
                     /db_xref="GeneID:4482319"
     CDS             304016..304429
                     /locus_tag="Mmc1_0266"
                     /note="TIGRFAM: flagellar basal-body rod protein FlgB;
                     PFAM: flagellar basal body rod protein;
                     KEGG: pca:Pcar_1195 related to flagellar basal-body rod
                     protein (FlgB)"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgB"
                     /protein_id="YP_864199.1"
                     /db_xref="GI:117923582"
                     /db_xref="InterPro:IPR001444"
                     /db_xref="InterPro:IPR006300"
                     /db_xref="GeneID:4482319"
                     /translation="MSGFGLLGNSGAFKANLLDLRQRRQDIIAANIANADTPGYKARR
                     LSFEEELAKSTPRDGDLPMARSDPRHLPAQGFLAASGEIQEVETPISKGDMNSVDMEQ
                     EMARQTANQLLYNYATQSLNGQITKMKMAIRGEVR"
     misc_feature    304034..304414
                     /locus_tag="Mmc1_0266"
                     /note="flagellar basal-body rod protein FlgB; Region:
                     FlgB; TIGR01396"
                     /db_xref="CDD:233395"
     misc_feature    304058..304411
                     /locus_tag="Mmc1_0266"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     gene            304526..304951
                     /locus_tag="Mmc1_0267"
                     /db_xref="GeneID:4482320"
     CDS             304526..304951
                     /locus_tag="Mmc1_0267"
                     /note="TIGRFAM: flagellar basal-body rod protein FlgC;
                     PFAM: flagellar basal body rod protein; protein of unknown
                     function DUF1078 domain protein;
                     KEGG: bba:Bd3406 flagellar basal-body rod protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein FlgC"
                     /protein_id="YP_864200.1"
                     /db_xref="GI:117923583"
                     /db_xref="InterPro:IPR001444"
                     /db_xref="InterPro:IPR006299"
                     /db_xref="InterPro:IPR010930"
                     /db_xref="GeneID:4482320"
                     /translation="MDFLTSFKVTASGLAAQRLRMNIISENVANAQTTRTPEGGPYKR
                     RDPVFMSRPFQDYLTREESAGATGVAVDRVNVDHRPPRLQYDPNHPDANADGYVAMPN
                     IDVMTEMVNMMSASRSYEANVSVLNASKQMALKALEIGR"
     misc_feature    304535..304948
                     /locus_tag="Mmc1_0267"
                     /note="flagellar basal-body rod protein FlgC; Region:
                     FlgC; TIGR01395"
                     /db_xref="CDD:130462"
     misc_feature    304544..304630
                     /locus_tag="Mmc1_0267"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    <304805..304942
                     /locus_tag="Mmc1_0267"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            304966..305277
                     /locus_tag="Mmc1_0268"
                     /db_xref="GeneID:4482321"
     CDS             304966..305277
                     /locus_tag="Mmc1_0268"
                     /note="TIGRFAM: flagellar hook-basal body complex subunit
                     FliE;
                     PFAM: flagellar hook-basal body complex protein FliE;
                     KEGG: dar:Daro_0776 flagellar hook-basal body complex
                     protein FliE"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body complex subunit FliE"
                     /protein_id="YP_864201.1"
                     /db_xref="GI:117923584"
                     /db_xref="InterPro:IPR001624"
                     /db_xref="GeneID:4482321"
                     /translation="MKIAALPQLPNIAQLSKGMSLSSTKAGGPWESFSTLLSQQIKET
                     QQLEKKARVLGEKAMLGNAGVSLHEAQIAGATAELHMQLLVQTRNKAVEVYKEVMNMP
                     V"
     misc_feature    304996..305274
                     /locus_tag="Mmc1_0268"
                     /note="Flagellar hook-basal body complex protein FliE;
                     Region: FliE; pfam02049"
                     /db_xref="CDD:251058"
     gene            305406..307061
                     /locus_tag="Mmc1_0269"
                     /db_xref="GeneID:4482322"
     CDS             305406..307061
                     /locus_tag="Mmc1_0269"
                     /note="TIGRFAM: flagellar M-ring protein FliF;
                     PFAM: secretory protein YscJ/FliF family protein;
                     flagellar M-ring C-terminal domain protein;
                     KEGG: gme:Gmet_3112 flagellar FliF M-ring protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar M-ring protein FliF"
                     /protein_id="YP_864202.1"
                     /db_xref="GI:117923585"
                     /db_xref="InterPro:IPR000067"
                     /db_xref="InterPro:IPR006182"
                     /db_xref="InterPro:IPR013556"
                     /db_xref="GeneID:4482322"
                     /translation="MAETPNDAEGGASAEEPSLGGLFGSLPLTGRNGVIIAAMASVFI
                     LAAIIWFATRPSMKVLYSGLPDLESARIVEQLGKLGVPYELGSGGTTIRIPEDKVYDV
                     RLEMAKAGLPKSTDGVGFEIFDNQSLMGMTDFVQRMNYQRALQGELARSVESIAAVEK
                     ARVHLVLPKKSMFAAEERTATASVVMELTHALNKTQIDGITHMVASAVEGLSQDQVTL
                     LDQKGNLIAGGKTEDLDGRMPTDDALALQSMKEKKIEERVQSLLDRVLGPDKSIIRIT
                     AELDLDKKQRQEESYDPDGQVPLSTNTVTESSRGMFGTGGVPGVIPNDPNQTAVAGGT
                     GSQQTRDVEREQVNFLVPKKVTTVQEAVGDIRRLSVAVMIDGTYEAVKDKDGNIDPEK
                     PAVYTPRSTEEMEQLKRIIMQTVGFDAKRGDSIEVTNTAFEPLPPPLDVKSPWLSREF
                     QLEMAKYGAIALLAFLLVFFVMRPLVTKLLIPEEEQDDRLPGTVADLERQLLAEGVGT
                     IPVDSPIRMKIPDRSLQLAQQMIADNLEEAREIIRSWMAQDSY"
     misc_feature    305457..307055
                     /locus_tag="Mmc1_0269"
                     /note="flagellar MS-ring protein; Reviewed; Region: fliF;
                     PRK06007"
                     /db_xref="CDD:235668"
     misc_feature    305496..306089
                     /locus_tag="Mmc1_0269"
                     /note="Secretory protein of YscJ/FliF family; Region:
                     YscJ_FliF; cl01907"
                     /db_xref="CDD:261111"
     misc_feature    306189..306701
                     /locus_tag="Mmc1_0269"
                     /note="Flagellar M-ring protein C-terminal; Region:
                     YscJ_FliF_C; pfam08345"
                     /db_xref="CDD:254746"
     gene            307363..308373
                     /locus_tag="Mmc1_0270"
                     /db_xref="GeneID:4482323"
     CDS             307363..308373
                     /locus_tag="Mmc1_0270"
                     /note="PFAM: flagellar motor switch protein FliG;
                     KEGG: gsu:GSU0411 flagellar motor switch protein FliG"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="YP_864203.1"
                     /db_xref="GI:117923586"
                     /db_xref="InterPro:IPR000090"
                     /db_xref="GeneID:4482323"
                     /translation="MKLTGKEKAAVFILSLPDDDAKKIMEGMSEDEIREISRTIARLG
                     QMDEETVKAVREEFLSLFENQSFNVRGGMQKVKDLIFKVLGKEKGRHLLKELQQGPKN
                     TPWEILNEMEPTLVATFLANEHPQSIALIISQLNAEQASFIIDYLAPEVQQEVIYRMA
                     KLGNLPPGALEDIEESLLAELEAMGASRGLYTSEGGGGVKKVAELLNLMPRDTSDKLL
                     AFLDEEDNPLAEDVRKEMFLFEDLLLMDDKSFQTLLREVSNDELLTALKGTDDRLKEK
                     FFTNMSERAAEMLREDLEMMGPVKVSDVEQAQQAILKVARQLEADGAIVIMGKGSDDV
                     VL"
     misc_feature    307363..308367
                     /locus_tag="Mmc1_0270"
                     /note="flagellar motor switch protein G; Validated;
                     Region: fliG; PRK05686"
                     /db_xref="CDD:235561"
     misc_feature    307366..307680
                     /locus_tag="Mmc1_0270"
                     /note="FliG N-terminal domain; Region: FliG_N; pfam14842"
                     /db_xref="CDD:258979"
     misc_feature    307696..307926
                     /locus_tag="Mmc1_0270"
                     /note="FliG middle domain; Region: FliG_M; pfam14841"
                     /db_xref="CDD:258978"
     misc_feature    308014..308340
                     /locus_tag="Mmc1_0270"
                     /note="FliG C-terminal domain; Region: FliG_C; pfam01706"
                     /db_xref="CDD:190075"
     gene            308532..310106
                     /locus_tag="Mmc1_0271"
                     /db_xref="GeneID:4482324"
     CDS             308532..310106
                     /locus_tag="Mmc1_0271"
                     /note="KEGG: lic:LIC11394 flagellar assembly protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864204.1"
                     /db_xref="GI:117923587"
                     /db_xref="GeneID:4482324"
                     /translation="MSQKTHLYRDRSGLTVEGGFAALLKHEPDPMRGAFVGYLPNGKL
                     PSLKVKEPEPIIDEVEAETRRDEALERELYQRVFAAAEQAGMEAGLRKMEEEMAARVP
                     RLEGIIRDLDGLPQRVFAASEQFMVESCILLLQELLAHEVSVNVESLKARIHRLMREV
                     ATRDRMGIHLNPKDVELLGASASFEGLEIIGDPMVPQGTARLESNFGGIEDDISDRLA
                     HMQNGIRAFLEERLEKPELYDAAVGAGEIALDEEEEVEQLDDLQEPDANDTTGATLAA
                     MEAGGSDDTPEEVHEMTSLGEEVAEDLSTLIDESEAQEANAALDLLGGDITEENEGDE
                     EDDDACIIGPGELSGMPKARPQQAAAELDELDEAAWDEEALTSGTTGATLAAMEAGAH
                     GSKTPAEAAALTQMGEGVEEDLSALLDDDVGDDEPDVLADVDEVADEEEEYGTGATLA
                     ALEAGALGSATPAEAAALTQIGEDVEQDLAALLDADEQDAMDDIAQMLADQGSDEDQD
                     ALFEGLLDEEDKEFQP"
     misc_feature    308838..309185
                     /locus_tag="Mmc1_0271"
                     /note="Flagellar assembly protein FliH; Region: FliH;
                     cl19405"
                     /db_xref="CDD:267758"
     gene            310103..311452
                     /locus_tag="Mmc1_0272"
                     /db_xref="GeneID:4482325"
     CDS             310103..311452
                     /locus_tag="Mmc1_0272"
                     /EC_number="3.6.3.15"
                     /note="KEGG: pca:Pcar_1189 probable flagellum-specific ATP
                     synthase (FliI);
                     TIGRFAM: ATPase, FliI/YscN family; flagellar protein
                     export ATPase FliI;
                     PFAM: H+-transporting two-sector ATPase, alpha/subunit
                     beta, central region; H+-transporting two-sector ATPase,
                     alpha/subunit beta domain protein;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein export ATPase FliI"
                     /protein_id="YP_864205.1"
                     /db_xref="GI:117923588"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005714"
                     /db_xref="InterPro:IPR013379"
                     /db_xref="GeneID:4482325"
                     /translation="MISMAQTPTEEHPLRLPWGAYAQVAQEDLGFHRLGWVKKVVGLL
                     IEGNGPAVSIGQMCDVVRENGEVVKAEVVGFRDKSVLLMPLGSIKGIFPGSRIISQGR
                     AEQVPVGPQLLGRVIGPMGEALDGHALPHLDDHVPLHAAPINPMLRRKIEEPLDLGVR
                     AVNSLLTVGRGQRLGIFAGTGVGKSTLLGMMARYTAADINVIALIGERGREVVEFIED
                     ELGPEGMARSIVIVATSDQPPLLRLRAAYMATAIAEFFRAQQKDVLLLMDSITRFAMA
                     QREVGLATGEPPTSRGYPPSTFMLLPRLLERGGRDQGRGSITSIYTVLMEGDDIQDPI
                     VDAVRGILDGHIVLSRDLAAANHYPAIDVNGSLSRLMEGLSEKAHKRAAGQLREILAT
                     YVKAEDMINIGAYVAGSNPRIDRAIRFIEPIRTFLKQSVEEPSTLEESIAQLESLFA"
     misc_feature    310205..311434
                     /locus_tag="Mmc1_0272"
                     /note="flagellar protein export ATPase FliI; Region:
                     FliI_clade1; TIGR03496"
                     /db_xref="CDD:213817"
     misc_feature    310211..310405
                     /locus_tag="Mmc1_0272"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    310415..311389
                     /locus_tag="Mmc1_0272"
                     /note="Flagellum-specific ATPase/type III secretory
                     pathway virulence-related protein. This group of ATPases
                     are responsible for the export of flagellum and
                     virulence-related proteins. The bacterial flagellar motor
                     is similar to the F0F1-ATPase, in that they...; Region:
                     ATPase_flagellum-secretory_path_III; cd01136"
                     /db_xref="CDD:238556"
     misc_feature    310637..310657
                     /locus_tag="Mmc1_0272"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238556"
     misc_feature    310892..310906
                     /locus_tag="Mmc1_0272"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238556"
     gene            311698..312003
                     /locus_tag="Mmc1_0273"
                     /db_xref="GeneID:4482326"
     CDS             311698..312003
                     /locus_tag="Mmc1_0273"
                     /note="KEGG: hit:NTHI1094 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864206.1"
                     /db_xref="GI:117923589"
                     /db_xref="GeneID:4482326"
                     /translation="MKKATIIGLFIGIGISLLAQIAVAGPPMLFGADGRYLGTLSNNR
                     YDPNSVSNPYGRYGSRYSPDSINNPFGRYGSRYSSESVNNPFASNPPKIFSPYGGLR"
     gene            312216..312671
                     /locus_tag="Mmc1_0274"
                     /db_xref="GeneID:4482327"
     CDS             312216..312671
                     /locus_tag="Mmc1_0274"
                     /note="KEGG: pca:Pcar_2753 metal dependent
                     phosphohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864207.1"
                     /db_xref="GI:117923590"
                     /db_xref="GeneID:4482327"
                     /translation="MSRIPIHYKVTLFYALFGVLWIFVSDRVLEFLVSDAQLMGIIQT
                     FKGWIYVVLTSAMLFVIIRMDHLAIEKKEREKAQLYQATMSAVHHILHNFLNKMMLYR
                     LGVEEQQPVNPELQALYERVIEETQHEIYLLQTAKQFTAEEVRATVQPK"
     gene            complement(312740..313471)
                     /locus_tag="Mmc1_0275"
                     /db_xref="GeneID:4482328"
     CDS             complement(312740..313471)
                     /locus_tag="Mmc1_0275"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
                     KEGG: sde:Sde_2152 ATPase FliI/YscN"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_864208.1"
                     /db_xref="GI:117923591"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:4482328"
                     /translation="MLLENRIALVTGAGSGIGKAIAEGYAAAGATVLLLGRTQKKLEN
                     VYDAITQAGGKATIVPMDLETGLGAIPELVKNTYERYGRLDILVNNAALLGTLSPLAN
                     YRPQEWEQVMRVNVTAPFFLMREFIPLLTQSDDASIINLSSGVGHQGRAFWGAYAASK
                     AALINLSETLAQELEKSPIRVNTVNPGATATTMRAKAFPGEDPTTLPSAQAILPVFLY
                     LASQQSKDVRGEHLNAREWMDWKAV"
     misc_feature    complement(312782..313471)
                     /locus_tag="Mmc1_0275"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(312770..313468)
                     /locus_tag="Mmc1_0275"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(312905..312916,312992..312994,
                     313004..313006,313043..313051,313196..313204,
                     313358..313366,313421..313423,313427..313432,
                     313436..313438))
                     /locus_tag="Mmc1_0275"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(312992..312994,313004..313006,
                     313043..313045,313127..313129))
                     /locus_tag="Mmc1_0275"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            313530..314450
                     /locus_tag="Mmc1_0276"
                     /db_xref="GeneID:4482329"
     CDS             313530..314450
                     /locus_tag="Mmc1_0276"
                     /EC_number="2.5.1.75"
                     /note="KEGG: gsu:GSU2000 tRNA
                     delta(2)-isopentenylpyrophosphate transferase;
                     TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
                     transferase;
                     PFAM: tRNA isopentenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="YP_864209.1"
                     /db_xref="GI:117923592"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR011593"
                     /db_xref="GeneID:4482329"
                     /translation="MGPTASGKTGLALHLAEHFPLEIVNADSVQVYRGMDIGSAKPTL
                     QERQAIVHHLIDVTTPDDPFSAGRFRTAALEVIEDCHRRGVIPALVGGTGFYFRAVEQ
                     GIAEIPEVDAQIVAELNRRVCDEVGLACCYAQLQQVDPPWAARVEPGDRQRIVRGLSV
                     YLASGQPLSYWQQLSCQQAPEGPALRICKLAIEWPREQLYARINQRFEQMLKEGFMEE
                     VQGLLSRGYHGDLPAMRAVGYRALIGYLQGAYDLARAVELGQRDSRRYAKRQITWLKA
                     EPGLQWLAPEGAKQAALDEVRAFLQFFKKK"
     misc_feature    313530..314432
                     /locus_tag="Mmc1_0276"
                     /note="tRNA delta(2)-isopentenylpyrophosphate transferase;
                     Reviewed; Region: miaA; PRK00091"
                     /db_xref="CDD:234626"
     gene            314696..314953
                     /locus_tag="Mmc1_0277"
                     /db_xref="GeneID:4482330"
     CDS             314696..314953
                     /locus_tag="Mmc1_0277"
                     /note="TIGRFAM: RNA chaperone Hfq;
                     PFAM: Like-Sm ribonucleoprotein, core;
                     KEGG: lpp:lpp0009 host factor-I protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein Hfq"
                     /protein_id="YP_864210.1"
                     /db_xref="GI:117923593"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR005001"
                     /db_xref="GeneID:4482330"
                     /translation="MGNSHAGHNVQDPFLNTLRREKVPVTVFLVNGIKLQGMITSFDN
                     YCLLLKNSVTQLVFKHAISTVMPSRNIHMGDERDDAKESKE"
     misc_feature    314720..314896
                     /locus_tag="Mmc1_0277"
                     /note="bacterial Hfq-like; Region: Hfq; cd01716"
                     /db_xref="CDD:212463"
     misc_feature    order(314720..314728,314735..314737,314780..314794,
                     314816..314824,314828..314833,314852..314896)
                     /locus_tag="Mmc1_0277"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212463"
     misc_feature    order(314768..314788,314792..314845)
                     /locus_tag="Mmc1_0277"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212463"
     misc_feature    order(314777..314779,314789..314803,314840..314842,
                     314858..314860,314882..314887,314891..314893)
                     /locus_tag="Mmc1_0277"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:212463"
     misc_feature    314855..314890
                     /locus_tag="Mmc1_0277"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212463"
     gene            315020..316318
                     /locus_tag="Mmc1_0278"
                     /db_xref="GeneID:4482331"
     CDS             315020..316318
                     /locus_tag="Mmc1_0278"
                     /note="PFAM: GTP-binding protein, HSR1-related;
                     KEGG: mag:amb2373 GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="HSR1-like GTP-binding protein"
                     /protein_id="YP_864211.1"
                     /db_xref="GI:117923594"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="GeneID:4482331"
                     /translation="MLETHQAPDRAILLQALEPKVTRDACQRLLDELVHLSTTAGLEV
                     HATQLLSLQKAVPATYFGSGQVEELARRIEEDEIDVAVVNHALTPIQQRNLEKKLNAK
                     VVDRTGLILEIFAARARTREGIMQVELASLMYQQSRLVRSWTHLERQRGGVGLRGGPG
                     ERQIEVDRRLIRERIHKLKKQLEEVERTRALQRQPRQDIPLFTVALVGYTNAGKSTLF
                     NLLTRAGVLAEDKLFATLDPTMRAVDLPDGGRILLSDTVGFIRQLPHQLVAAFKATLE
                     EVMSADMLLHVVDLSDPEWERYVESVNGVLQELEVQHTRTLTVYNKIDRLESRGILER
                     ELARGDTIGVSAQTGEGVEPLLSELRRAVGRAMLRYEVILPVSDGRWLAKFHAEASVV
                     EVREGEDFTTLIVELAPAVLGRLQGEVEREGVEVQFRPVD"
     misc_feature    315047..316108
                     /locus_tag="Mmc1_0278"
                     /note="GTP-binding protein HflX; Region: GTP_HflX;
                     TIGR03156"
                     /db_xref="CDD:234125"
     misc_feature    315107..315364
                     /locus_tag="Mmc1_0278"
                     /note="GTP-binding GTPase N-terminal; Region: GTP-bdg_N;
                     pfam13167"
                     /db_xref="CDD:205348"
     misc_feature    315500..316108
                     /locus_tag="Mmc1_0278"
                     /note="HflX GTPase family; Region: HflX; cd01878"
                     /db_xref="CDD:206666"
     misc_feature    315641..315664
                     /locus_tag="Mmc1_0278"
                     /note="G1 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    order(315650..315652,315656..315667,315980..315985,
                     315989..315991,316052..316060)
                     /locus_tag="Mmc1_0278"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206666"
     misc_feature    315704..315745
                     /locus_tag="Mmc1_0278"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206666"
     misc_feature    315734..315736
                     /locus_tag="Mmc1_0278"
                     /note="G2 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    315782..315793
                     /locus_tag="Mmc1_0278"
                     /note="G3 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    315791..315862
                     /locus_tag="Mmc1_0278"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206666"
     misc_feature    315980..315991
                     /locus_tag="Mmc1_0278"
                     /note="G4 box; other site"
                     /db_xref="CDD:206666"
     misc_feature    316052..316060
                     /locus_tag="Mmc1_0278"
                     /note="G5 box; other site"
                     /db_xref="CDD:206666"
     gene            complement(318313..319587)
                     /locus_tag="Mmc1_0279"
                     /db_xref="GeneID:4482332"
     CDS             complement(318313..319587)
                     /locus_tag="Mmc1_0279"
                     /note="PFAM: metal-dependent phosphohydrolase, HD sub
                     domain;
                     SMART: metal-dependent phosphohydrolase, HD region;
                     KEGG: cvi:CV0368 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_864212.1"
                     /db_xref="GI:117923595"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:4482332"
                     /translation="MKKKVSVSQLEPGMYVSDFNNGWNEDARSGKDPNGLPQQMMLKS
                     DADVRRVLADSTIREVYIDTERGRDVEGAKSQAEIEAELAAQMMELGEEGNAVKLPNP
                     DVKKQPMEQELEHAHEVKQKARRLVGDMLDDVRLGKTITVGPVKELMKDMVESMFSNK
                     DAMLSLSMIKAKDEYTFMHSVNVGVFLVAFAQSMEMTPEELVAVGVGAMLHDIGKMKT
                     PQEVLNKPGKLDDEEFLQMKMHVVHSEKILAAAPGISELSVQIAGRHHERWDGSGYPR
                     QLKGHAIGQMGQMSAIVDVYDAITSDRCYHKGNSPHQALKRMMEWSKFHFNPDLFQKF
                     VQCVGIYPMGTLVRLHNGYLGVVLETNTESLLHPVVRVLIDSKAKKKLKPVTLNLIER
                     KADKNWAVEGVEDARKWGVDPKKHMPKPELFQ"
     misc_feature    complement(319147..319587)
                     /locus_tag="Mmc1_0279"
                     /note="Domain of unknown function (DUF3391); Region:
                     DUF3391; pfam11871"
                     /db_xref="CDD:256688"
     misc_feature    complement(318475..319371)
                     /locus_tag="Mmc1_0279"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    complement(318667..319068)
                     /locus_tag="Mmc1_0279"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(318706..318708,318952..318957,
                     319051..319053))
                     /locus_tag="Mmc1_0279"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(318952..318954)
                     /locus_tag="Mmc1_0279"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            320040..320384
                     /locus_tag="Mmc1_0280"
                     /db_xref="GeneID:4483337"
     CDS             320040..320384
                     /locus_tag="Mmc1_0280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864213.1"
                     /db_xref="GI:117923596"
                     /db_xref="GeneID:4483337"
                     /translation="MPEFTGMRCPICNGRPAHIYVCVSCGEVRCGQNSCTGSEDGHAG
                     WAGSGTLCRHCGQGRYRIMSFHSSEFLDFVREYTFRKRNKDSAIATFNKAASIEDELL
                     LRLKRPTPTARR"
     gene            complement(320472..321011)
                     /locus_tag="Mmc1_0281"
                     /db_xref="GeneID:4483338"
     CDS             complement(320472..321011)
                     /locus_tag="Mmc1_0281"
                     /note="KEGG: fnu:FN2111 hypothetical exported 24-amino
                     acid repeat protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864214.1"
                     /db_xref="GI:117923597"
                     /db_xref="GeneID:4483338"
                     /translation="MLLSFLSKRQRHGLVALLLGLLLTGCGPTEFSDLEMRGGRAYLK
                     NSAVPYTGPVVAFFPSDEEGGERQIYMEGGFANGLRDGTWTTYRTNGGKIEDKYVLGR
                     RNGTIKRFDARGKVRSEESYFNGRRHGGAVYYNEDGGVARNLYYQEGNLRAYPSPARR
                     TMIEDKMKEGPDSDLLDIK"
     misc_feature    complement(320559..>320819)
                     /locus_tag="Mmc1_0281"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2849"
                     /db_xref="CDD:225405"
     gene            complement(321021..321242)
                     /locus_tag="Mmc1_0282"
                     /db_xref="GeneID:4483339"
     CDS             complement(321021..321242)
                     /locus_tag="Mmc1_0282"
                     /note="PFAM: Rubredoxin-type Fe(Cys)4 protein;
                     KEGG: cch:Cag_0147 rubredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="rubredoxin-type Fe(Cys)4 protein"
                     /protein_id="YP_864215.1"
                     /db_xref="GI:117923598"
                     /db_xref="InterPro:IPR001052"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="GeneID:4483339"
                     /translation="MGVWCCMSCEYEYDEEVGSTATGIVAGTDFDTLPKDWRCPVCGL
                     SKEHFQSEDMLRGESPIELADADDEEIEF"
     misc_feature    complement(321093..321233)
                     /locus_tag="Mmc1_0282"
                     /note="Rubredoxin; nonheme iron binding domains containing
                     a [Fe(SCys)4] center. Rubredoxins are small nonheme iron
                     proteins. The iron atom is coordinated by four cysteine
                     residues (Fe(S-Cys)4), but iron can also be replaced by
                     cobalt, nickel or zinc. They are...; Region: rubredoxin;
                     cd00730"
                     /db_xref="CDD:238372"
     misc_feature    complement(order(321117..321119,321126..321128,
                     321216..321218,321225..321227))
                     /locus_tag="Mmc1_0282"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238372"
     gene            321914..322363
                     /locus_tag="Mmc1_0283"
                     /db_xref="GeneID:4483340"
     CDS             321914..322363
                     /locus_tag="Mmc1_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864216.1"
                     /db_xref="GI:117923599"
                     /db_xref="GeneID:4483340"
                     /translation="MKSTQPQANFGFNICHFESQSDINSDIYDTMLEIRRDDLFEIGT
                     VRAWCFPPRGAPTSVHRAWDMAVNMLSDEDADRLAARFYKGTNLMGFPLPGLTTDAGT
                     SNHGSYRAWTRQLMAELSRTGHARADFDEQHALLELFLWALTACDAP"
     gene            322581..323186
                     /locus_tag="Mmc1_0284"
                     /db_xref="GeneID:4483341"
     CDS             322581..323186
                     /locus_tag="Mmc1_0284"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864217.1"
                     /db_xref="GI:117923600"
                     /db_xref="GeneID:4483341"
                     /translation="MLHITSTAHRPQGPTQTKVGTSGGPMDHASGFDTALEEASRKVD
                     PPSTVDPVATMAAAVIPPRGLQNRVLSGYDPAKGIVTPEALRQTLSREEMEAFGQLLN
                     APPSKEKVGDHPLPPNLEKRWMEAINGLSTDLRAALTKLLHGESKDGSHLQTAAEKGL
                     PLEGLSNHLLTALEADRESIPPATYRAWRLRIDDLQGRVAS"
     gene            323330..323605
                     /locus_tag="Mmc1_0285"
                     /db_xref="GeneID:4483342"
     CDS             323330..323605
                     /locus_tag="Mmc1_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864218.1"
                     /db_xref="GI:117923601"
                     /db_xref="GeneID:4483342"
                     /translation="MNDISTMVKLQTAAQQPKPAAPTKSGGHGVEPSPILNPSPAKDV
                     VTLQRSEPVVKAIDAMVNEVMDALINHEVDLSALTHNLSKQSSKLVQ"
     gene            complement(323709..324059)
                     /locus_tag="Mmc1_0286"
                     /db_xref="GeneID:4483343"
     CDS             complement(323709..324059)
                     /locus_tag="Mmc1_0286"
                     /note="TIGRFAM: arsenate reductase;
                     PFAM: arsenate reductase and related;
                     KEGG: sde:Sde_0900 arsenate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="YP_864219.1"
                     /db_xref="GI:117923602"
                     /db_xref="InterPro:IPR006659"
                     /db_xref="InterPro:IPR006660"
                     /db_xref="GeneID:4483343"
                     /translation="MSVTIYHNPRCSKSRQTLQILQDKGIEPTVVEYLKTPLDKAALQ
                     NLLAQLGCSPREILRKGEEAYKENHLHDPNLTDDQLLNVLVAHPKLMERPVVVHGERA
                     VLGRPPESVLALFP"
     misc_feature    complement(323718..324053)
                     /locus_tag="Mmc1_0286"
                     /note="Arsenate Reductase (ArsC) family, ArsC subfamily;
                     arsenic reductases similar to that encoded by arsC on the
                     R733 plasmid of Escherichia coli. E. coli ArsC catalyzes
                     the reduction of arsenate [As(V)] to arsenite [As(III)],
                     the first step in the...; Region: ArsC_ArsC; cd03034"
                     /db_xref="CDD:239332"
     misc_feature    complement(order(323742..323744,323781..323783,
                     323883..323885,324027..324029))
                     /locus_tag="Mmc1_0286"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239332"
     gene            complement(324075..324497)
                     /locus_tag="Mmc1_0287"
                     /db_xref="GeneID:4483344"
     CDS             complement(324075..324497)
                     /locus_tag="Mmc1_0287"
                     /note="KEGG: pfo:Pfl_2552 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864220.1"
                     /db_xref="GI:117923603"
                     /db_xref="GeneID:4483344"
                     /translation="MGMGLITLFLLALLAATLLPFSSELMLGSMAATGEWSLWHLWLA
                     ATAGNVLGALVNWYLGGWLMKWQHHRWFPVSPQALSTAKQRYDRFGVWSLLLAWVPVI
                     GDPLTLVAGLFRTPLYLFIPLVSLGKGGRYGVLLYLLA"
     misc_feature    complement(324081..>324440)
                     /locus_tag="Mmc1_0287"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG1238"
                     /db_xref="CDD:224159"
     gene            324717..327485
                     /locus_tag="Mmc1_0288"
                     /db_xref="GeneID:4483345"
     CDS             324717..327485
                     /locus_tag="Mmc1_0288"
                     /note="PFAM: hypothetical protein; protein of unknown
                     function DUF323;
                     KEGG: dps:DP2422 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864221.1"
                     /db_xref="GI:117923604"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="GeneID:4483345"
                     /translation="MHTIIRFMLLPMLMLVGLECHAALPYAHGTAPPEGVENQGVSTY
                     QAPEATKAVQRNLDPRALLAPPQREAVFSPDGNRLAETAQGGGIQVRTVGLEDQAVRL
                     TGHRNGVTAMAFSPASQRLLTAGGDLLVKLWDLDNSQLIYTLAGHAAPVRDAAFSSDG
                     RFILTASDDGTVRLWDTESGRMLGGHQRRTRLLTFTPDRRYALSVDTDEPRLMRRWEV
                     VTGKTVGYYQGHNKAITRMAYAPGGLRMATADAGGGIILWEAQNQTPISILEGHTAPI
                     SELVFSQDGTMLLSADRVQSWILWDARTGQPLQSVQAPPGNILAATLHGGPPAKPLFL
                     GERGMLRVWDSLGGGGAYSLLNPPTHDPMLPNQGVSLGMPPGTAGPHVPGTWMHQNAA
                     IAAPSVGGEAPAFSGSGHGYGAPAPGMPGGPALNGAGAVTTPASPPVEVQPGTALPGM
                     HSAPPQDSGQNRGGATMAPPMAQPAQSFSMPSGMLPNQGSTPHGLMPAAPPAVQGKRA
                     DQSSVYRPVALDATPVMQGQVIPGPGHPTGGAGGRGVAIPERNKALGQVLTAPPIPGA
                     VLAARPQVTPKHKTAIAIPAPEPVVTKKAETLPKKAPVWVKPARPPAAPVNLVATVNP
                     ETVPTQDTNSVVDADTGITFVEVPGGCFSMGGNDKNMTPAERPAHEVCLTPFWMSRFE
                     VTQGQWAAVMKKNPSFFKLGPNYPVEQVSWEDAQSFVQKINRKVGQPYYQLPTEAQWE
                     YACRSGGKDEEYCGGDDLSAVGWHQGNGGLSTHAVGLRRPNGLGLFDMSGNVLEWTLD
                     GFQENYYTKSPRNNPSGPKVANHRAARGGSWRTPPLDEARATMRHDLSPKLRHASLGF
                     RVIRTTPPRPAHTVVRRTDERRAAAITVEQLNIAQAQQPNMINGIPRFVTPQAGSMDP
                     PPVILPTP"
     misc_feature    <324915..325790
                     /locus_tag="Mmc1_0288"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    324930..325748
                     /locus_tag="Mmc1_0288"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    order(324957..324959,324969..324971,324987..324992,
                     325026..325031,325083..325085,325095..325097,
                     325113..325118,325152..325157,325206..325208,
                     325221..325223,325239..325244,325272..325274,
                     325323..325325,325338..325340,325362..325367,
                     325401..325406,325458..325460,325470..325472,
                     325488..325493,325527..325532,325581..325583,
                     325596..325598,325614..325619,325653..325658,
                     325725..325727,325743..325748)
                     /locus_tag="Mmc1_0288"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     misc_feature    326535..327296
                     /locus_tag="Mmc1_0288"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1262"
                     /db_xref="CDD:224182"
     misc_feature    326643..327296
                     /locus_tag="Mmc1_0288"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     gene            327824..329053
                     /locus_tag="Mmc1_0289"
                     /db_xref="GeneID:4483346"
     CDS             327824..329053
                     /locus_tag="Mmc1_0289"
                     /note="KEGG: cvi:CV3267 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864222.1"
                     /db_xref="GI:117923605"
                     /db_xref="GeneID:4483346"
                     /translation="MADHPCNCFETLFKGPYTPITTLDALHTYLQAAVTLEFATIPAY
                     TTALYSMQDTSSGAYQLTRSVAFEEMFHVYQAANLLVAVGGVPRFTEAYTPKYPTFIP
                     NANQRTTPYIGLNRASVAVYETVFMGIETPAPYEAPPQDQQIQTIGQFYKAIELGLIY
                     LETQAQQQGESIFKNTPGYGQHLNYYLGKGGGQIIEVTNLDDAKLAILQIVQQGEGAV
                     TPDHALVQTSPWGAYNHYGVRVDGNYGPIAGTPMELSHYFKFKRVVDGVDPLPSTYPV
                     VGVASLSNYSNPTAIATANLFNQYYSHLLVALENAFKGGAEARKTYLQQAMPIMNIAL
                     PNLARVLMSTPIWADQASSSVGPNALPTWSWVATTPQATVTATQRLADQNENEAEAQL
                     LQHCTTALDGFCRMAQA"
     misc_feature    327911..328618
                     /locus_tag="Mmc1_0289"
                     /note="Ferritin-like; Region: Ferritin-like; pfam12902"
                     /db_xref="CDD:257389"
     gene            329100..330926
                     /locus_tag="Mmc1_0290"
                     /db_xref="GeneID:4483347"
     CDS             329100..330926
                     /locus_tag="Mmc1_0290"
                     /note="KEGG: cvi:CV3268 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864223.1"
                     /db_xref="GI:117923606"
                     /db_xref="GeneID:4483347"
                     /translation="MSHPTFNATTQITVYPAIGIARVGDSQGFYIGPETACAMPTDLT
                     GQTVDQNGLRDAEQKMKRQAARFSLYATDDQGQVFEVTPATPGVKRIEWTVHLANKKS
                     IWYEFQTNPGELGYAPNHPLRNADITDPAQRQGMMIDPGPRQVVAQPNQQQIFFASFD
                     DSQSEIPHSFPPAHTKPYAITTLGDLSFDAKGNLLVVGGHGRSGCQMSKDNCQITAYA
                     NNDGWFDDTSDGPVDAQITLEDGQVIEAKGAWVIAGPPAYAPEVANMVTLYDTIFDTA
                     VCKLGARPDIFAQGMWKKGADGYKPSFVDEILPLIKRGDGYPWVVAIPPKPHRLQYDV
                     LGDPDPGYDPMRQRILNYLRAPGDENVLIDPSRGGTMMPYLAGDGCIGTTNETKSRYM
                     RLTDTQYFMLEQWANGYFRTESAPVNHPGEAISRGVLENCVGGPFSPGIEMTWVSRLP
                     QIYAEPLRIRKKPQITFPLSLDWDPLVGLEPGDVTKFMAIPWQADFNLCSSQPIQGRT
                     LWWWPAQRPLNVYTPLKEEIDFSQPLQQLVEGKQIKQVAWVGEDYNMNGGSYLTFPTY
                     MQMVEHWKELGFIINVSRDPEQPLLVEVARTLPRAGLDSTDS"
     gene            330926..332011
                     /locus_tag="Mmc1_0291"
                     /db_xref="GeneID:4483348"
     CDS             330926..332011
                     /locus_tag="Mmc1_0291"
                     /note="PFAM: FAD dependent oxidoreductase; tryptophan
                     halogenase;
                     KEGG: cvi:CV3269 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_864224.1"
                     /db_xref="GI:117923607"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006905"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4483348"
                     /translation="MERVLILGAGPAGVATALTLRQRGVAQITLLHRPLPHSRYQTGE
                     SASPDVAPLLRQLELPQLLEQGQHWVCRGIRWRWGGAELAENDYMMQGRGHGWHLNRH
                     RFDEQLRQAAEHRGIDLHVANLTRLEPIAQGGYRVTLSEPGGGAQRHDYRVLVDASGR
                     GAHLAGKLGVRWQPQDRLTAYLRLGTLAKESWLKHLSYVEATPHGWWFVAGIPGDQAV
                     VVFLTDVEIGRQQGLVQGSVFDGLLAQSLWGGQGVSGLEARVRPYAAHVGWLPQVVGR
                     DWVAVGDAALGLDPLSASGINGALADGIAAGHALADHLQGDAGALTRHGLALQESQRL
                     FVQERQIHYGRERRWCEHPFWQRRHLA"
     misc_feature    330935..331882
                     /locus_tag="Mmc1_0291"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    330935..331855
                     /locus_tag="Mmc1_0291"
                     /note="geranylgeranyl reductase family; Region: GG-red-SF;
                     TIGR02032"
                     /db_xref="CDD:233693"
     gene            complement(332469..333011)
                     /locus_tag="Mmc1_0292"
                     /db_xref="GeneID:4483349"
     CDS             complement(332469..333011)
                     /locus_tag="Mmc1_0292"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864225.1"
                     /db_xref="GI:117923608"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4483349"
                     /translation="MNGLKFLVLMVAVGLLSGCAMVTPQRTTGPSKVATQGWAEYTQS
                     RAAFDEVEPFLTTVEQLQALGFDPLGEQGVLHLKVHEIEPLLREGWEVAGGLPQGVQE
                     CQAAGEGCYAYLLQAQVRKQDLGVAEDAPFRALFLVKRVPAVKEDLVVYKMWDTKPHA
                     QLLRGRTLDGWKKLMQLARM"
     gene            333465..335834
                     /locus_tag="Mmc1_0293"
                     /db_xref="GeneID:4483350"
     CDS             333465..335834
                     /locus_tag="Mmc1_0293"
                     /note="PFAM: hypothetical protein; Tetratricopeptide
                     TPR_4; hypothetical protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: bur:Bcep18194_A3340 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864226.1"
                     /db_xref="GI:117923609"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4483350"
                     /translation="MTVQNPSSVPAFTQAMHHLQQGQTAQAMVLFQDVPAGDPGFVTA
                     QLNLGIHAHYQQQWQEAEQYYKGVLALAPQHPQCQQQLFILYKTLQREQPAQQLMQHL
                     LAATHGDPLLWQQWAETLAHYGEVNGALSCWAHAYRLQPDNPQPLRAMAQRLEQQGRI
                     QEATEQLQQLAQMLPEDLDLLLHLVGLLKQIGKHTAAEAYLRQRLVEHPQSQPLRFAL
                     ANLLMDQGNLAEAETLFRQNLPDHLLSQLNLGVIYGRQGRYTEALHLFRHANAVTPNH
                     LFTGYNLAVLCLQIGQLDEAQALLEQAIAHHPQQVALRNTLGQVYARQLKFTQAIQCF
                     HAALQQQPQCESYLQLGTLYRNSAQLAEAKQCNDQAVLLDPENLEARTHQLFLAHYLP
                     DAHQAQMLAQARAFGQLVAGRAKPFAHAVPASPPKPLRVGLVSPDLRGHPVGYFLESI
                     VHAMDGQRIMLCAYNSGPPGDALTQRLQSRMAHWRDIEFMSDAQVAQLIRQDGIDILV
                     DLAGHTAKNRLALFAWKPAPIQVTWLGYSATTGVSQIDYIMGDPYTLRAHEAAHYVEK
                     MWQLPHSHLCFTPPDLELEVNALPALQQGFVTFGCFNKLTKINDEVLSCWAEILQRLP
                     SSRLYLKQGIYANAEVAQQLYARFQALGIGAERLILEGGSDREGYFRCYHRVDMALDP
                     FPFPGGTTSVEGLWMGVPLVTLQGNRFMAHQGESILQHAGLAHWIAQDRHAYVEKVIA
                     FAKDLPALAQLRHGLRQQVLASPLFDAPLMATDLMQAWEQMWQIYQNGR"
     misc_feature    333504..333776
                     /locus_tag="Mmc1_0293"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(333507..333509,333543..333545,333555..333557,
                     333564..333566,333609..333611,333645..333647,
                     333657..333659,333666..333668,333711..333713,
                     333747..333749,333759..333761,333768..333770)
                     /locus_tag="Mmc1_0293"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(333510..333515,333600..333605,333609..333614,
                     333621..333626,333702..333707,333714..333719,
                     333726..333731)
                     /locus_tag="Mmc1_0293"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    334086..334271
                     /locus_tag="Mmc1_0293"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    334110..334391
                     /locus_tag="Mmc1_0293"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(334110..334115,334122..334127,334203..334208,
                     334212..334217,334224..334229,334305..334310,
                     334317..334322,334329..334334)
                     /locus_tag="Mmc1_0293"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(334119..334121,334155..334157,334167..334169,
                     334176..334178,334212..334214,334248..334250,
                     334260..334262,334269..334271,334314..334316,
                     334350..334352,334362..334364,334371..334373)
                     /locus_tag="Mmc1_0293"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    334230..334421
                     /locus_tag="Mmc1_0293"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     misc_feature    334305..334592
                     /locus_tag="Mmc1_0293"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(334305..334310,334317..334322,334407..334412,
                     334416..334421,334428..334433,334506..334511,
                     334518..334523,334530..334535)
                     /locus_tag="Mmc1_0293"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(334314..334316,334350..334352,334362..334364,
                     334371..334373,334416..334418,334452..334454,
                     334464..334466,334473..334475,334515..334517,
                     334551..334553,334563..334565,334572..334574)
                     /locus_tag="Mmc1_0293"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    334389..334589
                     /locus_tag="Mmc1_0293"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    334749..335810
                     /locus_tag="Mmc1_0293"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     gene            complement(335845..336171)
                     /locus_tag="Mmc1_0294"
                     /db_xref="GeneID:4483351"
     CDS             complement(335845..336171)
                     /locus_tag="Mmc1_0294"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864227.1"
                     /db_xref="GI:117923610"
                     /db_xref="GeneID:4483351"
                     /translation="MASIMLVCSDLLNRVQLESSWKAAGLAMVNASQGESPHIIVLDL
                     SPEQALHQIAPLKASHPDAQLVAFGPHLQGERLLAAKQQGADLVVARSSVVERVIKLA
                     QAHAQA"
     gene            complement(336285..337940)
                     /locus_tag="Mmc1_0295"
                     /db_xref="GeneID:4483352"
     CDS             complement(336285..337940)
                     /locus_tag="Mmc1_0295"
                     /note="TIGRFAM: chaperonin GroEL;
                     PFAM: chaperonin Cpn60/TCP-1;
                     KEGG: mag:amb0203 chaperonin GroEL"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="YP_864228.1"
                     /db_xref="GI:117923611"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012723"
                     /db_xref="GeneID:4483352"
                     /translation="MAAKEVKFGEAARAKMLNGVNILANAVKVTLGPKGRNVVLDKSW
                     GAPRMTKDGVSVAKEIELEDKFENMGAQMVREVSSKTADVAGDGTTTATVLAQAIIRE
                     GMKAVAAGMNPMDLKRGIDLAVEAVVVGLKGISREVANSQEIAQVGAISANSDKVVGD
                     MIAEAMDKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTNADKMLVQMENP
                     LILLVEKKISNLQQILQILEGAVQSSRPLMIIAEDVEGEALATLVVNKLRGGLKVCAV
                     KAPGFGDRRKAMMEDIATLTGGVLVSEDVGVKLENVTMDMLGMAKSIVVTKEDTTIID
                     GAGDHEAIKARVNQIRAQIEETSSDYDREKLQERLAKLAGGVAVIKVGGATEVEVKER
                     KDRVDDALHATRAAVEEGIVPGGGVALLRAREASLTNLQGANHDQQVGINIVTRALEE
                     PLRIIASNAGAEGSVVVNRVVETKETNFGFNAATGVYEDLVASGVIDPAKVVRHALQA
                     AASVAGLMITTEAMVAELPKDEPAMPGGDMGGMGGMGGMGGMM"
     misc_feature    complement(336345..337940)
                     /locus_tag="Mmc1_0295"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(336366..337931)
                     /locus_tag="Mmc1_0295"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(336369..336389,336396..336398,
                     336561..336563,336783..336785,336789..336791,
                     337170..337172,337254..337256,337350..337352,
                     337713..337715,337722..337724,337734..337736,
                     337758..337760,337764..337766,337794..337796,
                     337800..337805,337818..337820,337824..337835,
                     337866..337868,337917..337919,337929..337931))
                     /locus_tag="Mmc1_0295"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(336450..336452,336456..336458,
                     336576..336578,336696..336698,336747..336749,
                     337491..337493,337668..337670,337680..337682,
                     337842..337850))
                     /locus_tag="Mmc1_0295"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(336537..336539,336546..336551,
                     336555..336557,336582..336584,336636..336638,
                     337614..337616))
                     /locus_tag="Mmc1_0295"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(336711..336716,336816..336818,
                     337362..337364,337383..337385,337518..337520))
                     /locus_tag="Mmc1_0295"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(338016..338309)
                     /locus_tag="Mmc1_0296"
                     /db_xref="GeneID:4483353"
     CDS             complement(338016..338309)
                     /locus_tag="Mmc1_0296"
                     /note="PFAM: chaperonin Cpn10;
                     KEGG: atc:AGR_C_1221 10 KD chaperonin (protein CPN10)
                     (protein GROES)"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin Cpn10"
                     /protein_id="YP_864229.1"
                     /db_xref="GI:117923612"
                     /db_xref="InterPro:IPR001476"
                     /db_xref="GeneID:4483353"
                     /translation="MSINFRPLHDRVVVKRTESDAKTAGGIIIPDTAKEKPVQGEVLA
                     VGSGVVNDAGNVRPLEVKVGDKVLFSKYGGTEVRIDGEELLIMRESDIVGILG"
     misc_feature    complement(338022..338300)
                     /locus_tag="Mmc1_0296"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(338025..338033,338079..338081,
                     338085..338087,338100..338102,338130..338132,
                     338193..338198,338277..338279,338286..338288,
                     338292..338294,338298..338300))
                     /locus_tag="Mmc1_0296"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(338211..338252)
                     /locus_tag="Mmc1_0296"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(338136..338138,338169..338171))
                     /locus_tag="Mmc1_0296"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            complement(338740..339885)
                     /locus_tag="Mmc1_0297"
                     /db_xref="GeneID:4483354"
     CDS             complement(338740..339885)
                     /locus_tag="Mmc1_0297"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: tcx:Tcr_1381 sulfide-quinone reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_864230.1"
                     /db_xref="GI:117923613"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4483354"
                     /translation="MHARMHVTIIGTGFASIAAIKQLRKLDALKKLQITVIAPKPCFV
                     HLPSMIWIPSGLRRAEDVTVDLTNFFKHMQVNYIPATVAQITHKGRTVITTQGEHIPN
                     DGLIIASGGTYLQKAPGIEYTLNPCTGLTASERVRDRLQKMPGGTIAFGFAGNPNEPT
                     AVRGGPMFEFLFGIHTQLKREKRRQDFKLIFFNPMLEPGKRLGPKAVKGMLNAMQQRG
                     IETHLGHKIKAFGPDFVRTEGGEFAADMTLFIPGMRGLPLYEQSDLQLSPGGFIQGDQ
                     YCRAEGVMRTYVAGDAANLPGPDWKAKQGYGAGMQATAAASNLYDELLGRPIGATYRN
                     ELLCVVDTLDRGMFVQRSPKLNLILPPMRSMHYIKQFMEWKNIAPLR"
     misc_feature    complement(339004..339870)
                     /locus_tag="Mmc1_0297"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox_2; pfam07992"
                     /db_xref="CDD:254568"
     gene            complement(340981..343680)
                     /locus_tag="Mmc1_0298"
                     /db_xref="GeneID:4481646"
     CDS             complement(340981..343680)
                     /locus_tag="Mmc1_0298"
                     /note="PFAM: response regulator receiver; ATP-binding
                     region, ATPase domain protein domain protein; histidine
                     kinase A domain protein domain protein;
                     KEGG: sat:SYN_00226 signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic sensor hybrid histidine kinase"
                     /protein_id="YP_864231.1"
                     /db_xref="GI:117923614"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4481646"
                     /translation="MDYGSVTFRHLFLIISIIIALLDAAFVWLNYTADKRVLWQNLSR
                     RANNHRDVFNHTLISTAGHMQQISTLLANTPEVRSRFLQGRLAVDREGGGAGGVQAAR
                     IRKELYNFLKPGWQAVQNSYEIRQLHFHLAPGDISFLRVHKPDKFGDDLSAIRHTIVH
                     SNRFREPTQGFESGRVYAGIRGVVPVIMAAGEDKPEMLVGSVESGTSFVELLQNLKGQ
                     MGADYAVLLTTEYARNTLWPKVYQKMVTEGPTNTHYVTEATTSNSLAELFKDDALFSD
                     QEGMCRLQVVPLGGQPVALTCFDLLDFRNMQDPQSKPVGKVVVWSQAGAEMLAFNAKF
                     RDNILFAISTYLAVELLVFILLRMGTGQFRREVLERTVALHKNNRQLALAKREAEEAN
                     AAKSRFLATMSHEIRTPMNAIVGMADLLKDTPLDREQARFVATFQRAGDQLMDLLNDI
                     LDLSKVQSGQIHIEVVETDIRTLLDDLSAMMVAKARVKQVDLLFNPHPNLPARVGVDP
                     LRLRQVMINLLGNAIKFTANGEVELRAYFTSSSEVPYGLGFEISDTGIGIDETRLKAI
                     FEAFTQADLSVTRQFGGTGLGLTISRHLVALMGGDIQVESTIGQGSRFWFEIPIDEPV
                     QRQPLSILEPRPVLYLNGMSPNHAEVLRHQLLHHCEEIRYSHGEGELGAQLMEAAPGS
                     VVWLESGHDPTGAFRLLESLRGQYGKRGFHWIVAGWESVEKCLEQANFLGSHYIQKPH
                     SMGQVLQLLMDVLGMQRVVLAPRVDMDLQTPITILLAEDSPDNVLLVERFLKKTAYRL
                     DVVGNGREALESVKKHHYDLILMDIQMPEMDGLSATRTLRSWEREQGTPRTPVLALTA
                     HAFREDREASIEAGCDGHLTKPFKKDELLKTIQRHALPHMQRS"
     misc_feature    complement(342316..342507)
                     /locus_tag="Mmc1_0298"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(342331..342333,342343..342345,
                     342352..342354,342364..342366,342373..342375,
                     342385..342387,342433..342435,342442..342444,
                     342454..342456,342463..342465,342475..342477,
                     342487..342489))
                     /locus_tag="Mmc1_0298"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(342469..342471)
                     /locus_tag="Mmc1_0298"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(341827..342150)
                     /locus_tag="Mmc1_0298"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(341839..341841,341845..341850,
                     341863..341865,341869..341871,341917..341928,
                     342007..342012,342016..342018,342022..342024,
                     342028..342030,342109..342111,342118..342120,
                     342130..342132))
                     /locus_tag="Mmc1_0298"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(342118..342120)
                     /locus_tag="Mmc1_0298"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(341920..341922,341926..341928,
                     342010..342012,342016..342018))
                     /locus_tag="Mmc1_0298"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(341005..341358)
                     /locus_tag="Mmc1_0298"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(341047..341052,341059..341061,
                     341116..341118,341191..341193,341215..341217,
                     341344..341349))
                     /locus_tag="Mmc1_0298"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(341215..341217)
                     /locus_tag="Mmc1_0298"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(341191..341199,341203..341208))
                     /locus_tag="Mmc1_0298"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(341044..341052)
                     /locus_tag="Mmc1_0298"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(343683..344162)
                     /locus_tag="Mmc1_0299"
                     /db_xref="GeneID:4481647"
     CDS             complement(343683..344162)
                     /locus_tag="Mmc1_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864232.1"
                     /db_xref="GI:117923615"
                     /db_xref="GeneID:4481647"
                     /translation="MVAVLLVLGGLLFVPVGNPDLPPQGLWLRAQHRLLPGLYWQRRL
                     LAAQQRLEQAQLVLDGAKADYRQVVRGRRQQIEQARRLAQQEQRNPVTAHRAVVVASR
                     ARIHDLRKQLQGAQAQLRRQQRQLETIQLLKLQEMGLYTAVPAVESAGLKPVGAESR"
     gene            complement(344509..345882)
                     /locus_tag="Mmc1_0300"
                     /db_xref="GeneID:4481648"
     CDS             complement(344509..345882)
                     /locus_tag="Mmc1_0300"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type;
                     ATPase associated with various cellular activities, AAA_5;
                     SMART: ATPase AAA;
                     KEGG: sat:SYN_01466 sigma-54 dependent transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="two component, sigma54 specific, Fis family
                     transcriptional regulator"
                     /protein_id="YP_864233.1"
                     /db_xref="GI:117923616"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:4481648"
                     /translation="MKDQTEIILLGRSDSALNSLAMQLKSLQCQPVLIADVTKAKTYL
                     RSHQAGLVMIAMEGVDEPLDLLKELTFLFRGLPLLAIATRGSVHEAKQTIDAGAADYL
                     LLPVDNEVLSAQIKRYNNQFFDPELGRGRRLVTADPAMLKLLGQVRRVSNSNATVLIQ
                     GESGTGKELMARYVHQVSDRANGPFVAINCAALPENLLESELFGHIKGAFTGATSDRK
                     GKFLQANGGTIFLDEISEMTLNLQAKLLRVLQEKEVDPVGGKHPIALDVRVIASTNRD
                     LKEYAADGLFREDLYYRLNVFPVFITPLRQRPKDVVLLADLFRQRFIKELGRNDIPFD
                     AAAMDALVRYRWPGNIRELENVVQRALLIAEDDAVSSHDLMIEVSGSAAPSPSMTRDA
                     DEMGMALDGDHIHMPVGTTVREMEEILIRRTLDEVDGNRTRAAEILGISIRTLRNKLN
                     EYAGRIP"
     misc_feature    complement(344527..345882)
                     /locus_tag="Mmc1_0300"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    complement(345529..345834)
                     /locus_tag="Mmc1_0300"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(345700..345708,345712..345717))
                     /locus_tag="Mmc1_0300"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(345568..345573,345580..345582,
                     345637..345639,345700..345702))
                     /locus_tag="Mmc1_0300"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(345565..345573)
                     /locus_tag="Mmc1_0300"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(344998..345471)
                     /locus_tag="Mmc1_0300"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(345379..345402)
                     /locus_tag="Mmc1_0300"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(345061..345063,345187..345189,
                     345376..345399))
                     /locus_tag="Mmc1_0300"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(345184..345201)
                     /locus_tag="Mmc1_0300"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(345004..345006)
                     /locus_tag="Mmc1_0300"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(344527..344652)
                     /locus_tag="Mmc1_0300"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(345888..348623)
                     /locus_tag="Mmc1_0301"
                     /db_xref="GeneID:4481649"
     CDS             complement(345888..348623)
                     /locus_tag="Mmc1_0301"
                     /note="PFAM: hypothetical protein; Tetratricopeptide TPR_2
                     repeat protein;
                     SMART: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864234.1"
                     /db_xref="GI:117923617"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4481649"
                     /translation="MNAQPNKRTKPWAVPGLLLLVMVLFIPVRGWAFSTELQHEPSPS
                     GKGDTLSFELPSNDQLPSWELIRPKVLRLKVPNLLALPHTRIDPKTTRYIRNIVVEEI
                     AGELGLYITLELKVPLLTFRHQVTEAKRRHPSRYILYIEPTPMPNPQDVTRIRGARIL
                     PGAEGTLVVIDHVGSAEIKDQNIDHAQHAIRLQWQGAAMDKFWIAPQPAGLVTAIHTY
                     TFSNDLLEMEIAFHPRTGSVELHQNPKSGTLIIELRTQNMKDVKRKQDIDTILTNRLQ
                     AVAEGLPLPLNRITPIFKPSSEVVKLADQEVTEEYFMNNALAAEKDHQYGKARGYLDA
                     ILRTFPQTQNRELLAFYKVDLGKKMQWEKAGWLLEELTGVLNTYPNHYRYPEYRLLQL
                     QLMNGAHQSERALAAMNDPNLPMNDARVVLEQARAEKGMGHDVEALERLYYLLEKMPD
                     ANVRERAGAYFELVDLETQRNHLEKAVKILEEIPDPEMTFLANDPDRYIQLATAYYNH
                     NDFPKALDLYIRILDAYPDTPAVTPWAMLRAAMCYRFMNKEDEAKRLLDRLGLIYPNS
                     GAQLWGRIFRVEMDGKRDVKERLQELDEIIASNPRGKAIFEAYFAKSQLQGDSGDHES
                     SLKTLNYLLTMLDIGFERNRANLLRRRYLQAGMEQALTQRQPEYAMSLAETYGEDWRR
                     FNLFVVPRTQLSEALMRLGQYREAQPLLAVNDDVESKRLHKLADDLANGIYPKVDQDR
                     SLVNEREARVRVAEAERRREKEDWVAILDLLNRLPIKGLSEGERDERLRLLAKAESER
                     GRFPQAVQNLEDLLFNRPMGDGKDYYWYATVQQAWRGDEKALPVYRKVADEAEKVQFK
                     ALALMRIGDILQKQRNLTEAKQAFEKAAELDPQASWAPMARENAKQLELVQEMAP"
     misc_feature    complement(346824..347132)
                     /locus_tag="Mmc1_0301"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(346878..346880,346884..346886,
                     346893..346898,346905..346910,346989..346994,
                     347001..347006,347010..347015,347112..347117,
                     347124..347129))
                     /locus_tag="Mmc1_0301"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(346839..346841,346848..346850,
                     346860..346862,346899..346901,346947..346949,
                     346956..346958,346968..346970,347004..347006,
                     347061..347063,347070..347072,347082..347084,
                     347118..347120))
                     /locus_tag="Mmc1_0301"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(345957..>346115)
                     /locus_tag="Mmc1_0301"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(345975..345977,345984..345986,
                     345996..345998,346032..346034,346086..346088,
                     346095..346097,346107..346109))
                     /locus_tag="Mmc1_0301"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(348623..349684)
                     /locus_tag="Mmc1_0302"
                     /db_xref="GeneID:4481650"
     CDS             complement(348623..349684)
                     /locus_tag="Mmc1_0302"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type;
                     SMART: ATPase AAA;
                     KEGG: bba:Bd3432 response regulator of hydrogenase 3
                     activity (sensor HydH)"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent trancsriptional regulator"
                     /protein_id="YP_864235.1"
                     /db_xref="GI:117923618"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4481650"
                     /translation="MNGIIGSAPAMRKLFKLIERVAAADSTVLIHGESGTGKELICRA
                     IHNTSPRHNGPLIAVNCGAIPEDLLESELFGHAKGSFTGAVRDRPGKFVTANNGTIFL
                     DEIGDMSPKLQVKMLRVLQERIVEPVGALRSVEVNVRVIAATHKNLSKEVEEGRFRED
                     LFYRLNVVPIQVPPLRDRIEDVSSLVEHFMEKCAARSNCPPVKIGAQVMSIFQRYSWK
                     GNVRELENLMERLIVLADDEVTLDDLPENMLDTSNHTEPRAQEERIPVQAFRVAYNDD
                     DEDEGDGEMVLDDRESVTDFNHQVEQYENQLILNALNRTGWNKNKAAQLLKLNRTTLV
                     EKIKKKGLEDDKQSEQRSG"
     misc_feature    complement(348701..349675)
                     /locus_tag="Mmc1_0302"
                     /note="psp operon transcriptional activator PspF; Region:
                     phageshock_pspF; TIGR02974"
                     /db_xref="CDD:234077"
     misc_feature    complement(349163..349657)
                     /locus_tag="Mmc1_0302"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(349568..349591)
                     /locus_tag="Mmc1_0302"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(349250..349252,349376..349378,
                     349565..349588))
                     /locus_tag="Mmc1_0302"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(349373..349390)
                     /locus_tag="Mmc1_0302"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(349193..349195)
                     /locus_tag="Mmc1_0302"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(348668..348787)
                     /locus_tag="Mmc1_0302"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            350214..351236
                     /locus_tag="Mmc1_0303"
                     /db_xref="GeneID:4481651"
     CDS             350214..351236
                     /locus_tag="Mmc1_0303"
                     /EC_number="2.1.1.72"
                     /note="involved in methylation of ribosomal protein L3"
                     /codon_start=1
                     /transl_table=11
                     /product="N5-glutamine S-adenosyl-L-methionine-dependent
                     methyltransferase"
                     /protein_id="YP_864236.1"
                     /db_xref="GI:117923619"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="GeneID:4481651"
                     /translation="MSGKYKNRANQTDGTKKRTDKGRPGAPQRGGQKNPPARTVTDPA
                     HSVDGWLRRSTARLKQAKLSYDNGLQEPQWEAEYLLAHAMGMDLEQLERHKTQQVGPD
                     QAAYMEALLQQRIEQRKPVNYITGEAWFAGHRFVVDERVLIPRSRIENVLDDPDGLLG
                     LMEGARPLKRMLDLCTGSGCLAITAALHYPWLQVDAVDLSADALAVAAENVKRHRVTE
                     RVRLVRSNLFEKLTGACYDLILTNPPYVPTRIYAGLAAEYHREPKMALEAGGDGLDLV
                     IPILQQAAEYLEPGGILLCEVGDDTQEIMEQRWPDLPVYWLQFHFEASGVFAVTREQL
                     LDWDGL"
     misc_feature    350346..351206
                     /locus_tag="Mmc1_0303"
                     /note="protein-(glutamine-N5) methyltransferase, ribosomal
                     protein L3-specific; Region: L3_gln_methyl; TIGR03533"
                     /db_xref="CDD:234247"
     misc_feature    350721..351104
                     /locus_tag="Mmc1_0303"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(350733..350753,350805..350810,350886..350894,
                     350937..350939)
                     /locus_tag="Mmc1_0303"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            351233..352627
                     /locus_tag="Mmc1_0304"
                     /db_xref="GeneID:4481652"
     CDS             351233..352627
                     /locus_tag="Mmc1_0304"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein;
                     KEGG: dar:Daro_3868 GGDEF"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_864237.1"
                     /db_xref="GI:117923620"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="GeneID:4481652"
                     /translation="MIFRKKKKSLSEEPVKVQYALDFLEEKHEDRDGARRVLRDWVFQ
                     EAMGPDPLKDPAVRLLVSALVNGFKPAYLGDAEMQGRVDRVVEDLKQGKHKKESEPLL
                     EELRALIAGLGKLSTRQSDRMHLAIRWLPDILQAVHTLTRGEAWAEEQSLMLIEQSGV
                     LPPGYWERLGSFCSEIREAGVSSFERWEESRKALVDLIAEIADRMRVMRKDASGATGR
                     LDETLSRIRTTTRLGDLESLRGALVTEAEALRSQTQSLATSLSESQAQLDLTRKQLQQ
                     VQDDLKKAKEESLTDPLTQVANRRALFQSLTRETARTRRYGEPLSLIIIDLDHFKKIN
                     DTYGHPVGDRVLKEVAGHARALLRDSDTLARYGGEEFVALLPETTLPQAMEKAEQIRL
                     SVAAMRFKLKGESLSISASLGVAQLDDGASQDANNEAFVHRADQALYRAKSGGRNCVI
                     QADPTPASDSQATS"
     misc_feature    352097..352582
                     /locus_tag="Mmc1_0304"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(352208..352210,352337..352339)
                     /locus_tag="Mmc1_0304"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(352223..352225,352232..352237,352247..352249,
                     352259..352261,352325..352327,352331..352342)
                     /locus_tag="Mmc1_0304"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(352313..352315,352397..352399)
                     /locus_tag="Mmc1_0304"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            352637..353521
                     /locus_tag="Mmc1_0305"
                     /db_xref="GeneID:4481653"
     CDS             352637..353521
                     /locus_tag="Mmc1_0305"
                     /note="PFAM: Squalene/phytoene synthase;
                     KEGG: aba:acid345_1745 squalene/phytoene synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="squalene/phytoene synthase"
                     /protein_id="YP_864238.1"
                     /db_xref="GI:117923621"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="GeneID:4481653"
                     /translation="MSWFTGPTIPYHLLQDFDYCQRVVRANSENFPVGSLLAPARLRP
                     HIHAVYAYARMADDFADSSEGSPKEKLQKLDDWQRRLEAAQRGEADHPVFRALAYTMQ
                     QMQLPIDPLRDLLMAFRMDITCKHYDTTQELLEYCRYSANPVGRIVLRLAGYRDETLM
                     GYADAICTALQLTNHWQDLGEDPWNGRPLYLPREEMARFGVKEADILQRRFSAAAAEL
                     MMHLIAQTRALYLQGEPLLTKVSWPLNLELGATWAGGMAVLERIEQLGGNTLRERPSL
                     DKRAKMGCLLRGLGRVCR"
     misc_feature    352688..353479
                     /locus_tag="Mmc1_0305"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-head; Region: Trans_IPPS_HH; cd00683"
                     /db_xref="CDD:173831"
     misc_feature    order(352715..352729,353453..353464)
                     /locus_tag="Mmc1_0305"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    order(352721..352723,352727..352729,352784..352786,
                     352796..352798,352805..352807,352817..352819,
                     353042..353044,353057..353059,353069..353071,
                     353135..353137,353144..353146,353165..353170,
                     353177..353182,353195..353197,353372..353377)
                     /locus_tag="Mmc1_0305"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173831"
     misc_feature    order(352727..352729,352784..352786,352805..352807,
                     352817..352819,353042..353044,353066..353068,
                     353078..353080,353144..353146,353165..353170,
                     353180..353182,353195..353197,353372..353377,
                     353387..353389)
                     /locus_tag="Mmc1_0305"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    order(352805..352819,353168..353182)
                     /locus_tag="Mmc1_0305"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173831"
     misc_feature    352805..352819
                     /locus_tag="Mmc1_0305"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173831"
     misc_feature    353168..353182
                     /locus_tag="Mmc1_0305"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173831"
     gene            353518..354384
                     /locus_tag="Mmc1_0306"
                     /db_xref="GeneID:4481654"
     CDS             353518..354384
                     /locus_tag="Mmc1_0306"
                     /note="PFAM: Squalene/phytoene synthase;
                     KEGG: dar:Daro_2706 squalene/phytoene synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="squalene/phytoene synthase"
                     /protein_id="YP_864239.1"
                     /db_xref="GI:117923622"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="GeneID:4481654"
                     /translation="MTPDLYCQARVKRSGSSFYWPMRLLPAHKRRGLFALYAFCREVD
                     DIVDRQLDPRAAHMKLAWWHEEIVEVFTGQPRHPVARALHALKDQYGWQMAPFIEILQ
                     GMEMDLQPRNYENWQELEGYCHKVSVAVGLAALPVFGVTGERAQQFAHHLGMALQLTN
                     ILRDLFEDGQMGRVYLPQTVLQAHGVQHQGILDGEWQPALVAALQEVDARIESHFAQA
                     RELVQGEHFAQLTAARSMGAVYHARLRRIRAAGYRVDQQPAQLSKSYKLWLCLRCWLA
                     SRVGWLRAYDAL"
     misc_feature    353533..354315
                     /locus_tag="Mmc1_0306"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-head; Region: Trans_IPPS_HH; cd00683"
                     /db_xref="CDD:173831"
     misc_feature    order(353557..353571,354289..354300)
                     /locus_tag="Mmc1_0306"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    order(353563..353565,353569..353571,353626..353628,
                     353638..353640,353647..353649,353659..353661,
                     353881..353883,353896..353898,353908..353910,
                     353974..353976,353983..353985,354004..354009,
                     354016..354021,354034..354036,354208..354213)
                     /locus_tag="Mmc1_0306"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173831"
     misc_feature    order(353569..353571,353626..353628,353647..353649,
                     353659..353661,353881..353883,353905..353907,
                     353917..353919,353983..353985,354004..354009,
                     354019..354021,354034..354036,354208..354213,
                     354223..354225)
                     /locus_tag="Mmc1_0306"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173831"
     misc_feature    order(353647..353661,354007..354021)
                     /locus_tag="Mmc1_0306"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173831"
     misc_feature    353647..353661
                     /locus_tag="Mmc1_0306"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173831"
     misc_feature    354007..354021
                     /locus_tag="Mmc1_0306"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173831"
     gene            354371..355717
                     /locus_tag="Mmc1_0307"
                     /db_xref="GeneID:4481655"
     CDS             354371..355717
                     /locus_tag="Mmc1_0307"
                     /note="PFAM: amine oxidase;
                     KEGG: bxe:Bxe_B0011 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="YP_864240.1"
                     /db_xref="GI:117923623"
                     /db_xref="InterPro:IPR001613"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="GeneID:4481655"
                     /translation="MMPFEWEGPLDLVIIGGGLAGLACASEALRQGRRPLLVEAAPRL
                     GGRVASHWDRRWGCVLDNGPHLLVGAYKETLAWLAQLGVQEGLQRGTAYHFYTPQHGH
                     HKLSLGPGWAAWRLGRGLAQLPGLSGGELWSLRGLLPALWREHVRGAAHALTVTQWLQ
                     RAGSPPQLFERLWEPLCLATLNEGPGSADAHLFAGVLSRLFLWNSADAQPLYPTQDLS
                     SLLVEPARRWIEQRGGVIRTGLRLQGLEQSQQQITALILHSATEGVTWHLPAGLPVVL
                     AIPHWSLASLLPQWAQQQGWTEWPAAPIVAVHLRYDGAVKQPAPMVGMPGSVSQWLCQ
                     WPMAAGEGRISAAISAAYREVSWQSQRLIDAVHQDVVAQQPQLAGMQPQGRVIKTQRA
                     TFASWPGVNRWRPNGRCTPWHNMYLAGDWTATGLPATIEGAVQSGRQAAQAIFTPR"
     misc_feature    354410..354613
                     /locus_tag="Mmc1_0307"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    354461..355708
                     /locus_tag="Mmc1_0307"
                     /note="squalene-associated FAD-dependent desaturase;
                     Region: HpnE; TIGR03467"
                     /db_xref="CDD:234221"
     gene            355731..356639
                     /locus_tag="Mmc1_0308"
                     /db_xref="GeneID:4481656"
     CDS             355731..356639
                     /locus_tag="Mmc1_0308"
                     /note="KEGG: rru:Rru_A0941 competence lipoprotein ComL"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA uptake lipoprotein-like protein"
                     /protein_id="YP_864241.1"
                     /db_xref="GI:117923624"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:4481656"
                     /translation="MRDGEKRTMKRLCMMVMLVLLLSGCSSTEEKDVQPDLAPEVMYR
                     MAVNHVQKKNYKSAATIFTDLDQKHPFSPWAVRAQLNLIFATYKQDEFDEAVGHAKRF
                     IRLHPRHPEVSYAFYMIGLAHYRQIKDPYRDQARTKEAATAFHEVINRFGESDYAWEA
                     QKMLDFCRNRMAQQEIVVGRYYFDRGEYIAAMKRFNEIVDNPEFRDSLQTEEALFSMV
                     LSALKLGLEQEAKNYAVVLGHNYKDGRLYAVAKDILNGKGGISRSDLQSMRPEIVEDS
                     IVAQFLEGMQPGLPGMFGEGARGNGL"
     misc_feature    355755..356459
                     /locus_tag="Mmc1_0308"
                     /note="outer membrane assembly lipoprotein YfiO; Region:
                     OM_YfiO; TIGR03302"
                     /db_xref="CDD:234164"
     misc_feature    355755..>355847
                     /locus_tag="Mmc1_0308"
                     /note="Flagellar L-ring protein; Region: FlgH; cl19182"
                     /db_xref="CDD:267535"
     misc_feature    355848..356177
                     /locus_tag="Mmc1_0308"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(355848..355853,355857..355862,355869..355874,
                     355968..355973,355977..355982,355989..355994,
                     356070..356075,356091..356096,356103..356108)
                     /locus_tag="Mmc1_0308"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(355866..355868,355902..355904,355914..355916,
                     355977..355979,356013..356015,356025..356027,
                     356034..356036,356088..356090,356148..356150,
                     356160..356162,356169..356171)
                     /locus_tag="Mmc1_0308"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            356719..357849
                     /locus_tag="Mmc1_0309"
                     /db_xref="GeneID:4481657"
     CDS             356719..357849
                     /locus_tag="Mmc1_0309"
                     /note="TIGRFAM: efflux transporter RND family, MFP
                     subunit;
                     KEGG: noc:Noc_1992 secretion protein HlyD"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_864242.1"
                     /db_xref="GI:117923625"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:4481657"
                     /translation="MDRYISKGRIGLTWLALAWLTSAAAVGYGQEVTQPEQPPEAVLS
                     PPEAPLFGAQVTPGLGQVVTVKPVAALLVEQQEQAAASVVALREAWVAAQVSAPILEL
                     HAETGDRVAWGAVLARQDTWSQGLEHARAKAALGVLESQLLLAKQQLEQVEKLGEQEA
                     TGEALMGRRRGEKQVLEARIVEAKSAVEQAVKQVEKGVIHAPFSGVVLDRKAQLGGWS
                     DVGSPLFQLVDPVRVMLEATIPAASIKSMKMAKRWYFVHASGQVEVKLENILPRQEET
                     TQTLRVRFRFDRDKPLPGSSGQLVWQDEQRWIEPDLLVERNNKLGLFIVDDQQVAHFV
                     ALPHAQAGQRAQLLSLFTPDMPIVIMGRDQLQDGQQVVVSQE"
     misc_feature    356905..357837
                     /locus_tag="Mmc1_0309"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    357310..357600
                     /locus_tag="Mmc1_0309"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(357893..360877)
                     /locus_tag="Mmc1_0310"
                     /db_xref="GeneID:4481658"
     CDS             complement(357893..360877)
                     /locus_tag="Mmc1_0310"
                     /note="TIGRFAM: hemerythrin-like metal-binding protein;
                     PFAM: histidine kinase, HAMP region domain protein;
                     chemotaxis sensory transducer; hemerythrin HHE cation
                     binding domain protein;
                     KEGG: dps:DP2258 similar to methyl-accepting chemotaxis
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_864243.1"
                     /db_xref="GI:117923626"
                     /db_xref="InterPro:IPR002063"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR012312"
                     /db_xref="InterPro:IPR012827"
                     /db_xref="GeneID:4481658"
                     /translation="MCPVKPFLTYRIQHKYGRIAVWLEQSTFQPARFALVTVYHFVIL
                     RIKLYHAQFACLLANAIGDRQPGRGTGLNPDPILWESITVNIKKTLVLTNGLLAATIA
                     LILGIILWTTAEQQSDSVTINMAGRQRMLSQKIAKEFGLYLANPNQTEKSLLLTSVWA
                     FDTTLHALLTGGQAPTKLDRNTPALVQIGHPNDEILTKLKAVQALWQPLAQQFKALES
                     NPTDLNGLAKLVTTQNMPLLKEMNSAVTMMQNQAEGKVSRIINTALFGALLGLVIFAL
                     ALYQTRLLSQRLKRAFGTLEHISRGSLDHQLSADDPTHEVDQIAEKINIIVNQLSTST
                     QLVILQSDSVAACANELLKLRDMLNDDSEMTSKAMAAASEKLSELEQAIVSIQDKIGD
                     ATHSIENIADSSTYLSSGITTMASAAEQASQNVSTMAAAAEEMTSNLSAVNSSIQNVN
                     QATGKIGGSLDEMISTLEDVRQRCVVASHKSQQANQHIHSTLKVMNELSNSANEIDRF
                     VDLINNIAEQTNMLALNASIEAAGAGESGKGFAVVANEVKELAHQTSEVTTLISGQIR
                     IIQDHSKNAQQATEGVSEIVTAINQANDEITYAVDDQNHAIHEISSSFNAVVQASQEV
                     TRNVDELYQAANEVSRAALDAASGTNEIALSANASADSAQKVSENAQMVHQLVQAIFT
                     ETSTTIAAAEVTEKSIQTASQRATYISGTVHNFVILIDVLQAAMEALRAAQAVYKTGH
                     KSFDVRTIKEGHLAWLRELEQAVHGRSVLDAKEAANYRGCDFGLWYYGDGQQRYGNEA
                     LFVELGTVHQKVHEAAFEVVNLVQSGSVEQAYKSMDRFKQLRKELFILLDGIYFSGLT
                     INDQKMIDWEDALDVGVKVLNADHLKLMNYINDLHAAMRDGKGKDKLATILAGLIEFT
                     HTHFAREEGLMKKHGYDRYAQQKEEHVNLIAQLGEKKKQFDEGSATVALDLLAFLQNW
                     LIDHIKGEDMRYKTFFQSKGEL"
     misc_feature    complement(360197..360529)
                     /locus_tag="Mmc1_0310"
                     /note="Type IV pili methyl-accepting chemotaxis transducer
                     N-term; Region: PilJ; pfam13675"
                     /db_xref="CDD:257980"
     misc_feature    complement(359570..>359848)
                     /locus_tag="Mmc1_0310"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(358844..359683)
                     /locus_tag="Mmc1_0310"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(358919..359596)
                     /locus_tag="Mmc1_0310"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(358922..358927,358934..358936,
                     358943..358948,358955..358957,358964..358969,
                     358973..358978,358985..358990,358994..358999,
                     359006..359008,359015..359020,359027..359029,
                     359036..359041,359048..359053,359078..359083,
                     359090..359092,359099..359104,359111..359113,
                     359120..359125,359183..359188,359195..359200,
                     359204..359209,359216..359221,359228..359230,
                     359237..359242,359249..359251,359258..359260,
                     359270..359272,359291..359293,359300..359302,
                     359312..359314,359321..359326,359333..359335,
                     359342..359344,359351..359356,359363..359368,
                     359375..359377,359384..359389,359393..359395,
                     359405..359410,359414..359416,359459..359461,
                     359468..359470,359477..359482,359489..359494,
                     359501..359503,359510..359515,359522..359524,
                     359531..359536,359540..359545,359552..359554,
                     359561..359566,359573..359578))
                     /locus_tag="Mmc1_0310"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(359225..359326)
                     /locus_tag="Mmc1_0310"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(358418..358633)
                     /locus_tag="Mmc1_0310"
                     /note="Chemoreceptor zinc-binding domain; Region: CZB;
                     pfam13682"
                     /db_xref="CDD:257985"
     misc_feature    complement(357923..358258)
                     /locus_tag="Mmc1_0310"
                     /note="Hemerythrin; Region: Hemerythrin; cd12107"
                     /db_xref="CDD:213982"
     misc_feature    complement(order(357935..357937,357950..357952,
                     358058..358060,358070..358072,358115..358117,
                     358127..358129,358238..358240))
                     /locus_tag="Mmc1_0310"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:213982"
     gene            complement(360992..362356)
                     /locus_tag="Mmc1_0311"
                     /db_xref="GeneID:4481659"
     CDS             complement(360992..362356)
                     /locus_tag="Mmc1_0311"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein;
                     KEGG: pfl:PFL_4014 sensor histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor signal transduction histidine kinase"
                     /protein_id="YP_864244.1"
                     /db_xref="GI:117923627"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4481659"
                     /translation="MSRSLYARISIPLVLILLLVMGLQWLVVHLALHGLVKEYVASRL
                     DHDADNLLAQLSITAQGVHLAPERLDPIFYKPWSGHYFQIEVGGQTLRSRSLWDKALV
                     LEKVPPGGRLLRQQRGPDQAPLLVLIRGYSKQGQSVNMALAEDFQAATQIVTTLRLFY
                     GGLSLAALLLLLFLVRHHLRRALMPLESAEAQLHALEHGTLQRLDPTAMPLELHPFVH
                     QINSLLAILMNRLQRSRQAAGDLAHAIKTPLALLNQLANDAPFTQHPNLQHALRTQIT
                     TIAHLSERTLGLARLSGGQGHGVWLDLAHELNGLLEVMRQLHRDRGLTYHVEPLEPLK
                     IHMDREDLLTLLGNLLDNASRHARHQIHFGAQTSAQVLQLWVADDGPGIPPQARERLL
                     QRGIHGDQPQHGHGLGLAICQQIVLDYQGTLTLNQDPQLLGLQVMLELPAQLAHLAPS
                     TPTT"
     misc_feature    complement(361022..361933)
                     /locus_tag="Mmc1_0311"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(361082..361300)
                     /locus_tag="Mmc1_0311"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(361082..361084,361130..361141,
                     361208..361213,361217..361219,361223..361225,
                     361229..361231,361292..361294))
                     /locus_tag="Mmc1_0311"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(361133..361135,361139..361141,
                     361211..361213,361217..361219))
                     /locus_tag="Mmc1_0311"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(362353..363018)
                     /locus_tag="Mmc1_0312"
                     /db_xref="GeneID:4481660"
     CDS             complement(362353..363018)
                     /locus_tag="Mmc1_0312"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     KEGG: son:SO4487 DNA-binding response regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_864245.1"
                     /db_xref="GI:117923628"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:4481660"
                     /translation="MRILVVEDHASLAAGLKKDLGAAGFVVDWAANAEEGAFMGREEP
                     YDAVILDLGLPDDSGLNVLRGWRAAGVDVPVIILTAWDAWHQRVDGLQAGGDDYLGKP
                     FHMEELIARLNALIRRRHGVVRPALTLEGIHLDETDQQLSLANGELHTLTHTEFRLLR
                     YLMLHPDQLLSKSQLTEHIYAYDEDRDSNVIEVYIKRLRRLLGQQRIETRRGQGYRLR
                     SKP"
     misc_feature    complement(362356..363018)
                     /locus_tag="Mmc1_0312"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(362671..363009)
                     /locus_tag="Mmc1_0312"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(362713..362718,362725..362727,
                     362782..362784,362842..362844,362866..362868,
                     362995..363000))
                     /locus_tag="Mmc1_0312"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(362866..362868)
                     /locus_tag="Mmc1_0312"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(362842..362850,362854..362859))
                     /locus_tag="Mmc1_0312"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(362710..362718)
                     /locus_tag="Mmc1_0312"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(362368..362640)
                     /locus_tag="Mmc1_0312"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(362377..362379,362392..362394,
                     362413..362418,362440..362442,362449..362451,
                     362503..362508,362563..362565))
                     /locus_tag="Mmc1_0312"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(363021..363338)
                     /locus_tag="Mmc1_0313"
                     /db_xref="GeneID:4481661"
     CDS             complement(363021..363338)
                     /locus_tag="Mmc1_0313"
                     /note="KEGG: mag:amb0190 predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_864246.1"
                     /db_xref="GI:117923629"
                     /db_xref="GeneID:4481661"
                     /translation="MTNRLNRPIVPLLLLPLLMASPAYAGDDVDHEQAYALVQQGRIL
                     PLAEILARHPQLAQVRLLEVELEQKHGRYLYELSFVTPSGQVLEWKLDAQSGTRLTQP
                     RHH"
     misc_feature    complement(363048..363203)
                     /locus_tag="Mmc1_0313"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY; pfam03413"
                     /db_xref="CDD:251934"
     gene            complement(363331..363909)
                     /locus_tag="Mmc1_0314"
                     /db_xref="GeneID:4481662"
     CDS             complement(363331..363909)
                     /locus_tag="Mmc1_0314"
                     /note="KEGG: son:SO4485 diheme cytochrome C"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864247.1"
                     /db_xref="GI:117923630"
                     /db_xref="GeneID:4481662"
                     /translation="MLNKRFIVGGLLFVTLLGGGVMLGVKTVLSDDFRRGYQEHAHEK
                     YEQDKEHKKNHPDRHGAALNPTYVKACGSCHFAFQPRWLTGATWQHMLDGLENHFDEN
                     AQLDPATTQQLRDYLSQHGAKGNRSLDPASMRITDTRFFRHAHDEIPAKLVKDNPKVG
                     SWSRCDLCHSDAQQGKFDEDRARIPGAEHRDD"
     misc_feature    complement(363379..363711)
                     /locus_tag="Mmc1_0314"
                     /note="Dihaem cytochrome c; Region: DHC; pfam09626"
                     /db_xref="CDD:255460"
     gene            complement(363925..364296)
                     /locus_tag="Mmc1_0315"
                     /db_xref="GeneID:4481349"
     CDS             complement(363925..364296)
                     /locus_tag="Mmc1_0315"
                     /note="KEGG: rsp:RSP_2021 mono-heme class I cytochrome C"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864248.1"
                     /db_xref="GI:117923631"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4481349"
                     /translation="MICLPHSLRYAPLLLGLLWSNGTLAAEPAANLLAGQQLWSQPGI
                     TKNQLQRRCATCHGTNLTQPGQHILTGKPLAPMAASVSPDRYQDMEKVTLWLNRNCQW
                     TFGQLCTPQQQAQLLAYLKSL"
     misc_feature    complement(363937..364224)
                     /locus_tag="Mmc1_0315"
                     /note="Domain of unknown function (DUF1924); Region:
                     DUF1924; pfam09086"
                     /db_xref="CDD:255173"
     gene            complement(364293..364868)
                     /locus_tag="Mmc1_0316"
                     /db_xref="GeneID:4481733"
     CDS             complement(364293..364868)
                     /locus_tag="Mmc1_0316"
                     /note="PFAM: cytochrome B561;
                     KEGG: son:SO4483 cytochrome b"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="YP_864249.1"
                     /db_xref="GI:117923632"
                     /db_xref="InterPro:IPR011577"
                     /db_xref="GeneID:4481733"
                     /translation="MQTENQTLPVWDLWIRLFHASLILLVLTALLSEDEWLKIHVVAG
                     FGLCGLLLFRLIWGFIGSQHARFRDFIYPPKQVIAYLRTLYQGNPPHHLGHNPAGGMM
                     VLLLLITLTLLGLSGLLTLGASQETGLLHNMAAALPPSTVKPIESLHEGLGELLWALI
                     ALHLGGVLLGMWQHKENLIKSMIHGNKQARS"
     misc_feature    complement(364308..364844)
                     /locus_tag="Mmc1_0316"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            365328..371249
                     /locus_tag="Mmc1_0317"
                     /db_xref="GeneID:4481734"
     CDS             365328..371249
                     /locus_tag="Mmc1_0317"
                     /note="KEGG: hch:HCH_03218 superfamily I DNA and RNA
                     helicase and helicase subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="superfamily I DNA/RNA helicase"
                     /protein_id="YP_864250.1"
                     /db_xref="GI:117923633"
                     /db_xref="GeneID:4481734"
                     /translation="MDTLILHVSVQEKINFATQQNAVPILRELSIENIGQESVANLRL
                     TLTSNPVFLVRKTWHLDQLEPGLRLTVSDRDIRLDAGLLMSLHESLRGDLRVELYQDD
                     LLLVEKNIEVELLARHQWGGSQFMPEMLAAFIEPNDTFIAEILRSASSLLQKNGLESG
                     LDGYQKDSSVRVGEVVSAIWSAIAALGITYAEPPASFEQNGQKIRLPSIIKQTGLATC
                     LDLALLFASAMEQAGLNSLIIITQDHAFPGVWLKPQTFPTVLIKTALDIRKRFDLQEL
                     LVFESTFATSRTNPVPFHKAVKKGRAQLEEHGQFYMAIDVQRARMYQIRPLYWEDQCA
                     SKDQLNVEQVSSMGVDLLEFSDQGVIPEQESLKPTTASGRLELWQKKLLDLSLRNKLL
                     NFKLNGSSALVLICPDPGLLEDKLAQKMKLSIESLPEMGSSNNGRDAQLHTQRTGGGL
                     IEEFVTKALEKNQLYVQEEKEALDKRLTSLFRRSKADLDEGGANTLYLALGFLIWWRS
                     NDPNKKYYAPLILIPVTLERKSIQSGVRMVLHEDEPRFNTTLLQMLRQDFRLEIPGLE
                     GELPTDTHGVDVHGIWHKVRHHVRDVEGFEVVEEVALSNFSFAKYLMWKDLVDRTEQL
                     KENRVVRHLLETPQQSYASDISFREPRNLDNEVKPQDLLTPLPADSSQQTAVMASGEG
                     KDFIVIGPPGTGKSQTIANMIAHNLGLGRTVLFVSEKAAALNVVYRRLKEQGLGEFCL
                     ELHSNKARKLEVLNQFDQAWRSKSSFSQVEWQREANRLKETRDGLNRYVQAMHQPSRH
                     GMTPYQAIGKIALGDTVVQLELSFAHADIHDHADYVALTELCHKMDLYSKDLGSVVAH
                     ELAFVTHDDWTPQWVKDLLASAHLLKEQADRFQQSIKDLYLLFGYPDHSITILEPLLA
                     LIGTMQDLYEQDASFLFEPNTTQIVQQLDVGMRCVQEFTDEQDQLSCCYQLEGLLALD
                     IDALTKQWQESQQAWWLRGWFIKRRVNKALKYMGGAVGQPQPHRDLPRIKQMKKKYQQ
                     LQELDAVNTCVRHWRGLESDLAVIQRLVKGGQQVKARIQEIAPTPTEFVTLQTVVQRW
                     LIESNTLLAPNGTLLTLSARVKEQRQQLMETYNRVISLTGGEVDEFLPLGVLFGRAQT
                     YAATLIQNESKLNTWCRWQAVRKEACAQGLRPLVEAMEKGLCKTGKAEQVFEINYARW
                     WIHLVFAKEPDLRQFSAVEHEDKIRIFRMLDERFSELTREYICAKQGANIPDQSGVTQ
                     SSEYGVLKRELHKKIRHKPVRQLFREIPNVVKQLTPCLLMSPLSIAQYLPTEKENFDL
                     VIFDEASQITVWDAIGSLARGKQVVIAGDPKQLPPTSFFGRREAEDEGDDTGDVTDLE
                     SILDEMMGCSIPQIHLNWHYRSAHESLIAFSNQRYYMNKLITFPSAVTVDRALRLVTV
                     EGYYDRGGARHNRAEAEAIVTEVVRRLNDPNFAGAGKSIGVVTFNSEQQRLIEDLLDR
                     ARRDDPALEPYFADEQLEPVIVKNLESVQGDERDLILFSVTYGPDRAGHMTMNFGPLN
                     KQGGERRLNVAITRARSELIVFSTLKPEQMDLSRTQANGVVDLKDFLRYADRGKMALD
                     EVSHGSIGGYDSPFEEAVSEALTRKGWRVHSQIGVSAFRIDLGIVHPQREGHYFVGVE
                     CDGATYHSSATARDRDKVREAILERLGWRLVRVWSLDWWVNPKDTLEKLDQRIQAILA
                     EVDIQIAREEEIRKTAEEAFYQAKQAATAALFEENGAKLKAESATIGELSQTSTTDAK
                     VLQVRSMQADKEDRSYYRIATFEKLNLKLNPDLFYEYSYTPTVRMMVEHILEIESPIR
                     EDLLIRRIAQAHGFKRSGRLIVERVMQIVEETAEVTHEEGVGNFLWKRGVDLSSWSEI
                     RYPQQGEREARRPDEIAIQELMTLAKEHQGEGALIDTMARSLGVFRLNERNRTRLQLA
                     AQMATKSAPVEPAVL"
     misc_feature    366468..366989
                     /locus_tag="Mmc1_0317"
                     /note="Protein of unknown function (DUF4011); Region:
                     DUF4011; pfam13195"
                     /db_xref="CDD:257563"
     misc_feature    367380..367559
                     /locus_tag="Mmc1_0317"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    <368961..370172
                     /locus_tag="Mmc1_0317"
                     /note="Superfamily I DNA and RNA helicases and helicase
                     subunits [DNA replication, recombination, and repair];
                     Region: COG1112"
                     /db_xref="CDD:224037"
     misc_feature    369519..370049
                     /locus_tag="Mmc1_0317"
                     /note="AAA domain; Region: AAA_12; pfam13087"
                     /db_xref="CDD:257490"
     misc_feature    370176..370445
                     /locus_tag="Mmc1_0317"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00277"
                     /db_xref="CDD:260319"
     misc_feature    order(370200..370202,370278..370280,370329..370331,
                     370335..370337)
                     /locus_tag="Mmc1_0317"
                     /note="putative active site [active]"
                     /db_xref="CDD:238508"
     misc_feature    370770..370925
                     /locus_tag="Mmc1_0317"
                     /note="Protein of unknown function (DUF3320); Region:
                     DUF3320; pfam11784"
                     /db_xref="CDD:204742"
     gene            complement(371461..371931)
                     /locus_tag="Mmc1_0318"
                     /db_xref="GeneID:4481735"
     CDS             complement(371461..371931)
                     /locus_tag="Mmc1_0318"
                     /note="KEGG: mta:Moth_2336 transposase IS66"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS66"
                     /protein_id="YP_864251.1"
                     /db_xref="GI:117923634"
                     /db_xref="GeneID:4481735"
                     /translation="MEKDLREEEATPERRYKVRQERSRPIIDELKTWLEDNRAGVLPK
                     SKLGEAMGYLTNQWSSLIRYLDDGRLEIDNNRAENAIRPFVIGRKNWLFSNSVRGAKA
                     SANLYSLIETAKANGWEPFVYLTKVFEGLATAQTVDEFDLLLPWNLKSAAEPAG"
     misc_feature    complement(371626..>371928)
                     /locus_tag="Mmc1_0318"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     misc_feature    complement(371491..371610)
                     /locus_tag="Mmc1_0318"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:258097"
     gene            372074..372415
                     /locus_tag="Mmc1_0319"
                     /db_xref="GeneID:4481736"
     CDS             372074..372415
                     /locus_tag="Mmc1_0319"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864252.1"
                     /db_xref="GI:117923635"
                     /db_xref="GeneID:4481736"
                     /translation="MEDKSIEASVLSEKQRYWLDHLRSCRSEVGTIKEYAEVHKLSLP
                     SLYFWKRKLTQMGFLEESGSGKRRFQRLELSSKSSAGVCRIQFPNGMTVEWSGNGGES
                     LLSVLRSVAAL"
     gene            372415..372774
                     /locus_tag="Mmc1_0320"
                     /db_xref="GeneID:4481737"
     CDS             372415..372774
                     /locus_tag="Mmc1_0320"
                     /note="PFAM: IS66 Orf2 family protein;
                     KEGG: rme:Rmet_1275 IS66 Orf2 like"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 Orf2 family protein"
                     /protein_id="YP_864253.1"
                     /db_xref="GI:117923636"
                     /db_xref="InterPro:IPR008878"
                     /db_xref="GeneID:4481737"
                     /translation="MMRPSPDISVVHLCLEPVDFRKGINGLAALVEAELELNPFDEAL
                     FVFRNRSLDKVKILYWERNGFCLWQKRLEKDRFHWLRQGGAAEIQITGRQLNWLLDGY
                     NLAAMKGHNKLHFSSIV"
     misc_feature    372445..372744
                     /locus_tag="Mmc1_0320"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:253347"
     misc_feature    <372460..>372717
                     /locus_tag="Mmc1_0320"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     gene            372810..374390
                     /locus_tag="Mmc1_0321"
                     /db_xref="GeneID:4481738"
     CDS             372810..374390
                     /locus_tag="Mmc1_0321"
                     /note="PFAM: transposase IS66;
                     KEGG: ppu:PP3985 ISPpu13, transposase Orf2"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS66"
                     /protein_id="YP_864254.1"
                     /db_xref="GI:117923637"
                     /db_xref="InterPro:IPR004291"
                     /db_xref="GeneID:4481738"
                     /translation="MKTLPKTLPDDPAALREIILSLQAENVLLQDKSKRMEHEAQLLR
                     EKLNILIAKRFGRSSEKSDPRQLGLFDEAEVTAAEEPEEDAEEIQVPAHSRKVKSKGR
                     KPLPEWLPRVDIIHELPESALVCGLDGHHLVEIGRETSEQLDIIPAKVQVLRHIQIKY
                     GCPHCKQGVKTAPTPKRPIPKALATAALLAHVAVSKYADGLPLYRQGAILTRAGIDVC
                     RTTLANWMIQCGQLVQPLINLMRDKMLDYDILQMDETTIQVLKEKDKVAASNSYMWVQ
                     RGGPPGSPVILFDYDPTRGAEVPKRLLAGYKGWLQTDGYAGYLGVGAQEDVILMGCFA
                     HARRQFDEAIKALGKSKKGKIGKAGQALSLIRKLYAVEKDLREEEATPERRYKVRQER
                     SRPIIDELKTWLEDNRAGVLPKSKLGEAMGYLTNQWSSLIRYLDDGRLEIDNNRAENA
                     IRPFVIGRKNWLFSNSVRGAKASANLYSLIETAKANGWEPFVYLTKVFEGLATAQTVD
                     EFDLLLPWNLKSAAEPAG"
     misc_feature    372930..373151
                     /locus_tag="Mmc1_0321"
                     /note="Transposase C of IS166 homeodomain; Region:
                     LZ_Tnp_IS66; pfam13007"
                     /db_xref="CDD:257454"
     misc_feature    373092..373547
                     /locus_tag="Mmc1_0321"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    373179..373307
                     /locus_tag="Mmc1_0321"
                     /note="zinc-finger binding domain of transposase IS66;
                     Region: zf-IS66; pfam13005"
                     /db_xref="CDD:257452"
     misc_feature    373380..374225
                     /locus_tag="Mmc1_0321"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     misc_feature    <373485..>373628
                     /locus_tag="Mmc1_0321"
                     /note="Prp18 domain; Region: Prp18; pfam02840"
                     /db_xref="CDD:251567"
     misc_feature    374241..374360
                     /locus_tag="Mmc1_0321"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:258097"
     gene            complement(374290..375474)
                     /locus_tag="Mmc1_0322"
                     /db_xref="GeneID:4481739"
     CDS             complement(374290..375474)
                     /locus_tag="Mmc1_0322"
                     /note="PFAM: transposase IS66;
                     KEGG: ppu:PP3985 ISPpu13, transposase Orf2"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS66"
                     /protein_id="YP_864255.1"
                     /db_xref="GI:117923638"
                     /db_xref="InterPro:IPR004291"
                     /db_xref="GeneID:4481739"
                     /translation="MKTLPKTLPDDPAALREIILSLQAENVLLQDKSKRMEHEAQLLR
                     EKLNILIAKRFGRSSEKSDPRQLGLFDEAEVTAAEEPEEDAEEIQVPAHSRKVKSKGR
                     KPLPEWLPRVDIIHELPESALVCGLDGHHLVEIGRETSEQLDIIPAKVQVLRHIQIKY
                     GCPHCKQGVKTAPTPKRPIPKALATAALLAHVAVSKYADGLPLYRQGAILTRAGIDVC
                     RTTLANWMIQCGQLVQPLINLMRDKMLDYDILQMDETTIQVLKEKDKVAASNSYMWVQ
                     RGGPPGSPVILFDYDPTRGAEVPKRLLAGYKGWLQTDGYAGYLGVGAQEDVILMGCFA
                     HARRQFDEAIKALGKSKKGVSAHLSPSTTLPVQQQISNSTGATSRTHPRFALWRGPQR
                     PL"
     misc_feature    complement(375133..375354)
                     /locus_tag="Mmc1_0322"
                     /note="Transposase C of IS166 homeodomain; Region:
                     LZ_Tnp_IS66; pfam13007"
                     /db_xref="CDD:257454"
     misc_feature    complement(374737..375192)
                     /locus_tag="Mmc1_0322"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    complement(374977..375105)
                     /locus_tag="Mmc1_0322"
                     /note="zinc-finger binding domain of transposase IS66;
                     Region: zf-IS66; pfam13005"
                     /db_xref="CDD:257452"
     misc_feature    complement(<374431..374904)
                     /locus_tag="Mmc1_0322"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     misc_feature    complement(<374656..>374799)
                     /locus_tag="Mmc1_0322"
                     /note="Prp18 domain; Region: Prp18; pfam02840"
                     /db_xref="CDD:251567"
     gene            complement(375510..375869)
                     /locus_tag="Mmc1_0323"
                     /db_xref="GeneID:4481740"
     CDS             complement(375510..375869)
                     /locus_tag="Mmc1_0323"
                     /note="PFAM: IS66 Orf2 family protein;
                     KEGG: rme:Rmet_1275 IS66 Orf2 like"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 Orf2 family protein"
                     /protein_id="YP_864256.1"
                     /db_xref="GI:117923639"
                     /db_xref="InterPro:IPR008878"
                     /db_xref="GeneID:4481740"
                     /translation="MMRPSPDISVVHLCLEPVDFRKGINGLAALVEAELELNPFDEAL
                     FVFRNRSLDKVKILYWERNGFCLWQKRLEKDRFHWLRQGGAAEIQITGRQLNWLLDGY
                     NLAAMKGHNKLHFSSIV"
     misc_feature    complement(375540..375839)
                     /locus_tag="Mmc1_0323"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:253347"
     misc_feature    complement(<375567..>375824)
                     /locus_tag="Mmc1_0323"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     gene            complement(375869..376210)
                     /locus_tag="Mmc1_0324"
                     /db_xref="GeneID:4481741"
     CDS             complement(375869..376210)
                     /locus_tag="Mmc1_0324"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864257.1"
                     /db_xref="GI:117923640"
                     /db_xref="GeneID:4481741"
                     /translation="MEDKSIEASVLSEKQRYWLDHLRSCRSEVGTIKEYAEVHKLSLP
                     SLYFWKRKLTQMGFLEESGSGKRRFQRLELSSKSSAGVCRIQFPNGMTVEWSGNGGES
                     LLSVLRSVAAL"
     gene            376296..376529
                     /locus_tag="Mmc1_0325"
                     /pseudo
                     /db_xref="GeneID:4481742"
     gene            complement(376826..378067)
                     /locus_tag="Mmc1_0326"
                     /db_xref="GeneID:4481743"
     CDS             complement(376826..378067)
                     /locus_tag="Mmc1_0326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864258.1"
                     /db_xref="GI:117923641"
                     /db_xref="GeneID:4481743"
                     /translation="MARDNFTQKQLDNIKSQLAKTLGDQSSTALENLDNRFTAREEEV
                     IIEANPDVMDDHSATGGFKPGAKIDVDEVIAEGKLGPMLGTLGPLVKIEEKKADLRRM
                     VEAIINHPEIKAFNLVEALTRVRKNSEMVGLLVDQVVARKGINPLIDSLKVSGINKPA
                     MQKLAAGIAEMGTINHLLRAIASCPKNQEEVEITLTMEVIGKGALEQMLEAIKLIDPM
                     SPGAVVLATGVANVKNLPVEPCVRALTAVKDNEGGAQILAKRLVEMVEVPALVSLLEK
                     YVSETTPAAHVVVTQLIHKVMIQPSRNKELIKATKAVRGDSMPAQMLATAIVKFCDKD
                     DWERTFLRVAGHNSKVILACAYGKQGGMFGTIRKLGKAGYDMSKNAAEANKLMKEAWD
                     RCTEVARDVLQVELGKSSDDE"
     gene            378341..378982
                     /locus_tag="Mmc1_0327"
                     /db_xref="GeneID:4481744"
     CDS             378341..378982
                     /locus_tag="Mmc1_0327"
                     /note="PFAM: 3'-5' exonuclease;
                     KEGG: rbe:RBE_0748 ribonuclease D"
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="YP_864259.1"
                     /db_xref="GI:117923642"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="GeneID:4481744"
                     /translation="MGTAPLTIHTFIDDLDEAQFQRYMKSPFLAVDTETMGLDINRDR
                     LCVVQMCDVTGEVSVVQIRNYQAPRLKALMEAPEVEKIFHFARFDLATMKRWLDIEIK
                     PVFCTKIASKLVRTYTGSHGLKDVSQELLGVVMDKQQQSSDWGAEQLTPEQLQYAASD
                     VIHLVEIRARLVEMLAREGRLQLADEIMRFLPTRVALDLLGWNNHDIFSHASI"
     misc_feature    378362..>378961
                     /locus_tag="Mmc1_0327"
                     /note="Ribonuclease D [Translation, ribosomal structure
                     and biogenesis]; Region: Rnd; COG0349"
                     /db_xref="CDD:223426"
     misc_feature    378401..378919
                     /locus_tag="Mmc1_0327"
                     /note="DEDDy 3'-5' exonuclease domain of Ribonuclease D
                     and similar proteins; Region: RNaseD_exo; cd06142"
                     /db_xref="CDD:176654"
     misc_feature    order(378434..378445,378590..378595,378599..378607,
                     378704..378709,378806..378808,378818..378820)
                     /locus_tag="Mmc1_0327"
                     /note="putative active site [active]"
                     /db_xref="CDD:176654"
     misc_feature    order(378434..378436,378440..378442,378605..378607,
                     378806..378808,378818..378820)
                     /locus_tag="Mmc1_0327"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176654"
     misc_feature    order(378437..378445,378590..378595,378599..378604,
                     378704..378709,378806..378808,378818..378820)
                     /locus_tag="Mmc1_0327"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176654"
     gene            378995..379738
                     /locus_tag="Mmc1_0328"
                     /db_xref="GeneID:4481745"
     CDS             378995..379738
                     /locus_tag="Mmc1_0328"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: rsp:RSP_1075 short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_864260.1"
                     /db_xref="GI:117923643"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:4481745"
                     /translation="MDTTGCRALVTGAGRRIGAAIALALGEAGMDVAVHYSGSAQGAE
                     QSCAALAKMGRRACAFQADLSDWAQAEALLPRVVAQMGPVRVLVNSAAIFERSDLVDQ
                     SQAQWRRHMAINLEAPMLLMQHFARQWQSDQPPDGAGRIVNILDRRVLAPPPGHLAYN
                     AAKGALWSLTRVAARELAPHITVNGVGPGPILPAAGEPLEQFAKVIAATPMQRSGTPQ
                     EVADAVLYFIQNGFVTGQMICIDGGEHLL"
     misc_feature    378995..379732
                     /locus_tag="Mmc1_0328"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK09134"
                     /db_xref="CDD:236389"
     misc_feature    379016..379723
                     /locus_tag="Mmc1_0328"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(379028..379030,379034..379039,379043..379045,
                     379100..379108,379262..379270,379424..379432,
                     379469..379471,379481..379483,379556..379567)
                     /locus_tag="Mmc1_0328"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(379334..379336,379430..379432,379469..379471,
                     379481..379483)
                     /locus_tag="Mmc1_0328"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            379735..380115
                     /locus_tag="Mmc1_0329"
                     /db_xref="GeneID:4481746"
     CDS             379735..380115
                     /locus_tag="Mmc1_0329"
                     /note="TIGRFAM: dihydroneopterin aldolase;
                     KEGG: mca:MCA2988 dihydroneopterin aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="YP_864261.1"
                     /db_xref="GI:117923644"
                     /db_xref="InterPro:IPR006156"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="GeneID:4481746"
                     /translation="MTMHNQPPLDRIHIKDLLLRCIIGILEWERTTLQDVVINCTLHV
                     DLRSAGLSDDIADTVNYKALNKNIIQLVEGSAFFLVEAMAEAIAELCLQDRRVKQCEV
                     TVEKPGALRFARSVGVTVVRGQHG"
     misc_feature    379762..380103
                     /locus_tag="Mmc1_0329"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(379762..379794,379810..379836,380056..380061,
                     380068..380094)
                     /locus_tag="Mmc1_0329"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(379804..379812,379819..379821,379966..379977,
                     380050..380052,380086..380088)
                     /locus_tag="Mmc1_0329"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            380144..380692
                     /locus_tag="Mmc1_0330"
                     /db_xref="GeneID:4481747"
     CDS             380144..380692
                     /locus_tag="Mmc1_0330"
                     /note="TIGRFAM:
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     pyrophosphokinase;
                     PFAM: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase,
                     HPPK;
                     KEGG: cyb:CYB_2920
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     pyrophosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="YP_864262.1"
                     /db_xref="GI:117923645"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="GeneID:4481747"
                     /translation="MVPCDGPVLVAFGASLNPLYHLELGLRRLHALLGIVAISDVYQS
                     RPVNGAVGDPPFLNGAVRLEQAPEPWALRALLRQIEAEQGRERGDNPNAPRTLDLDIA
                     LMGSQIMDEPLLRIPDPHWLARPFVALPMAQLAAAWRHPEHPYSLAQLAARFDPLPVG
                     MHKDLEATRRLRQILPPFPNTV"
     misc_feature    380165..380545
                     /locus_tag="Mmc1_0330"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK). Folate derivatives are essential cofactors in the
                     biosynthesis of purines, pyrimidines, and amino acids as
                     well as formyl-tRNA. Mammalian cells are able to utilize
                     pre-formed folates after...; Region: HPPK; cd00483"
                     /db_xref="CDD:238269"
     misc_feature    order(380180..380182,380273..380278,380282..380284,
                     380309..380311,380315..380317,380360..380362,
                     380372..380374,380381..380383,380396..380398,
                     380402..380404,380417..380419,380426..380428,
                     380435..380437,380441..380446,380486..380488,
                     380495..380500,380513..380515,380519..380521)
                     /locus_tag="Mmc1_0330"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    order(380360..380362,380372..380374,380381..380383,
                     380396..380398,380402..380404,380426..380428,
                     380441..380446,380486..380488,380495..380500,
                     380513..380515)
                     /locus_tag="Mmc1_0330"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            380721..383252
                     /locus_tag="Mmc1_0331"
                     /db_xref="GeneID:4481748"
     CDS             380721..383252
                     /locus_tag="Mmc1_0331"
                     /note="TIGRFAM: PAS sensor protein;
                     PFAM: extracellular solute-binding protein, family 3;
                     response regulator receiver; ATP-binding region, ATPase
                     domain protein domain protein; histidine kinase A domain
                     protein domain protein;
                     KEGG: mag:amb1110 signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor hybrid histidine kinase"
                     /protein_id="YP_864263.1"
                     /db_xref="GI:117923646"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4481748"
                     /translation="MGYDAKLPWGWAPLLVCLVVLAWPAQLLANRVPDPIIVGVYQNK
                     PMIFLDEKGEVQGLYKDILGIIAERHGWQLEYRYGKWSALLEQLQRGEIDLLGAIAYS
                     DERALSMDFGKQSFFVNWGQVYTREERKVASFLDLQGKRVGVLKGDIYGHRLAELVKK
                     FGVSIEIVGYDSYSYVLHGIKQGEVDAGVVNRLTGGAEQQRFGLYGTPILFNPVEVTV
                     AVPKGKNMALLSAIEHDLVVMKADKDSAFHKAFDRWLGIASKPEMPSWYRTGFWIIMV
                     LMLLGVGWNLSLQRRVVLQAKRLEQEVAERQDAEQGLQHAHQELEQRVDERTQALEVS
                     ELRFRTLFHAALVPLFRSSLDGGRVLLANLALVELFGYSSVEEMVTLHDPLKSYADPL
                     MREHFIDILVRDGRVECLDVELVRPDSSRFYAEISAIHYPEGGYLEGAIIDITHRKRT
                     EHALIQAKQSAERANRAKSEFLATLSHEIRTPLNGMIGLLTALQASRLDAKQQEQVGL
                     ISRSSNLLLDLLNDILDFSKIEAGELVLEQIPFSPLQLVEDVCACLSERAQGKGVGLR
                     LETHGWIPPGLKGDAVRIRQIMLNLTNNAIKFTQQGEVVLHLWGLEQQPVPLPSWVSM
                     RFGVVDSGVGIAAKDMGRIFDPFCQADRVLDRRYKGTGLGLSICKRLVEAMGGEIWAE
                     SQEGQGSSFRFTLTLALVEHLPGQAMGRELVHEVLPMRILLVEDDPVNQMVAVELLES
                     AGHKVEVADNGASGLVKAQECSYDLVLMDIRMPGMDGITATRMLRAFEQAEGRERVPV
                     LGLTADTLKETLLACREAGMDDVLTKPVRVNVLTDRVARLGFENP"
     misc_feature    380826..381485
                     /locus_tag="Mmc1_0331"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    380826..381485
                     /locus_tag="Mmc1_0331"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     misc_feature    order(380847..380849,380961..380963,381033..381035,
                     381165..381167,381291..381293)
                     /locus_tag="Mmc1_0331"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(381240..381242,381252..381254,381270..381272)
                     /locus_tag="Mmc1_0331"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    381354..381371
                     /locus_tag="Mmc1_0331"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     misc_feature    381729..381923
                     /locus_tag="Mmc1_0331"
                     /note="PAS domain; Region: PAS_8; pfam13188"
                     /db_xref="CDD:257556"
     misc_feature    381783..382805
                     /locus_tag="Mmc1_0331"
                     /note="phosphate regulon sensor kinase PhoR; Region:
                     phoR_proteo; TIGR02966"
                     /db_xref="CDD:234074"
     misc_feature    382113..>382259
                     /locus_tag="Mmc1_0331"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(382131..382133,382143..382145,382155..382157,
                     382164..382166,382176..382178,382185..382187,
                     382233..382235,382245..382247,382254..382256)
                     /locus_tag="Mmc1_0331"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    382149..382151
                     /locus_tag="Mmc1_0331"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    382470..382805
                     /locus_tag="Mmc1_0331"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(382488..382490,382500..382502,382509..382511,
                     382602..382604,382608..382610,382614..382616,
                     382620..382625,382704..382715,382761..382763,
                     382767..382769,382782..382787,382791..382793)
                     /locus_tag="Mmc1_0331"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    382500..382502
                     /locus_tag="Mmc1_0331"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(382614..382616,382620..382622,382704..382706,
                     382710..382712)
                     /locus_tag="Mmc1_0331"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    382875..>383225
                     /locus_tag="Mmc1_0331"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    382884..383234
                     /locus_tag="Mmc1_0331"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(382893..382898,383025..383027,383049..383051,
                     383124..383126,383181..383183,383190..383195)
                     /locus_tag="Mmc1_0331"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    383025..383027
                     /locus_tag="Mmc1_0331"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(383034..383039,383043..383051)
                     /locus_tag="Mmc1_0331"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    383190..383198
                     /locus_tag="Mmc1_0331"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(383425..384834)
                     /locus_tag="Mmc1_0332"
                     /db_xref="GeneID:4481749"
     CDS             complement(383425..384834)
                     /locus_tag="Mmc1_0332"
                     /EC_number="5.4.2.8"
                     /note="PFAM: phosphoglucomutase/phosphomannomutase C
                     terminal; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain I;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain II; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain III;
                     KEGG: gox:GOX0044 phosphomannomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="YP_864264.1"
                     /db_xref="GI:117923647"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="GeneID:4481749"
                     /translation="MTFAPSHMFREYDVRGIAHSELSEEVVKHWGALFAERIRDAYKG
                     KKFMPHVVVGRDGRLSSPALANALMAGLAEAGARVSDVGLLPTPGLYYASHALHADGA
                     IMVTGSHNPAEYNGMKMMLGGLSFFGQDIQDLAQRLMLGERPMPRMGGSVSRVELRRD
                     YINRLVADYRPGRPLKVVLDCGNGAAGAVAKELLQALPGIEGEVLFAEVDGTFPNHHP
                     DPTVPANLEDLKNRVLAWGADLGIAFDGDGDRIGAIDGDGRVIWGDRLMILFAREILA
                     EHPGASILGDVKCSQQLFDAVAEAGGKPIMWKTGHSLVKSKMRQSGALLAGEMSGHLF
                     FADRYYGYDDALYAAVRLISLLAAEPTSLAARLSSLPKVYATPELRIECADSRKFRVM
                     DRIKRQVLDGGLGEVSDLDGVRVKQPGGWWLVRVSNTQPALVARVEADSLERLQEMAT
                     ALAKMLEGENVVFPEWQLV"
     misc_feature    complement(383458..384834)
                     /locus_tag="Mmc1_0332"
                     /note="Phosphomannomutase [Carbohydrate transport and
                     metabolism]; Region: {ManB}; COG1109"
                     /db_xref="CDD:224034"
     misc_feature    complement(383467..384813)
                     /locus_tag="Mmc1_0332"
                     /note="The phosphomannomutase/phosphoglucomutase (PMM/PGM)
                     bifunctional enzyme catalyzes the reversible conversion of
                     1-phospho to 6-phospho-sugars (e.g. between
                     mannose-1-phosphate and mannose-6-phosphate or
                     glucose-1-phosphate and glucose-6-phosphate) via a...;
                     Region: PMM_PGM; cd03089"
                     /db_xref="CDD:100091"
     misc_feature    complement(order(383548..383556,383560..383562,
                     383839..383841,383845..383847,383851..383853,
                     383902..383910,383971..383973,384085..384090,
                     384094..384096,384100..384102,384481..384483,
                     384505..384513,384790..384792,384799..384801,
                     384805..384807))
                     /locus_tag="Mmc1_0332"
                     /note="active site"
                     /db_xref="CDD:100091"
     misc_feature    complement(order(383548..383556,383560..383562,
                     383839..383841,383845..383847,383851..383853,
                     383902..383904,383908..383910,383971..383973,
                     384085..384087,384511..384513,384790..384792,
                     384799..384801))
                     /locus_tag="Mmc1_0332"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100091"
     misc_feature    complement(order(384088..384090,384094..384096,
                     384100..384102,384511..384513))
                     /locus_tag="Mmc1_0332"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100091"
     gene            complement(384839..386155)
                     /locus_tag="Mmc1_0333"
                     /db_xref="GeneID:4482863"
     CDS             complement(384839..386155)
                     /locus_tag="Mmc1_0333"
                     /EC_number="1.1.1.22"
                     /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
                     KEGG: rru:Rru_A2116 UDP-glucose 6-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="YP_864265.1"
                     /db_xref="GI:117923648"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR001732"
                     /db_xref="GeneID:4482863"
                     /translation="MRITMIGTGYVGLVSGACFSEFGVDVTCVDKDVSKIERLNKGEI
                     PIFEPGLDQLVVRNKDAGRLHFTTDTNTAVANSDVVFIAVGTPERRGDGAADLRYVFD
                     AARDVARAMQGFTVVVTKSTVPVGTGARVAEIIRETKPDADFAMASNPEFLREGSAIE
                     DFMRPDRVVVGVDSDRPVALLKELYRPLYLIETPILFTNIATAELTKYAGNAFLATKI
                     MFINQIANLCEKVGADVHDVAKGMGLDRRIGRKFLHPGPGYGGSCFPKDTAALANTAR
                     DHNTPMTIVENVIEANKWQKQRMITKIRDAMQGKLRGKTIGVLGLTFKPNTDDMRDSS
                     SLTILPALAGDGARIQAFDPEGMHEAKRMMPELHYCDDAYSACQGADAVVILTEWNQF
                     RNLDLDRIKAGMQTDSEGLYPFFDLRNIYVPADMRAQGFAYVGVGR"
     misc_feature    complement(384893..386155)
                     /locus_tag="Mmc1_0333"
                     /note="Predicted UDP-glucose 6-dehydrogenase [Cell
                     envelope biogenesis, outer membrane]; Region: Ugd;
                     COG1004"
                     /db_xref="CDD:223936"
     misc_feature    complement(385604..386155)
                     /locus_tag="Mmc1_0333"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    complement(385271..385558)
                     /locus_tag="Mmc1_0333"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    complement(384893..385207)
                     /locus_tag="Mmc1_0333"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            complement(386473..387144)
                     /locus_tag="Mmc1_0334"
                     /db_xref="GeneID:4482864"
     CDS             complement(386473..387144)
                     /locus_tag="Mmc1_0334"
                     /note="PFAM: methyltransferase type 11;
                     KEGG: mca:MCA1151 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_864266.1"
                     /db_xref="GI:117923649"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:4482864"
                     /translation="MASLTAMSTSKPAPASHWIQYGCGLDAPAGWLNFDASPTLRLQR
                     LALIGALFQYRTPFPPTVRYGDIVRGLPVADACAEGLYCSHVLEHLSADDVATALRHS
                     YQILRPGGTFRLVLPDLAHMVRGYLQATDAMACQQFMRDSGVLINKRSHGLKSFLITW
                     FGNSTHLSLWDYAGMAHMLEQAGFMEIRPARCGDSGLTQFNQVENPNRWENALGIACR
                     RPTHR"
     misc_feature    complement(<386764..>386934)
                     /locus_tag="Mmc1_0334"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4627"
                     /db_xref="CDD:226975"
     misc_feature    complement(386593..>386898)
                     /locus_tag="Mmc1_0334"
                     /note="Methyltransferase domain; Region: Methyltransf_23;
                     pfam13489"
                     /db_xref="CDD:257813"
     gene            complement(387132..388013)
                     /locus_tag="Mmc1_0335"
                     /db_xref="GeneID:4482865"
     CDS             complement(387132..388013)
                     /locus_tag="Mmc1_0335"
                     /EC_number="2.7.7.9"
                     /note="TIGRFAM: UTP-glucose-1-phosphate
                     uridylyltransferase;
                     PFAM: nucleotidyl transferase;
                     KEGG: dps:DPPB68 probable UTP-glucose-1-phosphate
                     uridylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose pyrophosphorylase"
                     /protein_id="YP_864267.1"
                     /db_xref="GI:117923650"
                     /db_xref="InterPro:IPR005771"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="GeneID:4482865"
                     /translation="MMKVRKAVFPVAGLGTRFLPATKVVPKEMLSVVDTPLIQYAVEE
                     AWDAGIEEVILITGRGKSLLMDQFDHMYELEDTLRRQGKEVLLSVSHEPIPFPGTVVA
                     TRQQDPLGLGHAVWCARYLVGDEPFAVILPDDLVHAQKPVLKQMVERFEELQSSIVAV
                     MEVAPDQTNKYGILDSEPEQNGVWRIKGLVEKPDPSVSPSNLAIIGRYILTPEIFCLL
                     ESIPRGAGGEIQLTDAMAALLKHQSIYGMRFEGTRFDCGDKAGFQMASLALSMERPEL
                     KDQMLAFIQENLPKWQA"
     misc_feature    complement(387198..388001)
                     /locus_tag="Mmc1_0335"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    complement(387216..388001)
                     /locus_tag="Mmc1_0335"
                     /note="dTDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: RfbA; COG1209"
                     /db_xref="CDD:224130"
     misc_feature    complement(order(387318..387320,387402..387404,
                     387438..387443,387498..387503,387612..387617,
                     387621..387623,387681..387692,387699..387701,
                     387930..387935,387975..387986))
                     /locus_tag="Mmc1_0335"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    complement(order(387198..387203,387210..387218,
                     387222..387230,387234..387242,387258..387260,
                     387330..387332,387504..387506,387690..387692,
                     387696..387698,387702..387707,387792..387797,
                     387807..387809,387813..387821,387825..387827,
                     387897..387899,387909..387917,387921..387929,
                     387939..387947,387951..387965,387972..387974))
                     /locus_tag="Mmc1_0335"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            complement(388146..388535)
                     /locus_tag="Mmc1_0336"
                     /db_xref="GeneID:4482866"
     CDS             complement(388146..388535)
                     /locus_tag="Mmc1_0336"
                     /note="KEGG: rba:RB11276 hypothetical
                     protein-transmembrane region and signal peptide
                     prediction"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane region and signal peptide
                     prediction"
                     /protein_id="YP_864268.1"
                     /db_xref="GI:117923651"
                     /db_xref="GeneID:4482866"
                     /translation="MANKVGMRSLLAGAALALGLMSGSAVASEMQEMTFKEDVYPIIT
                     YRCLECHVQGGPGMVYSGLDLQSYEGLMRGTKHGPVVVAGKPMLSNLLVLVSGKAGIR
                     MPHNRRRLTKCEIDIISKWIQQGAKNN"
     misc_feature    complement(388224..388397)
                     /locus_tag="Mmc1_0336"
                     /note="Planctomycete cytochrome C; Region: PSCyt1;
                     pfam07635"
                     /db_xref="CDD:254321"
     gene            389056..390300
                     /locus_tag="Mmc1_0337"
                     /db_xref="GeneID:4482867"
     CDS             389056..390300
                     /locus_tag="Mmc1_0337"
                     /EC_number="4.2.1.20"
                     /note="catalyzes the formation of L-tryptophan from
                     L-serine and 1-(indol-3-yl)glycerol 3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="YP_864269.1"
                     /db_xref="GI:117923652"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR006654"
                     /db_xref="GeneID:4482867"
                     /translation="MSKGYFGAFGGAYIPEILHETFAQLTLAYETARADEAFWRHYIE
                     LMRNYSGRPTPLTFAENLSLAHGKRRIYIKREDLNQTGAHKANNVMGQGLLVRRMGKT
                     RVIAETGAGQHGVATATMAARLGLACTIYMGAKDVARQRPNVFWMEQLGATVIPVTSG
                     SQTLKDAVNEAMRDWVGSMDNTHYVLGTACGAHPFPEMVSWFQSVIGQEARVQILEQE
                     GRLPDHVYACVGGGSNAMGIFQGFLEDPQVELIGVEAGGLGLAGHNHASRIASGKSTV
                     GIAQGYKTCFLQDEDGQMRDTHSVAAGLDYVGVSPILADLHQQGRVRFEAATDVEVVE
                     ALKRMVKSEGIIPALESSHAVAGALRELPQLKEDAVVIINLSGRGDKDIFTIAEALGD
                     AKWKTYIQERAAIYAAEQGERS"
     misc_feature    389122..390213
                     /locus_tag="Mmc1_0337"
                     /note="Tryptophan synthase-beta:  Trptophan synthase is a
                     bifunctional enzyme that catalyses the last two steps in
                     the biosynthesis of L-tryptophan via its alpha and beta
                     reactions. In the alpha reaction, indole 3-glycerol
                     phosphate is cleaved reversibly to...; Region:
                     Trp-synth_B; cd06446"
                     /db_xref="CDD:107207"
     misc_feature    order(389305..389310,389389..389391,389617..389619,
                     389743..389757,390103..390105,390181..390183)
                     /locus_tag="Mmc1_0337"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107207"
     misc_feature    389308..389310
                     /locus_tag="Mmc1_0337"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107207"
     gene            390297..391076
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /db_xref="GeneID:4482868"
     CDS             390297..391076
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /EC_number="4.2.1.20"
                     /note="catalyzes the formation of indole and
                     glyceraldehyde 3-phosphate from indoleglycerol phosphate
                     in tryptophan biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="YP_864270.1"
                     /db_xref="GI:117923653"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="GeneID:4482868"
                     /translation="MSRKSALEGHIKDKLQQQDILLMSHIVLGYPSLQANREVIRAMV
                     AGGVDLMELQIPFSEPIADGPTIARANQAALDGGFKVREGLAFIREVVAAFNIPFLIM
                     TYTNILMAYGVERFIDEVADIGVKGLIIPDLPLEQAQAAIEQCRAKGMDWIGLMTPTS
                     VDERLGKIGAAADGFVYCVARRGVTGSKTSFDEHVGAFMHRCRQATPVPLAVGFGVRS
                     AEDVDYLKGKAEIAVVGSAALDLFDQAGAAALEPFFRGLRG"
     misc_feature    390357..391073
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /note="Ttryptophan synthase (TRPS) alpha subunit (TSA).
                     TPRS is a bifunctional tetrameric enzyme (2 alpha and 2
                     beta subunits) that catalyzes the last two steps of
                     L-tryptophan biosynthesis. Alpha and beta subunit catalyze
                     two distinct reactions which are both...; Region:
                     Tryptophan_synthase_alpha; cd04724"
                     /db_xref="CDD:240075"
     misc_feature    order(390450..390452,390483..390485,390495..390497,
                     390825..390827,390849..390854,390936..390941,
                     390999..391004)
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240075"
     misc_feature    order(390450..390452,390483..390485,390606..390608,
                     390849..390851)
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /note="active site"
                     /db_xref="CDD:240075"
     misc_feature    order(390450..390452,390483..390485,390606..390608)
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240075"
     misc_feature    order(390465..390476,390480..390482,390489..390491,
                     390498..390503,390612..390614,390621..390623,
                     390687..390692,390696..390698,390705..390707,
                     390765..390767,390771..390779,390786..390788)
                     /gene="trpA"
                     /locus_tag="Mmc1_0338"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240075"
     gene            complement(391210..392286)
                     /locus_tag="Mmc1_0339"
                     /db_xref="GeneID:4482869"
     CDS             complement(391210..392286)
                     /locus_tag="Mmc1_0339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864271.1"
                     /db_xref="GI:117923654"
                     /db_xref="GeneID:4482869"
                     /translation="MVKGNKIFMLVGVLWMLGIPPVQAQRPDHSSELIFKDDFERTEL
                     SGDDQQWYMTRMSGVGCGRVNPASRPVQEQGQAILQPPVQIRDGQLLLSEASSGAPVQ
                     AYRVINRPVRRIGFEFTPLNVMGGMDDRAWVGARIQFMDRNNGLLGELWYYFYNRHYE
                     RPSNTSTRYAVAVKGAFDGVKRRLSIEVEELIRRYLKGVDPDQIARTLVIFELGAGWC
                     GSEVAGTFDNVEVFAGRSEEYTLTQQEVLAIGRSVMPSFLRDHAYFPENWIRRVRAKY
                     QAKRVDRWLDAIERHMQAHPTGFVPLVERMTGVSDNQIPQTAFAVRVMVDNRKLPGLD
                     DPVQGPMTRIEEGEPTTIDLNAER"
     misc_feature    complement(<391291..>391482)
                     /locus_tag="Mmc1_0339"
                     /note="AAA domain; Region: AAA_32; pfam13654"
                     /db_xref="CDD:257962"
     gene            complement(392443..393855)
                     /locus_tag="Mmc1_0340"
                     /db_xref="GeneID:4482870"
     CDS             complement(392443..393855)
                     /locus_tag="Mmc1_0340"
                     /note="PFAM: response regulator receiver; sigma-54 factor,
                     interaction domain-containing protein; helix-turn-helix,
                     Fis-type;
                     SMART: AAA ATPase;
                     KEGG: vpa:VP2099 LuxO repressor protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component, sigma54 specific, Fis family
                     transcriptional regulator"
                     /protein_id="YP_864272.1"
                     /db_xref="GI:117923655"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4482870"
                     /translation="MMKARDLHSLLLVEDSPSMAMVYQEYIKGEPQWQVSHCKEGHAA
                     LVYLHQHTPDLVLLDLQLPDMHGLEILKAIHEQQLPTQVVIITAHGSVDTAVEATRLG
                     AFDYLEKPFSANRLLVTMGNALRQKNLSLEVQAYRDSFDRDHYHGFIGASPTMQALYQ
                     TIESAAPSSATIFITGESGTGKEVCAEAIHKASTRRNRPFIPVNCAAIPKDLMESELF
                     GHVKGSFTGALSDRQGAAQRAHHGTLFLDEIGELPLDLQSKLLRFLQTGQVQKVGAQK
                     GEVVDVRILCATNRDPWEEVQEGRFREDLYYRLNVIPLHLPPLRKRDQDVLLLAHHLL
                     QQYSREEKKGFTRFSGEAEQLILGHRWPGNVRELQNVIRHAVVLNDGTLLEAAMLPPP
                     VGGSMGRHMTVPPQNKMLLQEGATDDEILPLWVEEKRIIERALKQCGDNIPQAAARLQ
                     INPSTIYRKKQLWKSREEEA"
     misc_feature    complement(392470..393846)
                     /locus_tag="Mmc1_0340"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    complement(393484..393825)
                     /locus_tag="Mmc1_0340"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(393526..393531,393538..393540,
                     393595..393597,393655..393657,393679..393681,
                     393811..393816))
                     /locus_tag="Mmc1_0340"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(393679..393681)
                     /locus_tag="Mmc1_0340"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(393655..393663,393667..393672))
                     /locus_tag="Mmc1_0340"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(393523..393531)
                     /locus_tag="Mmc1_0340"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(392902..393411)
                     /locus_tag="Mmc1_0340"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(393307..393330)
                     /locus_tag="Mmc1_0340"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(392989..392991,393115..393117,
                     393304..393327))
                     /locus_tag="Mmc1_0340"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(393112..393129)
                     /locus_tag="Mmc1_0340"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(392932..392934)
                     /locus_tag="Mmc1_0340"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(392479..392577)
                     /locus_tag="Mmc1_0340"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            394483..396081
                     /locus_tag="Mmc1_0341"
                     /db_xref="GeneID:4482871"
     CDS             394483..396081
                     /locus_tag="Mmc1_0341"
                     /note="PFAM: sulfatase; protein of unknown function
                     DUF1705;
                     KEGG: pcr:Pcryo_1245 sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylethanolamine:Kdo2-lipid A
                     phosphoethanolamine transferase"
                     /protein_id="YP_864273.1"
                     /db_xref="GI:117923656"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR012549"
                     /db_xref="GeneID:4482871"
                     /translation="MPNLQISRPYLILLVALFICLTGNYTFFSGVLQVYPWQQHAGFF
                     VSLVVAYSAFLVLLFSLLSLLFGQRSVAIFMLILSAFIGYFSDNFGVIIDRDMLQNTL
                     ETNLSEASDLMSLGLMVRVLLLGLLPALLVGRLSLPRLGWLRGLSQTGKTMGVALLVM
                     VAALAPFNAQYFSAGREHKSLRYHANPAYPIYSVGHYIKKKYQAGKPPYTTVTTYARQ
                     AADDTSRELVIMVVGEAVRADHFSLNGYARQTNPTLAKEPRVVNFSQVSSCGTATAIS
                     VPCMFSFHGRSTYKGSTAPYTENVLDVLAKAGVHVLWLDNNSSSKGVADRVAYQDFRT
                     SANNPICDAVECRDIGMLKNLQRYIDDHKQGDILIVLHQMGNHGPAYFKRYPPEFEKF
                     KPACQTIELAQCTKQEISNAYDNAILYTDFFLGKVIELLKSNTPNFETLMVYMSDHGE
                     SLGENGIYLHGLPYFMAPASQTHVPAVIWNGPNSDLDHQELLANKDKPNSHDGLAPLL
                     LKVFEVDADLQGDLVHAPFGSAQP"
     misc_feature    394513..396033
                     /locus_tag="Mmc1_0341"
                     /note="Predicted membrane-associated, metal-dependent
                     hydrolase [General function prediction only]; Region:
                     COG2194"
                     /db_xref="CDD:225105"
     misc_feature    394693..395094
                     /locus_tag="Mmc1_0341"
                     /note="Domain of unknown function (DUF1705); Region:
                     DUF1705; pfam08019"
                     /db_xref="CDD:149223"
     misc_feature    395164..396018
                     /locus_tag="Mmc1_0341"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            396405..397034
                     /locus_tag="Mmc1_0342"
                     /db_xref="GeneID:4482872"
     CDS             396405..397034
                     /locus_tag="Mmc1_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864274.1"
                     /db_xref="GI:117923657"
                     /db_xref="GeneID:4482872"
                     /translation="MAAKGWRYPFFWMRTMFRFRLIRPMLQGGHPPEYAARASGIGLA
                     IAMTPTVGVQIAAVMALWAWIKARKPDWDFNPMVAIAWTMVTNVVTLPPIYFMFVVTG
                     RLMMGHWDGLSGYDEYTARIAQVLAPDAGWLESIWIQLHELFTTFGLPLLLGCLPWAL
                     ICGWAGYFFTLRLVRKYQALREKRRIKNYVGLYKESHPYTSSNHAGPQK"
     misc_feature    396438..396959
                     /locus_tag="Mmc1_0342"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2062); Region: DUF2062; pfam09835"
                     /db_xref="CDD:255594"
     gene            complement(397061..397525)
                     /locus_tag="Mmc1_0343"
                     /db_xref="GeneID:4482873"
     CDS             complement(397061..397525)
                     /locus_tag="Mmc1_0343"
                     /note="KEGG: dvu:DVU1136 host-nuclease inhibitor protein
                     Gam"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864275.1"
                     /db_xref="GI:117923658"
                     /db_xref="GeneID:4482873"
                     /translation="MQKTVASLDDANAALAQIANLLAQQSELASKRDQAVEQLQQRYQ
                     EPLAKIAEQLNQLQQQLTQFAQVTPELFIKKRTLSLPQGQIGKRRQSRIIPTASQTET
                     EICDAIEAQGWHEALRLQRQLNRAALRSWSAQRLAQVGLQRCVNEQVWVEPK"
     misc_feature    complement(397142..397507)
                     /locus_tag="Mmc1_0343"
                     /note="Bacteriophage Mu Gam like protein; Region:
                     Phage_Mu_Gam; cl01825"
                     /db_xref="CDD:261085"
     gene            397822..398307
                     /locus_tag="Mmc1_0344"
                     /db_xref="GeneID:4482874"
     CDS             397822..398307
                     /locus_tag="Mmc1_0344"
                     /note="SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_864276.1"
                     /db_xref="GI:117923659"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:4482874"
                     /translation="MVGQKEKRQMDRGLIERLRKAAERAGGPDAIALKVDVSRRTWGN
                     YLQGATEPTASTIKDIAKVSGLDPAWILTGVGPMERRSGDSYLDSLDEDLLFSVIYEV
                     EHFLLGEGITIGNAKDKVQLIKAVYELVQREQAHQPDKPTTAGNVIQLPHVQALMRLA
                     G"
     misc_feature    397867..398034
                     /locus_tag="Mmc1_0344"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(397876..397878,397888..397890,397960..397962)
                     /locus_tag="Mmc1_0344"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(397885..397887,397957..397959)
                     /locus_tag="Mmc1_0344"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(397903..397908,397939..397941,397948..397950,
                     397960..397965)
                     /locus_tag="Mmc1_0344"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            398658..399041
                     /locus_tag="Mmc1_0345"
                     /db_xref="GeneID:4482875"
     CDS             398658..399041
                     /locus_tag="Mmc1_0345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864277.1"
                     /db_xref="GI:117923660"
                     /db_xref="GeneID:4482875"
                     /translation="MSHSANQAEQTIQKLLSKHRSASKTDALPVKRVEDGWNSRQKKG
                     LIGTLCGLILLLGSGWFWYMHQPISPYQELLLKALIKEYAVQQSIGHQKVWVDLKRRW
                     GFYRVQDIDRQQFHEMTQYLSQPIR"
     gene            complement(399227..400585)
                     /locus_tag="Mmc1_0346"
                     /db_xref="GeneID:4482876"
     CDS             complement(399227..400585)
                     /locus_tag="Mmc1_0346"
                     /EC_number="4.2.1.20"
                     /note="catalyzes the formation of L-tryptophan from indole
                     and L-serine"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="YP_864278.1"
                     /db_xref="GI:117923661"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR006316"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="GeneID:4482876"
                     /translation="MQTKILLDESEMPTQWYNVTADMPNRPPPPLGPDGKPVTPEMMG
                     MIFPPDILQQEMSTERWIDIPDEVRQILSLWRPSPLYRAHRLEQALATPAKIYYKYEG
                     VSPAGSHKPNSAVPQAYYNKKAGIKRLTTETGAGQWGSSIAFAGQMFGLEVEVYMVKV
                     SYHQKPFRRSMMETWGAQVFASPSDRTASGRKILAQDPDSPGSLGIAISEAVELAMQD
                     PHTNYSLGSVLNHVCLHQTIIGLEAKKQFAKAGDYPDVVIGCCGGGSNFAGTAFPFLA
                     DKAAGKALRLLAMEPSSCPTLTRGHFAYDYGDVAGLTPMMMQYTLGHDFTPPGIHAGG
                     LRYHGDSSQLSQLVHDKIIEARSVNQLDTFRAGVTFAQAEGIIPAPESNHAIRGAIEE
                     ALRCKEEGKQETIFFTLSGHGHFDMTSYDRFFAGELEDYPYPQSAIEAALKHLPDPTK
                     MG"
     misc_feature    complement(399326..400447)
                     /locus_tag="Mmc1_0346"
                     /note="Tryptophan synthase-beta:  Trptophan synthase is a
                     bifunctional enzyme that catalyses the last two steps in
                     the biosynthesis of L-tryptophan via its alpha and beta
                     reactions. In the alpha reaction, indole 3-glycerol
                     phosphate is cleaved reversibly to...; Region:
                     Trp-synth_B; cd06446"
                     /db_xref="CDD:107207"
     misc_feature    complement(order(399356..399358,399443..399445,
                     399788..399802,399905..399907,400175..400177,
                     400256..400261))
                     /locus_tag="Mmc1_0346"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107207"
     misc_feature    complement(400256..400258)
                     /locus_tag="Mmc1_0346"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107207"
     gene            400801..401589
                     /locus_tag="Mmc1_0347"
                     /db_xref="GeneID:4482877"
     CDS             400801..401589
                     /locus_tag="Mmc1_0347"
                     /note="PFAM: dienelactone hydrolase;
                     KEGG: pae:PA1166 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="YP_864279.1"
                     /db_xref="GI:117923662"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="GeneID:4482877"
                     /translation="MRTYAKWMGVALALLWSVPAWAVVQEQEVPYKDGDTGLAGYLVW
                     DDAFSGKRPGVLVVHEWWGLNSYAKSRARQLARMGYIAFAADMYGEGHVTEHAKEAKG
                     WMQQVTANVEGWRRRADLALEQLKAAPQVDTTRLAAVGYCFGGGTVMQMAYGGSDLLG
                     VASFHGPLPPAEKKDYAKIKAKIFVAHGDADTFVPLERLEAFRIGLNEAGADWQLLRY
                     GGAVHSFTNPAADGSWMPTVKYDAKADHRSWAAFTHFLDELFWP"
     misc_feature    400873..401586
                     /locus_tag="Mmc1_0347"
                     /note="Dienelactone hydrolase and related enzymes
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG0412"
                     /db_xref="CDD:223489"
     misc_feature    401023..401502
                     /locus_tag="Mmc1_0347"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            complement(401760..402374)
                     /locus_tag="Mmc1_0348"
                     /db_xref="GeneID:4482878"
     CDS             complement(401760..402374)
                     /locus_tag="Mmc1_0348"
                     /note="PFAM: lytic transglycosylase, catalytic;
                     KEGG: reu:Reut_A2357 lytic transglycosylase, catalytic"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase, catalytic"
                     /protein_id="YP_864280.1"
                     /db_xref="GI:117923663"
                     /db_xref="InterPro:IPR000189"
                     /db_xref="InterPro:IPR008258"
                     /db_xref="GeneID:4482878"
                     /translation="MTRPMKPLFILALLGLLCAVPPPAAADIYAFIDADGVIHLSNRA
                     NDPRYRRLMRINSQGRRLALPQYASVPSRGGDAKRYEQTIHNIAKRFDLDAGLVKAVI
                     QAESGFDPNVVSHKGAVGLMQLMPQTARIYGVSDRTDPHENILAGSQHLRYLLDKYKN
                     NIKLTLAAYNAGEGAVERYGNRIPPFRETQNYVRKVLAFYREFR"
     misc_feature    complement(<402222..402323)
                     /locus_tag="Mmc1_0348"
                     /note="Domain of unknown function (DUF4124); Region:
                     DUF4124; pfam13511"
                     /db_xref="CDD:257831"
     misc_feature    complement(401775..>402311)
                     /locus_tag="Mmc1_0348"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(401772..402086)
                     /locus_tag="Mmc1_0348"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(401868..401870,401925..401927,
                     402000..402002,402060..402062))
                     /locus_tag="Mmc1_0348"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(402060..402062)
                     /locus_tag="Mmc1_0348"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(402539..403135)
                     /locus_tag="Mmc1_0349"
                     /db_xref="GeneID:4482879"
     CDS             complement(402539..403135)
                     /locus_tag="Mmc1_0349"
                     /note="PFAM: peptidyl-prolyl cis-trans isomerase,
                     cyclophilin type;
                     KEGG: par:Psyc_0693 peptidyl-prolyl cis-trans isomerase,
                     cyclophilin type"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclophilin type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="YP_864281.1"
                     /db_xref="GI:117923664"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="GeneID:4482879"
                     /translation="MFFTRFFQPSAWWMTLGLLLVVTSPTMAGAQGKGANPVIVKLST
                     SMGDIKLQLDAEKAPISTENFLSYVKKGHYDGTIFHRVIPGFMVQGGGMDANMKEKST
                     DAPIKNEADNGLVNKRGSVAMARTQVVDSATSQFFINVNNNDFLNHGGRDFGYAVFGE
                     VIEGMDVVDQITAQPTGNKGYHQDVPTTPITINSATQE"
     misc_feature    complement(402551..403012)
                     /locus_tag="Mmc1_0349"
                     /note="cyclophilin_EcCYP_like: cyclophilin-type A-like
                     peptidylprolyl cis- trans isomerase (PPIase) domain
                     similar to the cytosolic E. coli cyclophilin A and
                     Streptomyces antibioticus SanCyp18. Compared to the
                     archetypal cyclophilin Human cyclophilin A, these...;
                     Region: cyclophilin_EcCYP_like; cd01920"
                     /db_xref="CDD:238901"
     misc_feature    complement(order(402671..402673,402698..402703,
                     402725..402727,402749..402766,402869..402871,
                     402875..402880,402887..402889,402893..402895))
                     /locus_tag="Mmc1_0349"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238901"
     gene            403543..404445
                     /locus_tag="Mmc1_0350"
                     /db_xref="GeneID:4482880"
     CDS             403543..404445
                     /locus_tag="Mmc1_0350"
                     /note="PFAM: Ppx/GppA phosphatase;
                     KEGG: bfs:BF2669  phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Ppx/GppA phosphatase"
                     /protein_id="YP_864282.1"
                     /db_xref="GI:117923665"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="GeneID:4482880"
                     /translation="MKFAAIDIGSNAVRLFIAHVYETGQAMPIVRKDDLYRVPLRLGA
                     DAFVRGEITPETEQQFVVVMQAFRKLIDFFQPLDMLACATSALRTARNGHEVVMRVSR
                     EANINIEIIEGQREAELIALNRADGSFDQDHFLFIDVGGGSTELTLLAKGRQVEATSF
                     PIGTVRIKENLVDSEIWSEMKRWIKVKAAPYPHLTAIGSGGNINKLVRMGGDKQAKQM
                     QRDEISKLLKTLRGMTNEQRMRELGMRPDRADVIVPAGEIFLSTMKWAKIKKIIVPQF
                     GLSDGMVHYLYRRHVEGQGGRIIS"
     misc_feature    403549..404394
                     /locus_tag="Mmc1_0350"
                     /note="Ppx/GppA phosphatase family; Region: Ppx-GppA;
                     cl19483"
                     /db_xref="CDD:267836"
     gene            complement(404673..405140)
                     /locus_tag="Mmc1_0351"
                     /db_xref="GeneID:4481211"
     CDS             complement(404673..405140)
                     /locus_tag="Mmc1_0351"
                     /note="PFAM: 17 kDa surface antigen;
                     KEGG: dps:DP0122 similar to 17 kDa surface antigen"
                     /codon_start=1
                     /transl_table=11
                     /product="17 kDa surface antigen"
                     /protein_id="YP_864283.1"
                     /db_xref="GI:117923666"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR008816"
                     /db_xref="GeneID:4481211"
                     /translation="MKSGSGTFKWMVISVAALFLLSGCAAPQNKAQGGAMVGALGGGL
                     AGSLMGNSKHKERNALIGAALGGLLGYSIGNEMDKADLLKLNNAYESTPSYQTTDWVN
                     PDSGRKYEVTPKPAARTAGRVCRDAEIKVWIDGRPETAIQRACRNPDGTWQMI"
     misc_feature    complement(404682..405092)
                     /locus_tag="Mmc1_0351"
                     /note="Surface antigen [Cell envelope biogenesis, outer
                     membrane]; Region: LipA; COG4520"
                     /db_xref="CDD:226903"
     gene            405437..406546
                     /locus_tag="Mmc1_0352"
                     /db_xref="GeneID:4481212"
     CDS             405437..406546
                     /locus_tag="Mmc1_0352"
                     /note="PFAM: RelA/SpoT domain protein;
                     KEGG: sth:STH1636  GTP pyrophosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="RelA/SpoT domain-containing protein"
                     /protein_id="YP_864284.1"
                     /db_xref="GI:117923667"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="GeneID:4481212"
                     /translation="MDSVDDMTVEQIMERYDERRALYDDFRNRQVTLLTEFLKENGPN
                     VFSITGRVKERESLRRKVTRPGSKYTRMEEVQDLVGIRIVTFFEEEVEQVAEVIRKEF
                     KINEAHILDRGEALDPERWGYRSRYYNVGLLDNRLKLIEYKRFVGCTAEIQVRSLLQH
                     AWAEIETRMGYTSRDTFPKERRRQFSRIAGMLELADQEFNETHRFLKPYRQRMLEQSN
                     KGHDNPVPSDMRRDPIGNDSLTRFIQENALVREMDARLAAIINVSLEDNGDFIDEVAT
                     HLSYLNLGTITALENELRIQRKTILGIAKQIFDRQGDKEFSALWRGISIYMLGYTLSA
                     VAEKSEHLLHGLDRTEIGPLLARSPFEDDSDLAPW"
     misc_feature    405518..405931
                     /locus_tag="Mmc1_0352"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    order(405587..405589,405593..405595,405665..405670,
                     405680..405682,405764..405766,405770..405772,
                     405791..405793,405797..405799,405803..405805,
                     405815..405817,405887..405889,405893..405895,
                     405899..405901,405923..405928)
                     /locus_tag="Mmc1_0352"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    order(405587..405589,405764..405766,405770..405772,
                     405791..405793,405797..405799,405803..405805,
                     405815..405817,405887..405889,405893..405895,
                     405923..405925)
                     /locus_tag="Mmc1_0352"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    order(405665..405667,405887..405889)
                     /locus_tag="Mmc1_0352"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     gene            406650..407189
                     /locus_tag="Mmc1_0353"
                     /db_xref="GeneID:4481213"
     CDS             406650..407189
                     /locus_tag="Mmc1_0353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864285.1"
                     /db_xref="GI:117923668"
                     /db_xref="GeneID:4481213"
                     /translation="MIAKQKNRKIGWLVALLVFTPLLAQADIYSCRDAQGIITLRNSP
                     CEKNEAVNSRTFTEPAVVHRREPKLRKRSPEERGEPPTYGSADAQLKAKQAVKKQMVQ
                     QLHDVGEQVMQEPEVLRSMLKFNADPHVRALLSDPFMVKALKEGDSRYLQNSYDYRML
                     LKSYPDAVPALKNLATNGQ"
     misc_feature    406689..>406793
                     /locus_tag="Mmc1_0353"
                     /note="Domain of unknown function (DUF4124); Region:
                     DUF4124; pfam13511"
                     /db_xref="CDD:257831"
     gene            complement(407300..407629)
                     /locus_tag="Mmc1_0354"
                     /db_xref="GeneID:4481214"
     CDS             complement(407300..407629)
                     /locus_tag="Mmc1_0354"
                     /note="TIGRFAM: glutaredoxin-like protein;
                     PFAM: glutaredoxin;
                     KEGG: mfa:Mfla_0245 glutaredoxin-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-like protein"
                     /protein_id="YP_864286.1"
                     /db_xref="GI:117923669"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="GeneID:4481214"
                     /translation="MSDIQATIQEHVNSHAVVLYMKGNPSFPQCGFSGAAAKMLAACD
                     LSNDDFLAVDVLMNPDIREGIKAFANWPTIPQLYIKGQFVGGADIMREMYQSGDLKTQ
                     LDAALGR"
     misc_feature    complement(407330..407608)
                     /locus_tag="Mmc1_0354"
                     /note="Glutaredoxin (GRX) family, PKC-interacting cousin
                     of TRX (PICOT)-like subfamily; composed of PICOT and
                     GRX-PICOT-like proteins. The non-PICOT members of this
                     family contain only the GRX-like domain, whereas PICOT
                     contains an N-terminal TRX-like domain...; Region:
                     GRX_PICOT_like; cd03028"
                     /db_xref="CDD:239326"
     misc_feature    complement(order(407408..407413,407534..407542,
                     407564..407566))
                     /locus_tag="Mmc1_0354"
                     /note="putative GSH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239326"
     misc_feature    complement(order(407531..407533,407540..407542))
                     /locus_tag="Mmc1_0354"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239326"
     gene            complement(407661..407903)
                     /locus_tag="Mmc1_0355"
                     /db_xref="GeneID:4481215"
     CDS             complement(407661..407903)
                     /locus_tag="Mmc1_0355"
                     /note="PFAM: BolA family protein;
                     KEGG: nmu:Nmul_A2742 BolA-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family protein"
                     /protein_id="YP_864287.1"
                     /db_xref="GI:117923670"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="GeneID:4481215"
                     /translation="MEVENVKALIEAGLSCDYIHVDGDGRHFEATIVSPEFCADAGMV
                     QQHQRVYRVLGEHMKEAIHALSLKTYTPEKWAQQKR"
     misc_feature    complement(407679..407882)
                     /locus_tag="Mmc1_0355"
                     /note="BolA-like protein; Region: BolA; pfam01722"
                     /db_xref="CDD:250816"
     gene            complement(408250..409083)
                     /locus_tag="Mmc1_0356"
                     /db_xref="GeneID:4481216"
     CDS             complement(408250..409083)
                     /locus_tag="Mmc1_0356"
                     /note="PFAM: cytochrome C1;
                     KEGG: mag:amb4089 cytochrome b/c1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C1"
                     /protein_id="YP_864288.1"
                     /db_xref="GI:117923671"
                     /db_xref="InterPro:IPR002326"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:4481216"
                     /translation="MNLKKALALSALVLGLAVAPQMATASGNAVELPNEEWSHLGPFG
                     KFDKAQIKRGIQVATEVCMGCHSIKYLKFDQLRQFGITEDEVNNMAGNYNATKLDKML
                     TGLAPEDAKESYGTVPPDLSLMTKARKGYENYLYGILTGYLTDDEAAKVSEASEDGNV
                     TDEEAKHLAEVLHMDPHNLEAVRKAVTRINGGDNFNKYFAGHFFAMPKPMGANQVEYA
                     DGTKATLEQQAKDVTAFLAWASEPNLEKRKATGKYVILYLLLLTGMLYAVKRRIWSRI
                     H"
     misc_feature    complement(408253..409077)
                     /locus_tag="Mmc1_0356"
                     /note="Cytochrome c1 [Energy production and conversion];
                     Region: CYT1; COG2857"
                     /db_xref="CDD:225413"
     misc_feature    complement(408256..408975)
                     /locus_tag="Mmc1_0356"
                     /note="Cytochrome C1 family; Region: Cytochrom_C1;
                     pfam02167"
                     /db_xref="CDD:251131"
     gene            complement(409103..410308)
                     /locus_tag="Mmc1_0357"
                     /db_xref="GeneID:4481217"
     CDS             complement(409103..410308)
                     /locus_tag="Mmc1_0357"
                     /note="PFAM: cytochrome b/b6, N-terminal domain;
                     cytochrome b/b6, C-terminal domain;
                     KEGG: mag:amb4089 cytochrome b/c1"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b/b6 domain-containing protein"
                     /protein_id="YP_864289.1"
                     /db_xref="GI:117923672"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR005798"
                     /db_xref="GeneID:4481217"
                     /translation="MFKSLMGWVDERLPISEFMRTQAVEYPTPKNLNYWWNFGSLALL
                     VLIIQLATGIFLVMHYKPDALLAFDSVEHIMRDVNWGWLLRYMHANGATFFFVVIYIH
                     ILRGMYYGSYRAPREILWWIGVIIFFLLMGTGFIGYVLVWGQMSYWGAVVITKLITAI
                     PLIGEGLVVWVWGGFSVGDPTLNRFFSLHYLLPFVLVGLVVLHIWALHAVHSNNPDGI
                     DLEEKDTIPFHPYFTIKDFFGYGVALTIYCYFVFFAPNAFLEPDNYIPANPMQTPPHI
                     VPEWYFLPFYAILRSIDFLGPYSKLAGVVAMVAAIAILFVLPFLDRSPVRSFRYRGIS
                     KGLFWIFVVDCFVLGWVGFSPADRMVFGLPIVYIGRTATAVYFGYFFLLWLVTALNIE
                     KPKPVPKSL"
     misc_feature    complement(409670..410269)
                     /locus_tag="Mmc1_0357"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cd00284"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(409673..409675,409697..409699,
                     410180..410182,410189..410191,410240..410245))
                     /locus_tag="Mmc1_0357"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(409670..409672,409826..409828,
                     409850..409855,409865..409885,409895..409897,
                     409925..409930,409937..409939,409946..409951,
                     409958..409963,409973..409990,410009..410011,
                     410018..410023,410027..410032,410036..410041,
                     410048..410053,410060..410062,410105..410107,
                     410177..410179,410186..410191,410198..410203,
                     410219..410227,410237..410242))
                     /locus_tag="Mmc1_0357"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(409682..409687,409964..409966,
                     410048..410050,410057..410065,410069..410083,
                     410090..410095,410102..410107,410132..410137,
                     410144..410146,410156..410158,410219..410221,
                     410228..410230,410234..410239))
                     /locus_tag="Mmc1_0357"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(409157..410230)
                     /locus_tag="Mmc1_0357"
                     /note="cytochrome b; Provisional; Region: CYTB; MTH00156"
                     /db_xref="CDD:214440"
     misc_feature    complement(order(409670..409675,409688..409690,
                     409697..409702,409709..409711,409928..409933,
                     409937..409942,409949..409954,409994..409996,
                     410000..410005,410012..410014,410024..410026,
                     410180..410185,410189..410194,410201..410203))
                     /locus_tag="Mmc1_0357"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(409730..409732,409739..409744,
                     409886..409891,409895..409900,409907..409912,
                     410033..410035,410042..410047,410054..410056,
                     410096..410098,410129..410131,410138..410143,
                     410147..410152,410159..410164,410171..410173))
                     /locus_tag="Mmc1_0357"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(409745..409747,409754..409756,
                     409838..409840,409850..409855,409862..409864,
                     409901..409906,409913..409918,409925..409927))
                     /locus_tag="Mmc1_0357"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(409253..409642)
                     /locus_tag="Mmc1_0357"
                     /note="Cytochrome b(C-terminus)/b6/petD:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: cytochrome_b_C;
                     cd00290"
                     /db_xref="CDD:238179"
     misc_feature    complement(order(409316..409321,409334..409339,
                     409514..409519,409526..409528,409544..409546,
                     409550..409555,409562..409567,409574..409576,
                     409583..409588,409595..409597,409604..409609,
                     409613..409621,409628..409642))
                     /locus_tag="Mmc1_0357"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238179"
     misc_feature    complement(order(409346..409348,409352..409360,
                     409364..409369,409376..409378,409406..409408,
                     409466..409477,409481..409483,409490..409498,
                     409502..409516,409520..409525,409529..409531,
                     409544..409546,409553..409561,409565..409570,
                     409580..409582,409589..409594,409601..409606,
                     409613..409615,409625..409627,409631..409639))
                     /locus_tag="Mmc1_0357"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    complement(order(409601..409603,409625..409627))
                     /locus_tag="Mmc1_0357"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    complement(order(409388..409390,409451..409456,
                     409463..409465,409472..409477,409481..409483))
                     /locus_tag="Mmc1_0357"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     gene            complement(410344..410880)
                     /locus_tag="Mmc1_0358"
                     /db_xref="GeneID:4481218"
     CDS             complement(410344..410880)
                     /locus_tag="Mmc1_0358"
                     /note="TIGRFAM: ubiquinol-cytochrome C reductase,
                     iron-sulfur subunit;
                     PFAM: Rieske [2Fe-2S] domain protein;
                     KEGG: rru:Rru_A0364 ubiquinol-cytochrome C reductase,
                     iron-sulfur subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol-cytochrome C reductase, iron-sulfur
                     subunit"
                     /protein_id="YP_864290.1"
                     /db_xref="GI:117923673"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="GeneID:4481218"
                     /translation="MSTVNEHDENRRDFLIMATGAVGAVGVAGAAWPFIDSWSPSADV
                     LSLATTEVSVAAIAEGQMITTMWQGKPVFILHRNAEQIERAKTDDKATDLVDPQADAD
                     RVKKDEWLIVLAICTHLGCVPQPIGTGDFGGFLCPCHGSHYDTSGRIRKGPAPRNLEV
                     PYYEFKDDETVIIGKAMG"
     misc_feature    complement(410758..410880)
                     /locus_tag="Mmc1_0358"
                     /note="Ubiquitinol-cytochrome C reductase Fe-S subunit TAT
                     signal; Region: UCR_Fe-S_N; pfam10399"
                     /db_xref="CDD:150981"
     misc_feature    complement(410359..410853)
                     /locus_tag="Mmc1_0358"
                     /note="ubiquinol-cytochrome c reductase, iron-sulfur
                     subunit; Region: Rieske_proteo; TIGR01416"
                     /db_xref="CDD:233404"
     misc_feature    complement(410359..410736)
                     /locus_tag="Mmc1_0358"
                     /note="Iron-sulfur protein (ISP) component of the bc(1)
                     complex family, Rieske domain; The Rieske domain is a
                     [2Fe-2S] cluster binding domain involved in electron
                     transfer. The bc(1) complex is a multisubunit enzyme found
                     in many different organisms including...; Region:
                     Rieske_cytochrome_bc1; cd03470"
                     /db_xref="CDD:239552"
     misc_feature    complement(order(410458..410460,410464..410466,
                     410473..410475,410524..410529,410533..410535))
                     /locus_tag="Mmc1_0358"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239552"
     gene            411082..411606
                     /locus_tag="Mmc1_0359"
                     /db_xref="GeneID:4481219"
     CDS             411082..411606
                     /locus_tag="Mmc1_0359"
                     /note="PFAM: tRNA/rRNA methyltransferase (SpoU);
                     KEGG: mta:Moth_1880 RNA methyltransferase TrmH, group 2"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/rRNA methyltransferase SpoU"
                     /protein_id="YP_864291.1"
                     /db_xref="GI:117923674"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="GeneID:4481219"
                     /translation="MNQIFQQPDASAPAPTLPDTLLHVVLYRPEIPPNTGNIQRICAA
                     TGAMLHLVGPIAFRLDNAALKRAGMDYRQWVDVQRYDDWAHCLRMQPLGVRWIPISTK
                     ATQGYHTMRYQAGDRLLFGSEGSGLPAEIHQALGHNAVRVPMLPRARSLNLANTVAVV
                     LYEALRQLNYPEMA"
     misc_feature    411145..411594
                     /locus_tag="Mmc1_0359"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            411709..413160
                     /locus_tag="Mmc1_0360"
                     /db_xref="GeneID:4481220"
     CDS             411709..413160
                     /locus_tag="Mmc1_0360"
                     /EC_number="5.4.2.10"
                     /note="TIGRFAM: phosphoglucosamine mutase;
                     PFAM: phosphoglucomutase/phosphomannomutase C terminal;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain I; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain II;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain III;
                     KEGG: atc:AGR_L_2256 phosphoglucomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="YP_864292.1"
                     /db_xref="GI:117923675"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR006352"
                     /db_xref="GeneID:4481220"
                     /translation="MVQNRAIFCFLSTIKSEETMTSESQPQVTQTRKFFGTDGIRGMA
                     NIHPMTPDLVLKLGRAAGHVFRVGDKRHTVIIGKDTRLSGYMFESALLAGLTSMGIHC
                     LQVGPLPTPAIAFLTRALRADAGIMISASHNPFHDNGIKFFGPNGMKLPDELELEIER
                     VLLSDEDLPMPTPHHLGRAHRIDDALGRYIEFAKTSFPKDLRLDGLRVVVDCAHGAAY
                     KVAPAVLWELGAEVVTLGNHPNGTNINDGVGSLYPQEMVKRVQEVRADVGIAFDGDAD
                     RVVICDERGEILDGDVILAMSALEMKRKGVLRGDGVVATVMSNLGLERALAAEGLTLA
                     RTKVGDRYVLEHMLAHGFNLGGEQSGHLIFLDHNTTGDGLISALSVLALMTTQAQPLS
                     KLANVMQRVPQVLQNVTIARGSDPMDDSRVVAAIAEAEAQLGTRGRILVRKSGTEPKV
                     RVMVEGDDTAHITALASGVCEAIKRASNGFGEG"
     misc_feature    411799..413142
                     /locus_tag="Mmc1_0360"
                     /note="phosphoglucosamine mutase; Provisional; Region:
                     glmM; PRK14315"
                     /db_xref="CDD:237669"
     misc_feature    411808..413106
                     /locus_tag="Mmc1_0360"
                     /note="GlmM is a bacterial phosphoglucosamine mutase
                     (PNGM) that belongs to the alpha-D-phosphohexomutase
                     superfamily. It is required for the interconversion of
                     glucosamine-6-phosphate and glucosamine-1-phosphate in the
                     biosynthetic pathway of...; Region: GlmM; cd05802"
                     /db_xref="CDD:100095"
     misc_feature    order(411814..411816,411820..411822,411829..411831,
                     412099..412107,412129..412131,412522..412524,
                     412528..412530,412534..412539,412657..412659,
                     412720..412728,412777..412779,412783..412785,
                     412789..412791,413032..413034,413038..413046,
                     413059..413061)
                     /locus_tag="Mmc1_0360"
                     /note="active site"
                     /db_xref="CDD:100095"
     misc_feature    order(411820..411822,412099..412101,412537..412539,
                     412657..412659,412720..412722,412726..412728,
                     412777..412779,412783..412785,412789..412791,
                     413032..413034,413038..413046,413059..413061)
                     /locus_tag="Mmc1_0360"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100095"
     misc_feature    order(412099..412101,412522..412524,412528..412530,
                     412534..412536)
                     /locus_tag="Mmc1_0360"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100095"
     gene            413297..414304
                     /locus_tag="Mmc1_0361"
                     /db_xref="GeneID:4481221"
     CDS             413297..414304
                     /locus_tag="Mmc1_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864293.1"
                     /db_xref="GI:117923676"
                     /db_xref="GeneID:4481221"
                     /translation="MVWYQNDPTFTQFVDALCDHADPVEVARGHNFRHDERIDKARAA
                     EYLAHMGKAPVGHQSCAAQHASYCAQYVRDAITPATFLPSNRAALLGPFDDGVMLIRV
                     ERLDKLLALISESNGESADDAFARLRQAMEDYQQRKDNEAERALKGWIARWNEKRDAR
                     PAFVTIGDEMASYLRRDDWVVALRDQLGLAHFSGAPGKPIYLALMAYPVQDVKTQAAK
                     YTQLSSPFVAPTVLDADMWEYFFPAPVDRRATTLSYGRAMSLQPLASEEQLQVEMLHT
                     RVDYQLAHVRQLGQLETPRPEHPVEELRNAHLDGVRMVTERYDWGEEIRVKERLDEPT
                     A"
     gene            414288..416702
                     /locus_tag="Mmc1_0362"
                     /db_xref="GeneID:4481222"
     CDS             414288..416702
                     /locus_tag="Mmc1_0362"
                     /note="PFAM: hypothetical protein; Tetratricopeptide
                     TPR_4; hypothetical protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: mba:Mbar_A2526 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864294.1"
                     /db_xref="GI:117923677"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:4481222"
                     /translation="MNPRLEEWLNSFMAAPLESWQHYVTGARRIPGSERLDPADSLKQ
                     LYVELPDNHAAFALLDKTLTQWLPRFVEWDSPTRQQFGLSRYVYWIAEIMVAATMLPL
                     PQLRQHLMDNFFTYRGRLTPLQLAPSRDALAEFLRVMAGSREFASNVPNFWMGLCQKA
                     GYSIPEYYLHIGIRGLRNCPKPINEQAPLWVGGLVAWLPNASSKEQFINTFYMIKVLY
                     PSTPSRWEKLIQPIIATLESREKVPTDRIAWLRALVREGKQSPDRSQSRPKPSALYAP
                     HKTPYRDELQPLLKTIEDDRQAWPQVEKPLHKLLERHQHYYAQTAESYFFVRAVNFTI
                     QKLLKCPPAYPFAQRWIEQVLEIDPWDPANWNLQGRLLVAMGKRERAEWVFWESTRRF
                     PDNSLNYTELGQLLLKQPGREDEAEQILREAMALDSNNIPPRTELGRLYMQQGKLEEA
                     EQVLREVIGLDSNDIHVRTELGRLYMQQGKLEEAEQVLQEAMALDSNNIPPRTELGRL
                     YMQQGKLKEAEQVLQEAMALDSNNIPPRTELGRLYMQQGKREEARWVLEQVLDIESED
                     HVARGLLSRLERGEQPAARDLSQPKQSHGSVQRVAAPPQVQESDPVALVGVLVRADFR
                     LRISEDHIPVLKKQGQQDLQGMLKQHAGMAVVSFYASRHGLTEEPLEGESLNRWAMQL
                     DRLLLAEGVSVEARQEGLQEVARHLSGRLVKDWLKAAAGEAEAWQRLRQAVLGEAKDA
                     GMPDDQFVKGQIGQIFKAPALQHDSPPPPWAEQRPGLQNLAARLVEANTDLFLHKVKD
                     GEEVAA"
     misc_feature    414981..415862
                     /locus_tag="Mmc1_0362"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    415317..415676
                     /locus_tag="Mmc1_0362"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(415326..415328,415338..415340,415347..415349,
                     415494..415496,415533..415535,415545..415547,
                     415554..415556,415599..415601,415635..415637,
                     415647..415649,415656..415658)
                     /locus_tag="Mmc1_0362"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(415485..415490,415494..415499,415506..415511,
                     415590..415595,415602..415607,415614..415619)
                     /locus_tag="Mmc1_0362"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    415593..415880
                     /locus_tag="Mmc1_0362"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(415593..415595,415602..415607,415692..415697,
                     415701..415706,415713..415718,415794..415799,
                     415806..415811,415818..415823)
                     /locus_tag="Mmc1_0362"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(415599..415601,415635..415637,415647..415649,
                     415656..415658,415701..415703,415737..415739,
                     415749..415751,415758..415760,415803..415805,
                     415839..415841,415851..415853,415860..415862)
                     /locus_tag="Mmc1_0362"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    415797..>416006
                     /locus_tag="Mmc1_0362"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(415797..415799,415806..415811,415896..415901,
                     415905..415910,415917..415922,415998..416003)
                     /locus_tag="Mmc1_0362"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(415803..415805,415839..415841,415851..415853,
                     415860..415862,415905..415907,415941..415943,
                     415953..415955,415962..415964)
                     /locus_tag="Mmc1_0362"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    415812..416015
                     /locus_tag="Mmc1_0362"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     gene            416837..418783
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /db_xref="GeneID:4481223"
     CDS             416837..418783
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="catalyzes a two-step reaction, first charging a
                     threonine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; catalyzes the formation
                     of threonyl-tRNA(Thr) from threonine and tRNA(Thr)"
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="YP_864295.1"
                     /db_xref="GI:117923678"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="GeneID:4481223"
                     /translation="MVEIILPDGSSRSYDQETLTCGQIAASIGKGLAKAAIAGVVNGQ
                     KVDLDAPVPHGAQVAIITEDSPEGLEIIRHSASHLMAQAVKTLFPQAQVTIGPAIENG
                     FYYDFDYERPFTPDDLTAIENCMRKLAKRNEKVERRVMPRDEAVAYFQAMGELYKAEI
                     IGAIPAGEDVSLYSQGEFTDLCRGPHVPSTGKLKAFKVMKAGGAYWRGDSRNKMLQRI
                     YGTAWATEADLKAYLTQMEEAEKRDHRRIGKDLDLFSVQEDAGGGLVFWHPRGSRIRR
                     VIEDFWKDRHVEAGYEFLYTPHIANRQLWNTSGHTDFYSDSMFSPMEVDEQAYQIRPM
                     NCPFHILIYKDRRHSYRELPFRWGELGTVYRYEMSGALHGLFRVRGFTQDDAHIFCTE
                     QQIEEEIQRILDLTLDILRTYGFSDFEINLSTRPEKSVGSAAIWDKATEALRRAIVSR
                     DLSYVVDEGGGAFYGPKIDVKITDSIGRKWQCSTVQLDFNLPERFDMGYIGEDGESHR
                     PIMIHRALMGSLERFFGILVEHYAGWFPMWLAPVQAVVCSITDAQHAYAETVLAALKK
                     AGLRVEIDLRNEKVGYKIREHTLKRVPYLLVVGDKEREEGTVNVRLRSGKSLGSLPIQ
                     DVVERLVEEAASRALSASEDQEEA"
     misc_feature    416837..418753
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
                     PRK00413"
                     /db_xref="CDD:234752"
     misc_feature    416840..417022
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is
                     a class II tRNA synthetase that couples threonine to its
                     cognate tRNA.  In addition to its catalytic and
                     anticodon-binding domains, ThrRS has an N-terminal TGS
                     domain, named after the ThrRS, GTPase, and...; Region:
                     TGS_ThrRS_N; cd01667"
                     /db_xref="CDD:133437"
     misc_feature    417344..417493
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; pfam07973"
                     /db_xref="CDD:254556"
     misc_feature    417563..418459
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="Threonyl-tRNA synthetase (ThrRS) class II core
                     catalytic domain. ThrRS is a homodimer. It is responsible
                     for the attachment of threonine to the 3' OH group of
                     ribose of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ThrRS_core;
                     cd00771"
                     /db_xref="CDD:238394"
     misc_feature    order(417572..417574,417611..417613,417764..417766,
                     417776..417778,417785..417790,417833..417835,
                     417929..417931,417935..417937,417941..417949,
                     417962..417970,417977..417979,417983..417985,
                     418268..418270,418277..418282,418292..418294,
                     418388..418393,418400..418402)
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="active site"
                     /db_xref="CDD:238394"
     misc_feature    order(417584..417586,417602..417604,417608..417616,
                     417620..417622,417626..417628,417632..417637,
                     417641..417643,417650..417652,417695..417700,
                     417710..417715,417719..417721,417725..417733,
                     417737..417739,417791..417799,417803..417814,
                     417821..417823,417857..417862,417869..417877,
                     417881..417889,417926..417928,417932..417934,
                     417941..417943,417971..417976,418055..418057,
                     418181..418189,418334..418336,418340..418342)
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238394"
     misc_feature    417710..417733
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="motif 1; other site"
                     /db_xref="CDD:238394"
     misc_feature    417926..417937
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="motif 2; other site"
                     /db_xref="CDD:238394"
     misc_feature    418388..418402
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="motif 3; other site"
                     /db_xref="CDD:238394"
     misc_feature    418457..418729
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="ThrRS Threonyl-anticodon binding domain. ThrRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     ThrRS_anticodon; cd00860"
                     /db_xref="CDD:238437"
     misc_feature    order(418481..418486,418589..418591,418607..418609,
                     418631..418633,418661..418663,418667..418669)
                     /gene="thrS"
                     /locus_tag="Mmc1_0363"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238437"
     gene            418910..419458
                     /locus_tag="Mmc1_0364"
                     /db_xref="GeneID:4481224"
     CDS             418910..419458
                     /locus_tag="Mmc1_0364"
                     /note="TIGRFAM: translation initiation factor IF-3;
                     PFAM: initiation factor 3;
                     KEGG: rru:Rru_A3488 initiation factor 3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor 3"
                     /protein_id="YP_864296.1"
                     /db_xref="GI:117923679"
                     /db_xref="InterPro:IPR001288"
                     /db_xref="GeneID:4481224"
                     /translation="MRFDRSLPQNQDSTRINEAIRVPEVRLIDEEGEQVGVVSRNDAL
                     YRAQNVGLDLVEVAPEAKPPVCKIMDYTKYKYQKAVRERIARKNQVRIDTKEVKFRPG
                     TDTHDYEVKLRSIRKFLEGGNKVKCTMRFRGREMAHQDLGLVMLKKVESEVLDLGKVE
                     QEPKLLGRQITMMLAPNALVKK"
     misc_feature    418931..419437
                     /locus_tag="Mmc1_0364"
                     /note="translation initiation factor IF-3; Reviewed;
                     Region: infC; PRK00028"
                     /db_xref="CDD:234582"
     misc_feature    418943..419167
                     /locus_tag="Mmc1_0364"
                     /note="Translation initiation factor IF-3, N-terminal
                     domain; Region: IF3_N; pfam05198"
                     /db_xref="CDD:191228"
     misc_feature    419180..419443
                     /locus_tag="Mmc1_0364"
                     /note="Translation initiation factor IF-3, C-terminal
                     domain; Region: IF3_C; pfam00707"
                     /db_xref="CDD:250071"
     gene            419701..419898
                     /locus_tag="Mmc1_0365"
                     /db_xref="GeneID:4481225"
     CDS             419701..419898
                     /locus_tag="Mmc1_0365"
                     /note="PFAM: ribosomal protein L35;
                     KEGG: dps:DP1426 probable 50S ribosomal protein L35"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="YP_864297.1"
                     /db_xref="GI:117923680"
                     /db_xref="InterPro:IPR001706"
                     /db_xref="GeneID:4481225"
                     /translation="MPKLKTHRGAAKRFKVTGSGKIRRNKAFKSHILTKKSAKRKRGF
                     RAGDLVHERDVAGVRKMLPYL"
     misc_feature    419701..419895
                     /locus_tag="Mmc1_0365"
                     /note="50S ribosomal protein L35; Reviewed; Region: rpmI;
                     PRK00172"
                     /db_xref="CDD:234676"
     gene            420008..420361
                     /locus_tag="Mmc1_0366"
                     /db_xref="GeneID:4481226"
     CDS             420008..420361
                     /locus_tag="Mmc1_0366"
                     /note="TIGRFAM: ribosomal protein L20;
                     KEGG: mlo:mll5057 50S ribosomal protein L20"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="YP_864298.1"
                     /db_xref="GI:117923681"
                     /db_xref="InterPro:IPR005812"
                     /db_xref="InterPro:IPR005813"
                     /db_xref="GeneID:4481226"
                     /translation="MPRVKRGVTSQARHKKVLKAAKGYTGRNNSCFRIAKQKVEKGLQ
                     YAYRDRKNLKREMRRLWIARINAATRLHGMSYSQFMNGLNKAGIELDRKVLSELAISE
                     PESFGTLVEQAKAAL"
     misc_feature    420023..420340
                     /locus_tag="Mmc1_0366"
                     /note="Ribosomal protein L20; Region: Ribosomal_L20;
                     cd07026"
                     /db_xref="CDD:197305"
     misc_feature    order(420023..420040,420044..420055,420068..420091,
                     420095..420106,420113..420118,420128..420133,
                     420140..420184,420188..420196,420203..420205,
                     420215..420217,420233..420238,420245..420250,
                     420257..420259,420281..420289)
                     /locus_tag="Mmc1_0366"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:197305"
     misc_feature    order(420113..420115,420125..420127,420134..420139,
                     420143..420148,420155..420157,420272..420283,
                     420290..420292,420308..420313,420329..420334)
                     /locus_tag="Mmc1_0366"
                     /note="L21 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     misc_feature    order(420176..420178,420185..420190,420197..420199,
                     420206..420211,420215..420217,420287..420289,
                     420296..420298,420305..420307)
                     /locus_tag="Mmc1_0366"
                     /note="L13 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     gene            421259..422305
                     /locus_tag="Mmc1_0367"
                     /db_xref="GeneID:4481227"
     CDS             421259..422305
                     /locus_tag="Mmc1_0367"
                     /EC_number="6.1.1.20"
                     /note="KEGG: psp:PSPPH_2139 phenylalanyl-tRNA synthetase,
                     alpha subunit;
                     TIGRFAM: phenylalanyl-tRNA synthetase, subunit alpha;
                     PFAM: phenylalanyl-tRNA synthetase, class IIc; aminoacyl
                     tRNA synthetase, class II domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase, subunit alpha"
                     /protein_id="YP_864299.1"
                     /db_xref="GI:117923682"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004188"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="GeneID:4481227"
                     /translation="MTMRNALQQLEQEAISAISSSENLKDLEDVRIRFMGKKGSITQQ
                     YGLMKTCPPEDKKELGQWLNQLKEAYNQSFEAQLEKLKKDELHARLLSERLDISLPGR
                     HTHTGGIHPVTRAIEEIAQVFAGMGFEVASGPEIESDWHNFGALNIPDDHPAREMHDT
                     FYIADDPNGGRRVLRTHTSPVQIRVMENRQPPLRVIAPGKVYRCDSDVTHTPMFHQVE
                     GFMVDKGVHFGQLKGLLESFLQTFFEQKLPVRFRPSFFPFTEPSAEVDMACLFCNGKG
                     CRICKGTGWLEVLGCGMIHPEVMKNVGMDSEIYAGFAFGMGVERLGMLKYGINDLRTF
                     FENDVRFLSRHAVY"
     misc_feature    421265..422287
                     /locus_tag="Mmc1_0367"
                     /note="phenylalanyl-tRNA synthetase subunit alpha;
                     Validated; Region: pheS; PRK00488"
                     /db_xref="CDD:234780"
     misc_feature    421313..421531
                     /locus_tag="Mmc1_0367"
                     /note="Aminoacyl tRNA synthetase class II, N-terminal
                     domain; Region: Phe_tRNA-synt_N; pfam02912"
                     /db_xref="CDD:111764"
     misc_feature    421586..422278
                     /locus_tag="Mmc1_0367"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) alpha chain
                     catalytic core domain. PheRS belongs to class II
                     aminoacyl-tRNA synthetases (aaRS) based upon its structure
                     and the presence of three characteristic sequence motifs.
                     This domain is primarily responsible...; Region:
                     PheRS_alpha_core; cd00496"
                     /db_xref="CDD:238277"
     misc_feature    order(421586..421588,421595..421597,421604..421609,
                     421628..421630,421643..421648,421652..421660,
                     421709..421711,421724..421726,421736..421753,
                     421811..421813,421832..421840,421850..421852,
                     421856..421858,421862..421864,421868..421870,
                     421889..421891,421940..421948,421952..421957,
                     422015..422017,422036..422044,422048..422050,
                     422141..422146,422261..422263,422267..422275)
                     /locus_tag="Mmc1_0367"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238277"
     misc_feature    421640..421660
                     /locus_tag="Mmc1_0367"
                     /note="motif 1; other site"
                     /db_xref="CDD:238277"
     misc_feature    order(421724..421732,421787..421789,421793..421795,
                     421802..421804,421865..421867,421871..421873,
                     421883..421891,421898..421900,421904..421906,
                     421910..421912,422024..422026,422030..422035,
                     422117..422134,422198..422209,422216..422218,
                     422249..422251)
                     /locus_tag="Mmc1_0367"
                     /note="active site"
                     /db_xref="CDD:238277"
     misc_feature    421862..421873
                     /locus_tag="Mmc1_0367"
                     /note="motif 2; other site"
                     /db_xref="CDD:238277"
     misc_feature    422201..422218
                     /locus_tag="Mmc1_0367"
                     /note="motif 3; other site"
                     /db_xref="CDD:238277"
     gene            422398..424788
                     /locus_tag="Mmc1_0368"
                     /db_xref="GeneID:4482670"
     CDS             422398..424788
                     /locus_tag="Mmc1_0368"
                     /EC_number="6.1.1.20"
                     /note="TIGRFAM: phenylalanyl-tRNA synthetase subunit beta;
                     KEGG: pca:Pcar_1423 phenylalanyl-tRNA synthetase subunit
                     beta"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="YP_864300.1"
                     /db_xref="GI:117923683"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR004532"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="GeneID:4482670"
                     /translation="MKFTEKWLREQINTQLDSEQISKTLTMAGLEVDAMERLGKGLDK
                     VQVGFLEAVQPHPDADRLTCCQVRVGETRLNIVCGATNHKQGDKVAVARDGAELPNGL
                     KIKKGQLRGQPSEGMLCSLTELGMAESSEGIIILPSDAPEGATMADYFQRNDICFELG
                     ITPNRGDCLGVRGIARDLAAVTGESLIPLQSAVQVAANVPTVAVEIADGEGCPRYAGR
                     VVEGVKVGPSPDWLRNRLESVGLRSINNIVDITNYVMLELNQPMHAFDLAQLAAPIVV
                     RRANPDERLTTLDYVERQLTEQMTLICDQQRPLAVAGVMGGLNSGVTDATTSIFLESA
                     YFNPVRTARTGRRLNLVTDSRHRFERGTDPMAIELALDRATQLVLELCGGQAGAITLT
                     DAGTWSRNPPVAFRHTRANALTGMCLTQAEQARYLQAIGCVEVAKPAQSATVEGAVWY
                     LPPTHRHDLLREEDLVEEVVRLFGYDKVPTELPSGAVATHQDSPERQLAKRLRKALTG
                     LGYLEAVNYAFVAPEVQARFDADLHPIMLTNPLSEEQSCMRTSLIAGLVEAVRRNLSR
                     GNDGLRLFEMGHIFKLDAQGQVQEEEHVSMVLAGRGTPRIWHTPQRVWDFFDLKGDFQ
                     TVVSRLQGAEPRYLPGGPAFLHPGRKAEIHLRGRVAGWMGELHPSLREAMGIDQPVLM
                     LELRSDALTQVNKKEAANVSRYPAVTRDFAFVVDRDTPAATILESARSVAKQLVREVE
                     LFDLYTGEHVPQDKKSIAFGLVLQADDRTLDEGEINQVMAQVTAKLEKQFNAVLRA"
     misc_feature    422398..424785
                     /locus_tag="Mmc1_0368"
                     /note="phenylalanyl-tRNA synthetase subunit beta;
                     Reviewed; Region: pheT; PRK00629"
                     /db_xref="CDD:234804"
     misc_feature    422530..422826
                     /locus_tag="Mmc1_0368"
                     /note="tRNA-binding-domain-containing prokaryotic
                     phenylalanly tRNA synthetase (PheRS) beta chain.  PheRS
                     aminoacylate phenylalanine transfer RNAs (tRNAphe).
                     PheRSs belong structurally to class II aminoacyl tRNA
                     synthetases (aaRSs) but, as they aminoacylate...; Region:
                     tRNA_bind_bactPheRS; cd02796"
                     /db_xref="CDD:239196"
     misc_feature    order(422578..422580,422677..422679,422716..422718,
                     422737..422739,422746..422748)
                     /locus_tag="Mmc1_0368"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239196"
     misc_feature    423028..423546
                     /locus_tag="Mmc1_0368"
                     /note="B3/4 domain; Region: B3_4; pfam03483"
                     /db_xref="CDD:251992"
     misc_feature    423598..423822
                     /locus_tag="Mmc1_0368"
                     /note="tRNA synthetase B5 domain; Region: B5; smart00874"
                     /db_xref="CDD:197942"
     misc_feature    423877..424467
                     /locus_tag="Mmc1_0368"
                     /note="Phenylalanyl-tRNA synthetase (PheRS) beta chain
                     core domain. PheRS belongs to class II aminoacyl-tRNA
                     synthetases (aaRS) based upon its structure. While class
                     II aaRSs generally aminoacylate the 3'-OH ribose of the
                     appropriate tRNA,  PheRS is an...; Region:
                     PheRS_beta_core; cd00769"
                     /db_xref="CDD:238392"
     misc_feature    order(423883..423888,423907..423909,423916..423918,
                     423928..423930,423934..423936,423940..423948,
                     424000..424011,424042..424044,424084..424086,
                     424114..424116,424129..424131,424135..424137,
                     424141..424143,424165..424167,424261..424263)
                     /locus_tag="Mmc1_0368"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238392"
     misc_feature    423928..423948
                     /locus_tag="Mmc1_0368"
                     /note="motif 1; other site"
                     /db_xref="CDD:238392"
     misc_feature    424060..424071
                     /locus_tag="Mmc1_0368"
                     /note="motif 3; other site"
                     /db_xref="CDD:238392"
     misc_feature    424135..424143
                     /locus_tag="Mmc1_0368"
                     /note="motif 2; other site"
                     /db_xref="CDD:238392"
     misc_feature    424501..424782
                     /locus_tag="Mmc1_0368"
                     /note="Ferredoxin-fold anticodon binding domain; Region:
                     FDX-ACB; pfam03147"
                     /db_xref="CDD:251758"
     gene            complement(424942..426558)
                     /locus_tag="Mmc1_0369"
                     /db_xref="GeneID:4482671"
     CDS             complement(424942..426558)
                     /locus_tag="Mmc1_0369"
                     /EC_number="4.1.1.49"
                     /note="PEP carboxykinase; PEP carboxylase; PEPCK;
                     catalyzes the phosphorylation and decarboxylation of
                     oxaloacetate to form phosphoenolpyruvate using ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="YP_864301.1"
                     /db_xref="GI:117923684"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="GeneID:4482671"
                     /translation="MSSTLTYKERVAAVTKQLAERGISNPGVVNLDLPTPKLYEQIIA
                     RGEGQIAHGGSVVVETGIYTGRSAKDKFIVEEPTSQADVDWGTVNRPVSQENYEKVRG
                     RLMAFLQGRELFVQDVRVGADPQFQRRVRVVNIKAWQNLFARNLFITPETMENEVVPP
                     DFTVIACPDFKADPELDGTRSEAFIYMNIAQREIIIGGTAYAGEMKKSIFSIMNYLLP
                     KQAVFPMHCSANIGTQDDVAIFFGLSGTGKTTLSTDPKRRMIGDDEHGWSDKGVFNFE
                     GGCYAKTIRLNAVAEPVIHNCTQTFGTVLENVVMDEESRTLDLDDDRKTENTRAAYPL
                     SSVGNIKADGMGGHPSHVILLTADAFGVLPPVSRLTSEQAMYHFISGYTAKLAGTERG
                     VKEPQATFSSCFGGPFMVHHPTVYAEMLGKRLSETGAKCWLVNTGWTAGPYGEGHRMP
                     IRETRAIIDSILANELNDVATHEDPVFGLAVPTAIDGVETVRLTPRDTWKDGAAFDAK
                     AKDLARQFNENFANFADRVSDAIKGAGPKV"
     misc_feature    complement(424954..426465)
                     /locus_tag="Mmc1_0369"
                     /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
                     critical gluconeogenic enzyme, catalyzes the first
                     committed step in the diversion of tricarboxylic acid
                     cycle intermediates toward gluconeogenesis. It catalyzes
                     the reversible decarboxylation and...; Region: PEPCK_ATP;
                     cd00484"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(425197..425199,425206..425208,
                     425215..425217,425572..425574,425686..425688,
                     425713..425715,425719..425721,425770..425775,
                     425809..425829,425881..425883,425938..425943,
                     425950..425952,425956..425958,426361..426363))
                     /locus_tag="Mmc1_0369"
                     /note="active site"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(425572..425574,425719..425721,
                     425938..425943,425950..425952,425956..425958,
                     426361..426363))
                     /locus_tag="Mmc1_0369"
                     /note="substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(425719..425721,425770..425775,
                     425812..425814,425881..425883,425938..425940))
                     /locus_tag="Mmc1_0369"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238270"
     misc_feature    complement(order(425197..425199,425215..425217,
                     425686..425688,425809..425829))
                     /locus_tag="Mmc1_0369"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238270"
     gene            complement(427075..428205)
                     /locus_tag="Mmc1_0370"
                     /db_xref="GeneID:4482672"
     CDS             complement(427075..428205)
                     /locus_tag="Mmc1_0370"
                     /note="PFAM: peptidoglycan-binding LysM; peptidase M23B;
                     KEGG: rru:Rru_A1767 peptidase M23B"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23B"
                     /protein_id="YP_864302.1"
                     /db_xref="GI:117923685"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="InterPro:IPR002886"
                     /db_xref="GeneID:4482672"
                     /translation="MDRLTIKHRLTGLMTLLLLGGCMPLDTLNLSTTPTDTPVRVARG
                     PALGWQPTTTPNHVEPSNAPTYQVQAGDSLWSIAMSHQVDVFDLARWNGVDDPDKVVA
                     GQLLYVRSPSMPVPNGKPDVMDEGNSSGDTPLRTVHLPQPSVVAQPDPMGVAQSGGFL
                     KQHSFILPTGRTAPLPLPALATPLAAVGSTATPTDKATPAPKSRDLTTQPATRQIVVQ
                     IRGDEEKPGIIQQPATLSSATAAANLQRMKGKPAPQQWNWPVQGTVVASFGRRGAKIN
                     PGIDIAAEKGTPVLAPAAGVVAYVGGHDSFGNLIIVNHGGDYKTLYAHNDVNLVERGQ
                     EIRPGQMIARVGNTGVRVRSPRLHFEIRRPIKPLNPLNYLSK"
     misc_feature    complement(427081..428013)
                     /locus_tag="Mmc1_0370"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(427882..428013)
                     /locus_tag="Mmc1_0370"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    complement(427096..427386)
                     /locus_tag="Mmc1_0370"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(428193..428771)
                     /locus_tag="Mmc1_0371"
                     /db_xref="GeneID:4482673"
     CDS             complement(428193..428771)
                     /locus_tag="Mmc1_0371"
                     /note="KEGG: pca:Pcar_1428 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864303.1"
                     /db_xref="GI:117923686"
                     /db_xref="GeneID:4482673"
                     /translation="MRGLYDWTMHWAMHPKAVVALFLVAVAESSFFPIPPDLLLMAMA
                     LAEPMRSLLYAAVCTAGSVLGGALGYLIGYLAWDWIGAPILTFYGKMEAYDQLAGLFD
                     AHGAWVVAIAGFSPLPYKLFTITAGALHANFALFMVMSLLSRGARFFLVAALLRWGGE
                     PLRKLVERHLDLLTVAVVVVIVAIVVVMKWIV"
     misc_feature    complement(428283..428768)
                     /locus_tag="Mmc1_0371"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG1238"
                     /db_xref="CDD:224159"
     gene            complement(428780..429466)
                     /locus_tag="Mmc1_0372"
                     /db_xref="GeneID:4482674"
     CDS             complement(428780..429466)
                     /locus_tag="Mmc1_0372"
                     /EC_number="2.1.1.77"
                     /note="KEGG: gme:Gmet_1420
                     protein-L-isoaspartate(D-aspartate) O-methyltransferase;
                     TIGRFAM: protein-L-isoaspartate O-methyltransferase;
                     PFAM: protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase; methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="YP_864304.1"
                     /db_xref="GI:117923687"
                     /db_xref="InterPro:IPR000682"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:4482674"
                     /translation="MVAVSLKMSQPAAPPPPMGERARTRMLLALQSRGIHDPRVLEVM
                     GALPRHDFVDEALAGHAYGDATLPIGEGQTLSQPYTVARMSQALELGYGMHVLEIGTG
                     SGYQTAVLAALCRRVYTVERIPSLALLARERLERMGITNVRYRVGDGTLGWPEPRPFE
                     RIIVTAGAPATPERLKRQLEIGGRMIIPEGGKLNQQLICIQRTGPESWQRDVLEACRF
                     VPLVGQQGWE"
     misc_feature    complement(428888..429181)
                     /locus_tag="Mmc1_0372"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(428972..428974,429020..429028,
                     429101..429106,429152..429172))
                     /locus_tag="Mmc1_0372"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(429448..430197)
                     /locus_tag="Mmc1_0373"
                     /db_xref="GeneID:4482675"
     CDS             complement(429448..430197)
                     /locus_tag="Mmc1_0373"
                     /EC_number="3.1.3.5"
                     /EC_number="3.1.3.6"
                     /EC_number="3.6.1.11"
                     /note="KEGG: noc:Noc_0789 acid phosphatase;
                     TIGRFAM: stationary-phase survival protein SurE;
                     PFAM: Survival protein SurE"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="YP_864305.1"
                     /db_xref="GI:117923688"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="GeneID:4482675"
                     /translation="MLILLTNDDGIASPGLQALKDALKERHDVVTLAPVKDMSGTAHA
                     ISRGEDIKLTRIAEYEVAINGTPTDCVMAGLRMVLRRPPDLLVSGINMGANVAEDLSY
                     SATAGAAWEGALSGIPSMAVSLCGSAAPWHFESAIKVTHMVIRQWLENPLPPGTFLNV
                     NVPNVPEYELKNPKPTRQGLRFNWPPPPVTAAGNPAFWDPTIPTPREEEFQLATDEEA
                     LRDGFTSVTALHCLFRHPHATERLKAWSLFR"
     misc_feature    complement(429463..430197)
                     /locus_tag="Mmc1_0373"
                     /note="5'(3')-nucleotidase/polyphosphatase; Provisional;
                     Region: surE; PRK00346"
                     /db_xref="CDD:234732"
     gene            complement(430516..431466)
                     /locus_tag="Mmc1_0374"
                     /db_xref="GeneID:4482676"
     CDS             complement(430516..431466)
                     /locus_tag="Mmc1_0374"
                     /note="KEGG: hch:HCH_04666 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864306.1"
                     /db_xref="GI:117923689"
                     /db_xref="GeneID:4482676"
                     /translation="MARNIRILALLLAAQMGLALVLLGSGPSLQAVNPNTPLLNLGEG
                     ELDELLIEGDDHSQLLLKKQDGLWRLPDHHNYPAEQGDVTALLSQLKSLSHGTPMATS
                     DAALERFKVADTHFNRRITLKRQQQVVAVLYLGSGQGARNSAAHVEGQPGIFNVAIAL
                     HQVPQTAKAWQDKTLLQIPAGEIMQIATHGLTLQRQPVDKEDKAAKPSWQATGLQAGE
                     TVNSTAVESLSTKLATLRIEELLGVTDQPAYGLDKPVWQATLTRQGQPPLIYQLGHQS
                     EPNSYTLKRSDRPEYFKLPTYLAESLIEAGKRDSLLNKAP"
     misc_feature    complement(431185..>431364)
                     /locus_tag="Mmc1_0374"
                     /note="Domain of unknown function (DUF4340); Region:
                     DUF4340; pfam14238"
                     /db_xref="CDD:258428"
     misc_feature    complement(430705..431265)
                     /locus_tag="Mmc1_0374"
                     /note="Domain of unknown function (DUF4340); Region:
                     DUF4340; pfam14238"
                     /db_xref="CDD:258428"
     gene            complement(431469..434363)
                     /locus_tag="Mmc1_0375"
                     /db_xref="GeneID:4482677"
     CDS             complement(431469..434363)
                     /locus_tag="Mmc1_0375"
                     /note="KEGG: noc:Noc_2141 ABC transporter inner membrane
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter inner membrane protein"
                     /protein_id="YP_864307.1"
                     /db_xref="GI:117923690"
                     /db_xref="InterPro:IPR006025"
                     /db_xref="GeneID:4482677"
                     /translation="MDKIMRIAQKEFQSFFASPAAFLFLGAFLAATLFIVFWVETFFA
                     RNIADLRPMFQWMPLLLIFLVAALTMRSWSEERRSGTLETLLTSPVNPLHLIAGKFAA
                     ALALVVVGLALTLPLTLTVALLGPLDWGPVLGGYIATLFLAAAYVSIGLFMSARTDNP
                     IVALILTTAVCGLFYFIGSPTLTNLFGHEVSHFLALLGSGSRFDAITRGVVDLRDLYY
                     YLSLVGVFLTLNLFTLERLKWAGNPISQRHKQWGWLTALLVANFVAGNLWLGSIGWLR
                     QDMTAGKLYSLSEATQQQLQQLQEPLQIRGYFSAKTHPLLAPLVPQIRDLLKEYAQLS
                     KGRVEVAFIDPQRSPALEEEAASRYGIRPVPFQMASRHQASVVNAYFDLVVAYGDQFQ
                     KLSYTDLIEIKSGASRELEVMLKNPEYAITQSIRKVQHAYQSGGNPFEGLAHPVTFTG
                     YLSQPLPAGVEKLQGALQSALDELTAQGKEKFKVQFKDPGQDPALAKQLKQDYGFKPQ
                     IASLLDPQPFWFYMVLTGNDSDGIPVPLPEELTKEGLKRTIEAAVQRMAPGFLKNITL
                     TTATPAPAGMMGRAPTPGKGYTLLQEALGESLKVTSNDLQSGQVPAQTDLLMVMGPDK
                     LNEKQLFAMDQFLMQGGTVVLATSPFDVDLQGSLSVANKHDAGLTEWLASHGITLQEK
                     MVLDAQKASLPVPVTRYIGPMAVEEIQQFPYPHFPDLRGASLNPKSPITAGLGQLTIN
                     WASPIVVDAEPNKTRQVIPLLHSSKQSWSSDALNILPDYQAYPDQGFPKPDSQEPQLL
                     AVALEGRFDSFFKDKASPLLHEQEAPSAHAPEEKAQQTDPEPTKPQFGGVLEHSSPEA
                     RLILIASNGFASDEVLSLASQGAGTLYNKPIELLQNSIDWALQDAALMQIRGRMQFAR
                     TLLPMSDGSRMVIEYFNYGLVLLGLLGIWLWRRAVRLRQLRRHQAILAEV"
     misc_feature    complement(433656..434345)
                     /locus_tag="Mmc1_0375"
                     /note="gliding motility-associated ABC transporter
                     permease protein GldF; Region: ABC_perm_GldF; TIGR03518"
                     /db_xref="CDD:132557"
     misc_feature    complement(<433821..>434207)
                     /locus_tag="Mmc1_0375"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_3; pfam12698"
                     /db_xref="CDD:257232"
     misc_feature    complement(432306..433538)
                     /locus_tag="Mmc1_0375"
                     /note="ABC-type uncharacterized transport system; Region:
                     ABC_transp_aux; pfam09822"
                     /db_xref="CDD:255585"
     misc_feature    complement(431637..433031)
                     /locus_tag="Mmc1_0375"
                     /note="gliding-associated putative ABC transporter
                     substrate-binding component GldG; Region: GldG; TIGR03521"
                     /db_xref="CDD:132560"
     gene            complement(434356..435375)
                     /locus_tag="Mmc1_0376"
                     /db_xref="GeneID:4482678"
     CDS             complement(434356..435375)
                     /locus_tag="Mmc1_0376"
                     /note="PFAM: ABC transporter;
                     SMART: ATPase AAA;
                     KEGG: noc:Noc_2142 ABC transporter ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_864308.1"
                     /db_xref="GI:117923691"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:4482678"
                     /translation="MAPDRPFKANLIRKPDPLGSQPKTSLGDCMIEVSQLSRVYGDYT
                     AVEACSFAIQRGEVVGLLGHNGAGKTTIMKMLTGFLEPTSGTILIDGLALNREANTVQ
                     GRIGYLPENCPVWPEMTVMAYLEYHADLRGIADIDKPRAIARAIRRTALQEKALAPIA
                     TLSRGYRQRVGVAQAILHDPDIIILDEPTNGLDPTQIRQMRDLIRELAKEATVILSTH
                     ILQEVQAVCERVLILKQGKLVVDATLATLQSGGRLRLTTAKTAQATLASQLESAQIES
                     LPSTDGLYHYALNVPAQQTPQIAQAVVEGGLGLHGLHFEKQNLESLFAQINQQPQTHG
                     EVGHG"
     misc_feature    complement(434398..435288)
                     /locus_tag="Mmc1_0376"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(434662..435285)
                     /locus_tag="Mmc1_0376"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(435166..435189)
                     /locus_tag="Mmc1_0376"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(434722..434724,434815..434820,
                     435046..435048,435163..435171,435175..435180))
                     /locus_tag="Mmc1_0376"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(435046..435057)
                     /locus_tag="Mmc1_0376"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(434863..434889,434998..435000))
                     /locus_tag="Mmc1_0376"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(434815..434832)
                     /locus_tag="Mmc1_0376"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(434797..434808)
                     /locus_tag="Mmc1_0376"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(434716..434736)
                     /locus_tag="Mmc1_0376"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            complement(435499..436518)
                     /locus_tag="Mmc1_0377"
                     /db_xref="GeneID:4482679"
     CDS             complement(435499..436518)
                     /locus_tag="Mmc1_0377"
                     /note="KEGG: ade:Adeh_1674 protein of unknown function
                     DUF59"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864309.1"
                     /db_xref="GI:117923692"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="GeneID:4482679"
                     /translation="MAQRAAIVALFDQLQEPKLKWNINTLNLLQEVTLHEQHLRVVVH
                     LITGDRQQRIAFEEQARQAIQAIHTGSLELIVAQAQVGTEGIQGVKRIILVASGKGGV
                     GKSTVAVNLAVGLNLLGHKVGLMDADIYGPSVPTMLGCHDKPQVLPHEYLLPLQRHGI
                     RFISTGSLVDPGKALDWRGPLVSGTLLQFITKTCWGELDYLIIDMPPGTGDAQLTIAS
                     KLKTHGVVLVTTPQEVAWGDVRRAIELFQKQQAPILGIVENMNHQVCTACGHQSHPLI
                     HSQLPLPPGIVSLAQLPLAHEISQAGDAGVPLLLQESSSPAKAALLALAQRVAQCTAP
                     TQEPA"
     misc_feature    complement(435505..436248)
                     /locus_tag="Mmc1_0377"
                     /note="cell division ATPase MinD, archaeal; Region:
                     minD_arch; TIGR01969"
                     /db_xref="CDD:131024"
     misc_feature    complement(435637..436245)
                     /locus_tag="Mmc1_0377"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     misc_feature    complement(436204..436227)
                     /locus_tag="Mmc1_0377"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238994"
     gene            complement(436525..436785)
                     /locus_tag="Mmc1_0378"
                     /db_xref="GeneID:4482680"
     CDS             complement(436525..436785)
                     /locus_tag="Mmc1_0378"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864310.1"
                     /db_xref="GI:117923693"
                     /db_xref="GeneID:4482680"
                     /translation="MSAEQGFIDYVKTTQPKMWELIRKTADESGLIVVDEANDAITAT
                     NRLLWCNPVLHDCLATLVDQWCGKQTTPAESFRALLNPPSKD"
     gene            437165..437530
                     /locus_tag="Mmc1_0379"
                     /db_xref="GeneID:4482681"
     CDS             437165..437530
                     /locus_tag="Mmc1_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864311.1"
                     /db_xref="GI:117923694"
                     /db_xref="GeneID:4482681"
                     /translation="MAEVREGSVWVLCACEYLHGDRYAQFERLREDLHNSRQVELVVF
                     NVGMMKTLNSEQLGKLIQISNQDKYEVCLTNVSEQNYALMKLIGLERFVKIYDKPQAE
                     ALAKEHRILSAFDCLYGDG"
     gene            complement(437927..438982)
                     /locus_tag="Mmc1_0380"
                     /db_xref="GeneID:4482682"
     CDS             complement(437927..438982)
                     /locus_tag="Mmc1_0380"
                     /note="PFAM: GTPase EngC;
                     KEGG: vvy:VVA0067 predicted GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase EngC"
                     /protein_id="YP_864312.1"
                     /db_xref="GI:117923695"
                     /db_xref="InterPro:IPR004881"
                     /db_xref="InterPro:IPR010914"
                     /db_xref="GeneID:4482682"
                     /translation="MSNALSTLSNVPLRPFFQQQLSMEEQHATHVVRVIARHGDTLTL
                     LGNDGQSSLKLPGKWRLQPPEEQPIVGDWLVMDQQNQPLRWLERLSHLSRKAAGSGQQ
                     TQHMAANIDTLFVVSSCNRDFNPSRLERYLALAFAGNVQPVVLLTKADLVDEPEPFCR
                     QVESLHRGVVAIALDARHPDLHHQLGPWIGPGESVAFLGSSGVGKSTLINALLDQKSM
                     ATQAARADDDRGRHTTTARAMFHMKSGAWLLDTPGMRELRLGESNQGLQTLFSDIEAL
                     AQACQYRDCDHERTSGCAVLAAVASDTLDARRVRNYLKLQREQTYLTETVWQQRDRHR
                     QFARLVNRVKIDKFGKR"
     misc_feature    complement(437930..438979)
                     /locus_tag="Mmc1_0380"
                     /note="GTPase RsgA; Reviewed; Region: PRK01889"
                     /db_xref="CDD:234988"
     misc_feature    complement(438032..438661)
                     /locus_tag="Mmc1_0380"
                     /note="Ribosomal interacting GTPase YjeQ/EngC, a
                     circularly permuted subfamily of the Ras GTPases; Region:
                     YjeQ_EngC; cd01854"
                     /db_xref="CDD:206747"
     misc_feature    complement(order(438038..438040,438050..438052,
                     438059..438061,438170..438172,438176..438178,
                     438188..438190,438476..438478,438572..438577,
                     438584..438589,438593..438598,438605..438610))
                     /locus_tag="Mmc1_0380"
                     /note="GTPase/Zn-binding domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(order(438362..438379,438455..438460,
                     438530..438535,438539..438544))
                     /locus_tag="Mmc1_0380"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438533..438544)
                     /locus_tag="Mmc1_0380"
                     /note="G4 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438452..438460)
                     /locus_tag="Mmc1_0380"
                     /note="G5 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438365..438388)
                     /locus_tag="Mmc1_0380"
                     /note="G1 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438269..438292)
                     /locus_tag="Mmc1_0380"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438281..438283)
                     /locus_tag="Mmc1_0380"
                     /note="G2 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438224..438235)
                     /locus_tag="Mmc1_0380"
                     /note="G3 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(438221..438229)
                     /locus_tag="Mmc1_0380"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206747"
     gene            439323..439637
                     /locus_tag="Mmc1_0381"
                     /db_xref="GeneID:4482683"
     CDS             439323..439637
                     /locus_tag="Mmc1_0381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864313.1"
                     /db_xref="GI:117923696"
                     /db_xref="GeneID:4482683"
                     /translation="MQQRIKKAFQDAINNKNSKNGYPISLYEIKLTFCVSMVRNLDEP
                     KWLNQIAGRPSYGFPDSPNIYALWVYHDRHMFIKACSGNLVPEGLSTMGGMTIYGKHV
                     EL"
     gene            439872..440087
                     /locus_tag="Mmc1_0382"
                     /db_xref="GeneID:4482684"
     CDS             439872..440087
                     /locus_tag="Mmc1_0382"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_864314.1"
                     /db_xref="GI:117923697"
                     /db_xref="GeneID:4482684"
                     /translation="MLGFKERNNTVNEIVNGRRAISAEVAVKLEFVFKMPAKLWKGLQ
                     DDYDIGMARLKVKEEHLTLRVAEKQHA"
     misc_feature    <439896..440030
                     /locus_tag="Mmc1_0382"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cl17200"
                     /db_xref="CDD:266550"
     gene            complement(440145..442025)
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /db_xref="GeneID:4482685"
     CDS             complement(440145..442025)
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="catalyzes the formation of propionyl-CoA using
                     propionate as a substrate; PrpE from Ralstonia
                     solanacearum can produce acetyl-, propionyl-, butyryl- and
                     acrylyl-coenzyme A, and Salmonella enterica produces
                     propionyl- and butyryl-coenzyme A; not expressed in
                     Escherichia coli when grown on propionate/minimal media;
                     ATP-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="propionyl-CoA synthetase"
                     /protein_id="YP_864315.1"
                     /db_xref="GI:117923698"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR012694"
                     /db_xref="GeneID:4482685"
                     /translation="MENREKYEAFYKRSIEDRDGFWKEQAKLIHWDKPFKTVLEYQKP
                     PFANWFPDGTTNLCYNAVDRHLAERADQTAIIWVSTEVEQEKTITYQELYQQVNEYAA
                     LLKDLGVGKGDRVLVYLPMIAEVIPVMLSCVRIGAIHSVVFGGFASTALASRIDDAAP
                     KLIITVDAGIRGGKVVPYKPLLQESLNQISVTRPKVLLINRNLDPNLKMEKGDLDFTT
                     ELAKHKDAVVEPEWLPSSHPSYILYTSGTTGKAKGVQRDTGGHAVAMRASMKHIYGVE
                     PGQVMFAGSDVGWVVGHSYIVYAPLLTGATTVVYEGLPIRPDPGVWWSLVEKYKVNCL
                     FTSPTAIRLLKKSGEEWIWKYDLSSLESMFLAGEPLDRETHRWVTSALKHAPVVDNYW
                     QTETGWPILTNFKGMGLMETKFGSPCRPAYGFDVVLIDDLTQQPAEPNTKGSLMIRPP
                     LPPGCLSTVWGDDERFVQTYFSRMREPIYATFDSAVYDDDGYYYIMGRDDDVINVAGH
                     RLGTREIEEALCSHPAVAEAASIGIKDELRGQAISCFVVLTTGAEPPSEADLKNHVAS
                     QLGPVARPHFVRVVTALPKTRSGKVLRRAIVAINEGRDPGDLPTIEDASALDKIKEAC
                     KN"
     misc_feature    complement(440148..442016)
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="propionyl-CoA synthetase; Provisional; Region:
                     prpE; PRK10524"
                     /db_xref="CDD:182517"
     misc_feature    complement(440166..441980)
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(441270..441275,441279..441296,
                     441303..441305))
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(440256..440258,440499..440501,
                     440532..440534,440541..440543,440577..440579,
                     440844..440861,440925..440930,441294..441296))
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(440313..440315,440499..440510,
                     440532..440534,440541..440543,440577..440579,
                     440844..440861,440925..440930,440997..440999,
                     441006..441011,441015..441017,441168..441173,
                     441294..441296))
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(440313..440315,440331..440333,
                     440502..440510,440928..440930,440997..440999,
                     441006..441011,441171..441173))
                     /gene="prpE"
                     /locus_tag="Mmc1_0383"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(443775..444176)
                     /locus_tag="Mmc1_0384"
                     /db_xref="GeneID:4482686"
     CDS             complement(443775..444176)
                     /locus_tag="Mmc1_0384"
                     /EC_number="5.1.99.1"
                     /note="PFAM: glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: jan:Jann_3164 glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA epimerase"
                     /protein_id="YP_864316.1"
                     /db_xref="GI:117923699"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR011588"
                     /db_xref="GeneID:4482686"
                     /translation="MIGRLNHVAIAVADLDAAERQYGDLLGGILSAREDLPEHGVTTV
                     FVRLSNTNIELLHPLGMDSPIAKFLEKSPSGGLHHVCYEVEDIRAAMERLVAGGARVL
                     GREPKIGAHGKPVIFLHPKDFSGTLVELEQA"
     misc_feature    complement(443781..444164)
                     /locus_tag="Mmc1_0384"
                     /note="Methylmalonyl-CoA epimerase (MMCE); Region: MMCE;
                     cd07249"
                     /db_xref="CDD:211350"
     misc_feature    complement(order(443799..443804,443823..443825,
                     443880..443882,443886..443888,443931..443933,
                     443937..443942,443946..443948,443952..443957,
                     444018..444020,444024..444029,444090..444101,
                     444105..444107,444111..444116,444126..444128,
                     444147..444149,444153..444155,444162..444164))
                     /locus_tag="Mmc1_0384"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:211350"
     misc_feature    complement(order(443784..443786,443790..443792,
                     443826..443828,443832..443834,443940..443942,
                     443982..443984,444015..444017,444048..444050,
                     444156..444158))
                     /locus_tag="Mmc1_0384"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:211350"
     misc_feature    complement(order(443790..443792,443940..443942,
                     444015..444017,444156..444158))
                     /locus_tag="Mmc1_0384"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211350"
     gene            complement(444190..446148)
                     /locus_tag="Mmc1_0385"
                     /db_xref="GeneID:4482687"
     CDS             complement(444190..446148)
                     /locus_tag="Mmc1_0385"
                     /note="PFAM: biotin/lipoyl attachment domain-containing
                     protein; ATP-dependent carboxylate-amine ligase domain
                     protein, ATP-grasp; carbamoyl-phosphate synthase L chain,
                     ATP-binding; carbamoyl-phosphate synthetase large chain
                     domain protein; biotin carboxylase domain protein; RimK
                     domain protein ATP-grasp;
                     KEGG: sil:SPO1101 propionyl-CoA carboxylase, subunit
                     alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase subunit L"
                     /protein_id="YP_864317.1"
                     /db_xref="GI:117923700"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="GeneID:4482687"
                     /translation="MQKILIANRGEIACRVIKTARRMGIQTVAVYSDADREALHVRMA
                     DEAYYIGPSPSNQSYLVMDKLLEVIKQCGADGVHPGYGFLSENSTFCRRLQEMGVIFI
                     GPNPTAIDAMGDKISSKKLAQAANVNTIPGHMGIIENADEAVRIAAEIGYPVMLKASA
                     GGGGKGMRIAHNDAEAAEGWQSATNEGLSYFGDGRVFIEKFIENPRHIEIQVLCDGHG
                     NGVYLNERECSIQRRNQKVIEEAPSPFVDADMRRAMGEQALALAQAVDYVSAGTIEFV
                     VGADKGFYFLEMNTRLQVEHPVTEFITGLDLVEQMIRVARGERLSITQDQVLLKGWSM
                     ESRVYAENPYRNFLPSVGRLVRYEPPLESAHVRVDTGVFAGGEVTLFYDPMIAKLITW
                     GQDRGEAIEHMREALDSYLIEGPGHNIDFLNAVLRHPRFVSGNISTAFIAEEYPEGFE
                     GAPLSGMDRQLFAVAAAYIEQQAQALLMDLGVEKSWVVSVDEEVLPLIFREVEGGDEV
                     EFGDGSRFGVSGVVRPGAKKVTLTIAGQVCTFGVVRGEEGYHLTRGGRQVGVYVRTPR
                     QHQLAQRMPVKVAPDTSKMLITPMPGLVLKIIVEVGDCVSAGDPVCVLEAMKMENIMR
                     VERDGVVGAIFAKPGQAVESDSIIMTFE"
     misc_feature    complement(444193..446148)
                     /locus_tag="Mmc1_0385"
                     /note="Acetyl/propionyl-CoA carboxylase, alpha subunit
                     [Lipid metabolism]; Region: COG4770"
                     /db_xref="CDD:227111"
     misc_feature    complement(445825..446145)
                     /locus_tag="Mmc1_0385"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(445180..445809)
                     /locus_tag="Mmc1_0385"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(444823..445146)
                     /locus_tag="Mmc1_0385"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     misc_feature    complement(444196..444393)
                     /locus_tag="Mmc1_0385"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(444271..444273,444292..444300,
                     444325..444327))
                     /locus_tag="Mmc1_0385"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(444295..444297)
                     /locus_tag="Mmc1_0385"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(446161..447705)
                     /locus_tag="Mmc1_0386"
                     /db_xref="GeneID:4482130"
     CDS             complement(446161..447705)
                     /locus_tag="Mmc1_0386"
                     /EC_number="6.4.1.3"
                     /note="PFAM: carboxyl transferase;
                     KEGG: rfr:Rfer_2803 propionyl-CoA carboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="propionyl-CoA carboxylase"
                     /protein_id="YP_864318.1"
                     /db_xref="GI:117923701"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="GeneID:4482130"
                     /translation="MQEIIEKLDHLRNQARLGGGQARIDSQHARGKLTARERIDVLLD
                     EGSFEELDMFVTHNCIDFGMADKRIAGDGVVTGHGTIFGRAVFVFSQDFTVFGGSLSE
                     ANATKICKIMDMALKVGAPVIGLNDSGGARIHEGVSSLAGYAEVFQRNVMASGVIPQI
                     SAIMGPCAGGAVYSPALTDFIAMVKDTSYMFVTGPDVVKTVTHEEVTAEDLGGAVTHA
                     TRSGVADFAFDNDMSMLKQLRRLMSFLPSNNTEKPPLVETHDPANRPDMTLDHLVPMD
                     ATKPYDMKELIEKVVDNNDFMEVQAGYAKNIIIGFGRMEGSTVGIVANQPLVLAGCLD
                     INSAIKAARFVRFCDCFNIPIVTFVDVPGFLPGTQQELGGIIKHGAKLLFAYAECTVP
                     KITVITRKAYGGAYDVMASKHLRGDLNYAWPNAEIAVMGPKGASEIIFRNEIKEADDP
                     AAKLQEKTDEYTNKFANPFIAASKGFIDDVIMPHNTRYRVIRGLRLMKDKDLQNPWKK
                     HANMPL"
     misc_feature    complement(446164..447705)
                     /locus_tag="Mmc1_0386"
                     /note="Acetyl-CoA carboxylase, carboxyltransferase
                     component (subunits alpha and beta) [Lipid metabolism];
                     Region: COG4799"
                     /db_xref="CDD:227136"
     misc_feature    complement(446995..447609)
                     /locus_tag="Mmc1_0386"
                     /note="malonate decarboxylase subunit beta; Reviewed;
                     Region: PRK07189; cl17682"
                     /db_xref="CDD:248236"
     misc_feature    complement(446263..>446871)
                     /locus_tag="Mmc1_0386"
                     /note="Acetyl co-enzyme A carboxylase carboxyltransferase
                     alpha subunit; Region: ACCA; cl19172"
                     /db_xref="CDD:267525"
     gene            complement(449300..450298)
                     /locus_tag="Mmc1_0387"
                     /db_xref="GeneID:4482131"
     CDS             complement(449300..450298)
                     /locus_tag="Mmc1_0387"
                     /note="TIGRFAM: LAO/AO transporter ATPase;
                     PFAM: ArgK protein;
                     KEGG: eba:ebA3741 arginine/ornithine transporter ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="LAO/AO transporter ATPase"
                     /protein_id="YP_864319.1"
                     /db_xref="GI:117923702"
                     /db_xref="InterPro:IPR005129"
                     /db_xref="GeneID:4482131"
                     /translation="MRHTGQEYIAGVLAGNRRMVAKAITLVESSRAEDRLLAREVLAG
                     LMPHTGGALRVGISGPPGAGKSTFIEVFGLYLIEQGLRVGVLAVDPSSRRSGGSILGD
                     KTRMARLTGSRQAFIRPSPAGESLGGVARCTRESQLILEAAGYEIILIETVGVGQSET
                     LVAGMVDLFVLMALPNAGDELQGMKRGIMELADLVLVNKSDGAFVDAAQRTAGGIESA
                     LRLLHGGSVGWDPEVMTISAAEGRGLAEVWSLFSRFREGMTASGALAYKRQEQARAWM
                     WDLVRDGLTQRFMAHVQVKDILQGLELRVVAGEVTAVVAAELLLDRFTDGGGADGL"
     misc_feature    complement(449321..450283)
                     /locus_tag="Mmc1_0387"
                     /note="membrane ATPase/protein kinase; Provisional;
                     Region: PRK09435"
                     /db_xref="CDD:236515"
     misc_feature    complement(449324..450283)
                     /locus_tag="Mmc1_0387"
                     /note="Putative periplasmic protein kinase ArgK and
                     related GTPases of G3E family [Amino acid transport and
                     metabolism]; Region: ArgK; COG1703"
                     /db_xref="CDD:224617"
     gene            complement(450310..452454)
                     /locus_tag="Mmc1_0388"
                     /db_xref="GeneID:4482132"
     CDS             complement(450310..452454)
                     /locus_tag="Mmc1_0388"
                     /EC_number="5.4.99.2"
                     /note="MDM; functions in conversion of succinate to
                     propionate"
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA mutase"
                     /protein_id="YP_864320.1"
                     /db_xref="GI:117923703"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR006098"
                     /db_xref="InterPro:IPR006099"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006159"
                     /db_xref="GeneID:4482132"
                     /translation="MAHSKPTLADWQALATKSLKGKPLESLHWHSAEGIEVKSLYTSA
                     DLTAHGWESDTMPGMAPYTRGPYPTMYASRPWTIRQYAGFSTAEASNAFYKRALAGGG
                     QGISVAFDLATHRGYDSDHPRVVGDVGKAGVAIDSVEDMKILFDGIPLDKVSVSMTMN
                     GAVLPILAGYVVAAREQGVTEDQLSGTIQNDILKEFMVRNTYIYPPEPSMRIIGDIIV
                     YASEHMPKFNTISISGYHIQEAGADAALELAYTLADGKAYVETAISRGLTVDAFAPRL
                     SFFFGIGMNFFMEVAKLRAARLLWTRIMEGFKPSDPRSSMLRTHCQTSGWSLTSQDPY
                     NNVVRTTVEAMAAVFGGTQSLHTNALDEAMALPTDFSARIARNTQLILQEECHITHVV
                     DPWAGSYMMESLTRALAEKAWAIFEEVEAKGGMVKAIAAGLPSRRIEASAAERQARID
                     KGLDVIVGVNRYRPPQEDPVDVLVVDNDAVRTSQVARLQWVKANRDNAQVAEILARMT
                     AAAASGEGNLLALAIEATAARATGGEITSALEQVYGRFQDKAQATTGVYGKVWEEDET
                     WKALRRDIEAFAQEEGRRPRLLVVKMGQDGHDRGAKVIASAFADLGFDVDLGPLFQTP
                     EEAAQQAVENDVHVLGVSTLAGAHHTLIPALIRALCAEQAEDVLVVAGGVIPEQDYAF
                     LREAGVAEIFGPGTSVVDAAGRVLRAIRAKRG"
     misc_feature    complement(450313..452442)
                     /locus_tag="Mmc1_0388"
                     /note="methylmalonyl-CoA mutase; Reviewed; Region:
                     PRK09426"
                     /db_xref="CDD:236508"
     misc_feature    complement(450823..452433)
                     /locus_tag="Mmc1_0388"
                     /note="Coenzyme B12-dependent-methylmalonyl coenzyme A
                     (CoA) mutase (MCM) family, Alpha subunit-like subfamily;
                     contains proteins similar to the alpha subunit of
                     Propionbacterium shermanni MCM, as well as human and E.
                     coli MCM. Members of this subfamily contain...; Region:
                     MM_CoA_mutase_alpha_like; cd03679"
                     /db_xref="CDD:239651"
     misc_feature    complement(order(451357..451362,451369..451371,
                     451396..451398,451477..451482,451489..451491,
                     451495..451497,451501..451503,451618..451620,
                     451624..451626,451630..451632,451738..451740,
                     451747..451749,451858..451863,451894..451896,
                     451981..451983,451987..451989,452062..452064,
                     452113..452115,452122..452124,452128..452130,
                     452137..452139,452212..452214,452218..452220,
                     452224..452226,452233..452235,452245..452250,
                     452254..452256))
                     /locus_tag="Mmc1_0388"
                     /note="active site"
                     /db_xref="CDD:239651"
     misc_feature    complement(order(451396..451398,451489..451491,
                     451495..451497,451501..451503,451618..451620,
                     451624..451626,451630..451632,451747..451752,
                     451858..451860,451894..451896,451981..451983,
                     451987..451989,452137..452139,452212..452214,
                     452218..452220,452224..452226,452233..452235,
                     452245..452250,452254..452256))
                     /locus_tag="Mmc1_0388"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239651"
     misc_feature    complement(order(451357..451362,451366..451371,
                     451477..451482,451738..451740,451852..451854,
                     451858..451863,452062..452064,452113..452115,
                     452122..452124,452128..452130,452212..452214))
                     /locus_tag="Mmc1_0388"
                     /note="coenzyme B12 binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239651"
     misc_feature    complement(450334..450699)
                     /locus_tag="Mmc1_0388"
                     /note="methylmalonyl CoA mutase B12 binding domain. This
                     domain binds to B12 (adenosylcobamide), which initiates
                     the conversion of succinyl CoA and methylmalonyl CoA by
                     forming an adenosyl radical, which then undergoes a
                     rearrangement exchanging a hydrogen atom...; Region:
                     MM_CoA_mut_B12_BD; cd02071"
                     /db_xref="CDD:239022"
     misc_feature    complement(order(450352..450354,450370..450372,
                     450379..450381,450433..450435,450517..450525,
                     450529..450537,450646..450648,450655..450675))
                     /locus_tag="Mmc1_0388"
                     /note="B12 binding site [chemical binding]; other site"
                     /db_xref="CDD:239022"
     misc_feature    complement(450664..450666)
                     /locus_tag="Mmc1_0388"
                     /note="cobalt ligand [ion binding]; other site"
                     /db_xref="CDD:239022"
     gene            complement(452884..453864)
                     /locus_tag="Mmc1_0389"
                     /db_xref="GeneID:4482133"
     CDS             complement(452884..453864)
                     /locus_tag="Mmc1_0389"
                     /note="KEGG: bca:BCE0977 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864321.1"
                     /db_xref="GI:117923704"
                     /db_xref="GeneID:4482133"
                     /translation="MQPIHRYGLALSLTVIGVLGAVFLYNALWDPLWYFAGNQFRPVN
                     YTFDERLSKTNQFLRHPDSYDCFIFGSSRTTLLNPQQIKGYRCFNFAFSSGRIEEIVA
                     YARYVKKWNPNPKLIIVGVDLYNLAKWEDALSIPAFVQRMEKPPSALRSYLSWGAVAL
                     SRQLQRGQSPLPRYYDGQFICRVEDGLPPYQPALDRPSDRLKLPLGGHNLHHYAALAE
                     IFPHSQRLGYIPPESTRHVAFWLEHYRLETIINLYQQVKTHFTRFYDFALPSQITANP
                     AYTYDGSHYDLSVTQRIAHRLSGHVDEFGLEVTHDSTANWVTHYQSAINR"
     gene            complement(453873..455396)
                     /locus_tag="Mmc1_0390"
                     /db_xref="GeneID:4482134"
     CDS             complement(453873..455396)
                     /locus_tag="Mmc1_0390"
                     /note="PFAM: membrane bound O-acyl transferase, MBOAT
                     family protein;
                     KEGG: mca:MCA3074 alginate O-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane bound O-acyl transferase, MBOAT family
                     protein"
                     /protein_id="YP_864322.1"
                     /db_xref="GI:117923705"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="GeneID:4482134"
                     /translation="MLFNSYTFLLYFLPTVWAVTMLLRRYATEQLTLPWLVAASLFFY
                     GWWNPRYLLLILLSMGINYALAGMILQRRGSVALLTVGILVNLGLLGWFKYALFVGHT
                     LNQLLHSSWSLPQIVLPLAISFFTFQQIAYLVDCHRQQVDVHNPLHYMLFVTFFPQLI
                     AGPIVHHKEMMGQFRGAEALRPSATDLYVGLTIFIIGLGKKVLIADTLAPHADVIFNQ
                     AEAGGALSLVEAWLGVLAYTGQIYFDFSGYSDMAIGLGRLFGIHLPLNFNSPYKAHSI
                     IEFWRRWHMTLSRFLRDYLYIPLGGGHCAPWRRYTNLMLTMLLGGLWHGAGWTFMVWG
                     LLHGTYLMINHAWQHVGTKRFTLHPWFAVGLTFMAVVVGWVFFRATSFAGASHLLAAM
                     FGLHGVTLPATLAPWLPHWSWLNYTGIAPHGLLNHTTAIAQVGMALLAAWVLPNTYQM
                     MRQHVAPELANQLSHSQASFQGLLWRPTARWGIYTGLILAGVLLSLQQVSAFLYFQF"
     misc_feature    complement(454212..455393)
                     /locus_tag="Mmc1_0390"
                     /note="Predicted membrane protein involved in D-alanine
                     export [Cell envelope biogenesis, outer membrane]; Region:
                     DltB; COG1696"
                     /db_xref="CDD:224610"
     gene            455552..456688
                     /locus_tag="Mmc1_0391"
                     /db_xref="GeneID:4482135"
     CDS             455552..456688
                     /locus_tag="Mmc1_0391"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: dde:Dde_3316 glycosyltransferase-like"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_864323.1"
                     /db_xref="GI:117923706"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4482135"
                     /translation="MRLSFLCHEFPPTGGGAASALDHFTRVLVKRGHRVQILTIGLGA
                     KTLRETLDERQIIRYGVGRRSMLSPTTTELLRSYWALRHRSKRDLAEFKPDCSVAFFA
                     FPAGHALLKQRRRLTGPMAVSIRGSDIPGFSKKRWGLFQWLQPWLVRPVLEGADRVFA
                     NGETLATLTRAFAPHIAVTSIPNGVDTQQFSPADRAVGAHDGPLRVLSVGQLIPRKQV
                     ALLLAGAALLQRPLEITLAGSGPLEEPLKAQAAQLPPPIKVHFCGHTQREAMPQLYRA
                     HDLLVHLSGAEGVSNVALEALASGLPLLATPQALGPEFVGSRGVMVLHDPNEAALAEA
                     LLTLDSQRQRLGQMGHEARHFAERFDWQRAAAQFEAQMSRLWLA"
     misc_feature    455552..456676
                     /locus_tag="Mmc1_0391"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    455564..456676
                     /locus_tag="Mmc1_0391"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. wlbH in Bordetella
                     parapertussis has been shown to be required for the
                     biosynthesis of a trisaccharide that, when attached to the
                     B. pertussis lipopolysaccharide (LPS) core; Region:
                     GT1_wlbH_like; cd03798"
                     /db_xref="CDD:99971"
     gene            complement(456772..457656)
                     /locus_tag="Mmc1_0392"
                     /db_xref="GeneID:4482136"
     CDS             complement(456772..457656)
                     /locus_tag="Mmc1_0392"
                     /note="KEGG: pca:Pcar_0283 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864324.1"
                     /db_xref="GI:117923707"
                     /db_xref="GeneID:4482136"
                     /translation="MLKRLWSLLFALCLVPVVALSTAHAEVYFPYVLADIAAPTVDDG
                     LTQVKDRLSGAGFDVVGQYALNGDAQVLIATSGAQQALAAKSEHGGFGAATRISVTAV
                     EGTVQVAYTDPRWMAHAYRLEDDGSALLGRLTAALGNKQSFGSAAGMEKERLRLYQYM
                     IFMPDFEDVEKLASHSNYQAAVAAVEAGLQKGAGGTAKVYRIDIPGKEESLFGVALNE
                     GAGADKAVMGIIDTAPLKHTAHLPYEMLVSGGKVVMLHGKFRMAQSFPDLSMGTFMEI
                     SAAPDAIVEALSQAASGK"
     gene            complement(457954..461298)
                     /locus_tag="Mmc1_0393"
                     /db_xref="GeneID:4482137"
     CDS             complement(457954..461298)
                     /locus_tag="Mmc1_0393"
                     /note="PFAM: transglutaminase; transglutaminase,
                     N-terminal domain protein;
                     KEGG: sde:Sde_3099 transglutaminase-like superfamily
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase domain-containing protein"
                     /protein_id="YP_864325.1"
                     /db_xref="GI:117923708"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR013589"
                     /db_xref="GeneID:4482137"
                     /translation="MTIQVAIHHHTQYCYDRMVNLSPHVFRLRPAPHCRTPIRAYSLK
                     ISPGNHFINWQQDPFGNYLARLVFQEKTDQLTVDVEVVADMVTINPFEFFLEDSAKAF
                     PFAYEQALREDLTPYLKMTEESPALKKWLKDFKGSKGTVDFLVELNAKLNKDIGYTIR
                     MEPGVQTCEETFSRGTGSCRDTGWLLVQAMRQLGLAARFVSGYLVQLTPDVKSLDGPS
                     GPTEDFTDLHAWCEVYIPGAGWVGLDPTSGLFAGEGHIPLACTPIPASAAAVTGATDK
                     CETTFHYKNTVVRIHEDPRVTKPYSSSQWSDILTLGEDVDKLLKKEDVRLTMGGEPTF
                     VSVDDFESPQWTEAADGPHKRERAVDLLGRMRNHFAPGGIYHFGQGKWYPGEPIPRWR
                     YGCYWRTDGEPIWRDINLLGFPTVDYGYGADEAEAFMGELARRLGHLGKFVSPAYEDP
                     FYYVWAEAKLPVNLDPFKFNLKDGIERQKMAQVLQHGLQNPVGYVLPMAWNAYDQRWD
                     SCKWSFRREHLFLIPGNSAIGLRLPLESLFYQSPAERPLTPEQDLFDTLGRLPKYKQL
                     AKQAETKTAKKGKEPAIPPHPQVETFMQTALCVEVREGRLYLFIPPLTHVEGFLALVS
                     VIEATAQALGICILLEGYSPPEDPRLKKFYVTPDPGVIEVNVHPSAHWHEMVENTEAL
                     YEMAHQARLGTEKFMLNGRQNGTGGGNHVTLGGITPADSPMLRRPDLLASLITYWQHH
                     PGLSYLFSGLFIGPTSQAPRVDEGRDDALYELELALSQFPSGQVVQPWIVDRLLRNIL
                     VDVTGNTHRTEFCIDKLYSPDGPTGRLGLLELRAFEMPPHAQMSLVQMLLLRTIIARM
                     WKAPYRHPLIRWGTDLHDRYLLGHYVRRDMEEVVDDLNREGYPFQLAWLEPFFEFRFP
                     KWGEIQVGDIHLELRAGLEPWHVLGEEAGQSGTTRFVDSSLERMQVKVNGLHRDQYTV
                     MCNGFELPLHSTGINGEYVAGVRFKAWQPWAALHPLMPTHAPLVVDVVDLRNGRSLGG
                     CTYHVGHPGGRNYDTFPVNAYEAESRRISQFWNHGHTIGPFVPSPSPAGPGKFIPQGS
                     GKVAPTPPLPLRSNEFPHTLDLRRWG"
     misc_feature    complement(460516..461298)
                     /locus_tag="Mmc1_0393"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    complement(461044..461289)
                     /locus_tag="Mmc1_0393"
                     /note="Bacterial transglutaminase-like N-terminal region;
                     Region: Bact_transglu_N; pfam08379"
                     /db_xref="CDD:254765"
     misc_feature    complement(460564..460896)
                     /locus_tag="Mmc1_0393"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     misc_feature    complement(457966..460479)
                     /locus_tag="Mmc1_0393"
                     /note="Putative amidoligase enzyme (DUF2126); Region:
                     DUF2126; pfam09899"
                     /db_xref="CDD:255627"
     gene            461462..463990
                     /locus_tag="Mmc1_0394"
                     /db_xref="GeneID:4482138"
     CDS             461462..463990
                     /locus_tag="Mmc1_0394"
                     /note="PFAM: protein of unknown function DUF403; protein
                     of unknown function DUF404; protein of unknown function
                     DUF407;
                     KEGG: sde:Sde_3098 protein of unknown function DUF403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864326.1"
                     /db_xref="GI:117923709"
                     /db_xref="InterPro:IPR007296"
                     /db_xref="InterPro:IPR007297"
                     /db_xref="InterPro:IPR007302"
                     /db_xref="GeneID:4482138"
                     /translation="MTPKAIPIVDGAAGPAYDEAFEQPGKPRAHWRRYLDYLYSRGPQ
                     LPVQLERDADRLMRELGVTYNLHGGSGRRGQPWPFDPIPLILDTGNWKALEEGVIQRH
                     RLLTLLHRDIYGKQTSVRQGLLPPELLYRCGQFLFAAHGATPEDMIPMPLYGVDLIRD
                     RDGRHKVVSDRTSSPSGHGYVLQNRRVMNRLYAESSQFNNVPVLLPFFKSMRSRLAGL
                     TPYAKHDAHVVLLSPGPANEIYVEHALLAHYLGLILSQGADLTVRNGRLWIKSLSGLL
                     PVDVLLRKVDESFCDPLELRDDSRLGVVGLTQVARSGRLALANALGTAMLENLALHAY
                     LPRLARFFLDEPLLLENPYTLWMGDPLHRQLVAEEPHRFVILPARYDPSTPMNGLSRD
                     EALEQALLEQPHAFVARERLYPSRTPSVQRGQITSQPVQMRLYLNSDGEDTAVMPGGL
                     ARVSPQVERLTFSPRQGGLSKDIWVMHDHPIEDRGGVITATSIDPSPMVGVPSRVAES
                     LFWLGRYMERSESAIRLFREHLMLQTQETGLGVRQRIHCRNRFLVAFTRVTGTRPGFE
                     GEEGAYNLANPAPELRSALLDSDRAGSLAFSLRAMIQNAFSVRDRLSTDTWHVVDDIA
                     TVLDRLQQDPDKDLQNLFWETAPLLHGLTAFSGLIWENMYRDLGWRFLDMGRRMERGL
                     FLTHLLETTLGSDADDSLEIAVLERLLAINDSLAAFRMRYRTQLGVPQVLEKLLQDET
                     DPRSLVFQLELMEKHARAVATGADESFYRTHLGRVVFEALATVRLATPELLSKPEKAG
                     GSRTHLVALLKLMKKFLPLFSESASNSYFRHAEATHLLFKTGSE"
     misc_feature    461498..462919
                     /locus_tag="Mmc1_0394"
                     /note="Circularly permuted ATP-grasp type 2; Region:
                     CP_ATPgrasp_2; cl17448"
                     /db_xref="CDD:248002"
     misc_feature    462962..463942
                     /locus_tag="Mmc1_0394"
                     /note="A predicted alpha-helical domain with a conserved
                     ER motif; Region: Alpha-E; pfam04168"
                     /db_xref="CDD:252423"
     gene            463990..464877
                     /locus_tag="Mmc1_0395"
                     /db_xref="GeneID:4482139"
     CDS             463990..464877
                     /locus_tag="Mmc1_0395"
                     /note="PFAM: transglutaminase; transglutaminase,
                     N-terminal domain protein;
                     KEGG: mag:amb0821 transglutaminase-like enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase domain-containing protein"
                     /protein_id="YP_864327.1"
                     /db_xref="GI:117923710"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR013589"
                     /db_xref="GeneID:4482139"
                     /translation="MEYRIKHTTLYQYSEPVTLCHNRAILKPKDGMGQKCHKFTLRID
                     PEPAIMESHKDAFGNTVHYFEIHEPHKQLEITATSQLTRTPVLLPPMAMENSPAWESV
                     RSQFDAGDGNEDMVHVALYRMPSPMIPALPALAELTDPIFTPGRPILEATMAFTQAIH
                     EGFKYDPEATTIATPITAVLAQRAGVCQDFAHIAVGALRQIGLAARYVSGYLETLPPP
                     GQPRLEGADASHAWFSLYLPGLGWVDFDPTNGCMTESHHLVVAVGRDYADVPPVKGVV
                     MGGWEHTLEVAVDVVRQTV"
     misc_feature    463990..464859
                     /locus_tag="Mmc1_0395"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    463996..464229
                     /locus_tag="Mmc1_0395"
                     /note="Bacterial transglutaminase-like N-terminal region;
                     Region: Bact_transglu_N; pfam08379"
                     /db_xref="CDD:254765"
     misc_feature    464392..464730
                     /locus_tag="Mmc1_0395"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     gene            465047..466126
                     /locus_tag="Mmc1_0396"
                     /db_xref="GeneID:4482140"
     CDS             465047..466126
                     /locus_tag="Mmc1_0396"
                     /note="KEGG: pca:Pcar_0073 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864328.1"
                     /db_xref="GI:117923711"
                     /db_xref="GeneID:4482140"
                     /translation="MEKPCKVVGLVQCKNEWGLIALSITHALRNHVDEVFVLNDSSSD
                     ESYQGLLKLQTLFPGRLHLYHMLGDEFLEDSSRTVLMHLSQSAQADWCYTFDADEFLY
                     TTTGVSLKALLSTVAADVGALRYPLYNYLSLDTFDECQLHGYAALQWQAQVTQRAPIT
                     LAQIIEGVRQGERNLFTLPFFPKLIVRNDPMLRLHVGAHTVRDFNRTPKRLMHADTVA
                     VVHLPMLSWARLQRKARMGQIFVESGVSPQLGWQNQLVYRMQQEGRLPQMWRQHSLSA
                     EGQLEPDRPRNVVQDRRFVTLIAPTLKFLEEAFQSKDLRVFRGERLQRGAAPESTLPL
                     QSVVRLLHRFMGFEARYDEQLHQPK"
     misc_feature    465086..465385
                     /locus_tag="Mmc1_0396"
                     /note="Glycosyl transferase family 2; Region:
                     Glyco_tranf_2_4; pfam13704"
                     /db_xref="CDD:258002"
     gene            complement(466222..466947)
                     /locus_tag="Mmc1_0397"
                     /db_xref="GeneID:4482141"
     CDS             complement(466222..466947)
                     /locus_tag="Mmc1_0397"
                     /note="PFAM: methyltransferase type 11;
                     KEGG: nar:Saro_0725 chromosome segregation ATPases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_864329.1"
                     /db_xref="GI:117923712"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:4482141"
                     /translation="MHQTALWHAALFFSTYHSRSQPESHPAQTSKRLLEIGGQNVNGS
                     IRDVAPEGIHYIAADFVAGNGVDVVLDDPYSLPYGENSFDYVMASSVFEHSQMFWLLH
                     LEIMRVLKPSGLFYLNAPANGQFHRFPVDCYRFYPDAGGGLVTWANRNGYQSALLESF
                     VGKQKQDEYWNDFVAVFIKDETHHAHYTARMLDKHPSFNNGLRYPDPESFIRLNPISE
                     DQRKLFAMTNMAQNRPLNHYLRD"
     misc_feature    complement(466597..>466761)
                     /locus_tag="Mmc1_0397"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     gene            complement(467058..468056)
                     /locus_tag="Mmc1_0398"
                     /db_xref="GeneID:4482142"
     CDS             complement(467058..468056)
                     /locus_tag="Mmc1_0398"
                     /note="PFAM: protein of unknown function DUF403;
                     KEGG: sde:Sde_3100 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864330.1"
                     /db_xref="GI:117923713"
                     /db_xref="InterPro:IPR007296"
                     /db_xref="GeneID:4482142"
                     /translation="MLSRVAEHIYWLGRYMERAEDTARLIMATSGATLELMSVPGHQP
                     VDWEQLLLIVGVLPNYNEHHHTYEEREIVHFLLASERNPCSIYNAMRMARENLRITRD
                     AFPRETWSQINGLRRRVEHIPDFALYGSGRQDLLEGIIGSCLQMSGLLISTMSRDEAY
                     QMFRLGQLLERADMTTRILDVQGAGVLGGDSDAELSMEHAVWTTVLRSLSGDQMYRKQ
                     VEPRVRGRQTLAFVLKDKQFPRAFYYCLNGVRDRLVKLGRAEAAQGILGELEKSLYLA
                     DLDTLAKQGLHEFLDGLQVQLGSLHEAVVDTYFRFRQEETPPAAPASQTQSQEQRA"
     misc_feature    complement(467130..468056)
                     /locus_tag="Mmc1_0398"
                     /note="A predicted alpha-helical domain with a conserved
                     ER motif; Region: Alpha-E; pfam04168"
                     /db_xref="CDD:252423"
     gene            complement(468056..469510)
                     /locus_tag="Mmc1_0399"
                     /db_xref="GeneID:4482143"
     CDS             complement(468056..469510)
                     /locus_tag="Mmc1_0399"
                     /note="PFAM: protein of unknown function DUF404; protein
                     of unknown function DUF407;
                     KEGG: hch:HCH_00983 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864331.1"
                     /db_xref="GI:117923714"
                     /db_xref="InterPro:IPR007297"
                     /db_xref="InterPro:IPR007302"
                     /db_xref="GeneID:4482143"
                     /translation="MAAKNLPTTGLTYEAPGLFDELIHYAQSNTGCDLLPHLLDMGLD
                     TLRTRQQGAELAIESLGITFTIYSEGQNIDRAWPFDIIPRCIPDGEWQQLEAGLLQRS
                     QALNAFIHDLYNDQKIIKDKKFPGELLDKSKNFLPPLIGANPRFGVWAHVCGSDLIRD
                     KDGVMYVLEDNLRVPSGVSYMLENRQLTKRVFPELFQRYHIRPVDDYPSQLYDVLASL
                     HPRDQKPNIVVLTPGVYNSAYFEHAYLAQQMGVELVEAGDLLVDDDKVYKKTIRGLQR
                     VDVIYRRVDDLYMDPTVFIPDSLLGIPGIIKSWLKGNVAIANAPGSGVADDKVVYSYM
                     PDIIRYYLGEEAKIPNVPTYRCNDPVERRHVIKNMHQLVIKPANESGGYGIMIGNRAT
                     RVEREAYAARIEEDPRNYIAQPILSPSTCPTLVEEGMEPRHLDLRPFILQGKKGYVTA
                     GGLTRVALRRGSLVVNSSQGGGSKDTWIVAGRRD"
     misc_feature    complement(468065..469393)
                     /locus_tag="Mmc1_0399"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2308"
                     /db_xref="CDD:225190"
     gene            469978..470940
                     /locus_tag="Mmc1_0400"
                     /db_xref="GeneID:4482144"
     CDS             469978..470940
                     /locus_tag="Mmc1_0400"
                     /note="TIGRFAM: hemerythrin-like metal-binding protein;
                     PFAM: response regulator receiver;
                     KEGG: mag:amb1682 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_864332.1"
                     /db_xref="GI:117923715"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002063"
                     /db_xref="InterPro:IPR012827"
                     /db_xref="GeneID:4482144"
                     /translation="MLLTKLAQELKPLIRPNVSVLYAEDHGETRLIVTEQLFKPLGIA
                     VKACNDGFSAAQAFSTGHYDMLVTDFDMPNMTGSELLKHVRKSNANMPVLLLTSLATL
                     EIVRSIKDNNLFVLPKQEFNRFLDDARGESADEKRLSAKQTLVKFLEASGAIKPSSMG
                     GKNYAPPAKAKLVPSDEAKLKKIGAAGPCEFPLLGISLVDQQHRQLFQLMYALQAQIE
                     NRDNRVDLMIMALNNYANKHLADEEALLQRYAYPRLADHQKLHIKLREDLVQRAHAVK
                     QAADDNEKFKRAEELRDFIQEWLVSHIGSEDRKHCDYLLSKGAV"
     misc_feature    470038..>470295
                     /locus_tag="Mmc1_0400"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(470047..470052,470182..470184,470206..470208,
                     470266..470268)
                     /locus_tag="Mmc1_0400"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    470182..470184
                     /locus_tag="Mmc1_0400"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(470191..470196,470200..470208)
                     /locus_tag="Mmc1_0400"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    470572..470904
                     /locus_tag="Mmc1_0400"
                     /note="Hemerythrin; Region: Hemerythrin; cd12107"
                     /db_xref="CDD:213982"
     misc_feature    order(470584..470586,470689..470691,470701..470703,
                     470746..470748,470758..470760,470881..470883,
                     470896..470898)
                     /locus_tag="Mmc1_0400"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:213982"
     gene            471369..472616
                     /locus_tag="Mmc1_0401"
                     /db_xref="GeneID:4482145"
     CDS             471369..472616
                     /locus_tag="Mmc1_0401"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase A domain protein domain
                     protein;
                     KEGG: mag:amb3447 signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver sensor signal
                     transduction histidine kinase"
                     /protein_id="YP_864333.1"
                     /db_xref="GI:117923716"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:4482145"
                     /translation="MSGADIKKKLVFKQKSKQPEQVSDQPPWVLGVVDDEPHLHEVTA
                     HVLRNFSFQGRRVELVQGYSGAEAKQLVCNHPDMAVLLLDVVMESDHAGLDVVEYVRD
                     VLGNQSLRIVLRTGQAWLFPEDEVFEKYDINDYLDKAELSAHRMKVALKAAFRSFETM
                     RDLERSQQREQVLRQIAEQASQAKSDFVASLGHELRSPTQSIMGFNRYVMDAVSQSNI
                     EPDVKAEIAKFIRYAQISSERLAGLINNLLDLSKLESGRMEFAIEPHNIWDAVRFLQM
                     EMEPLLQEKGVTLEHPQCTEPLELLFDMGKIIQVLVNLLSNAIKFTPAGGVIRITAHA
                     LDTGRVKIAVSDSGRGIPEEEIEHIFGRYQQSTSNQQSDGGTGLGLAIAREICLNHGD
                     SLVAENNPNGVGACFSFTLAVVG"
     misc_feature    471462..471830
                     /locus_tag="Mmc1_0401"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     misc_feature    order(471468..471473,471618..471620,471645..471647,
                     471711..471713,471771..471773,471780..471782,
                     471786..471788)
                     /locus_tag="Mmc1_0401"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    471618..471620
                     /locus_tag="Mmc1_0401"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(471627..471629,471633..471638,471645..471647)
                     /locus_tag="Mmc1_0401"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    order(471780..471782,471786..471791)
                     /locus_tag="Mmc1_0401"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    <471858..472601
                     /locus_tag="Mmc1_0401"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    471909..472124
                     /locus_tag="Mmc1_0401"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(471927..471929,471939..471941,471951..471953,
                     471960..471962,471972..471974,471981..471983,
                     472053..472055,472065..472067,472074..472076,
                     472086..472088,472095..472097,472107..472109)
                     /locus_tag="Mmc1_0401"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    471945..471947
                     /locus_tag="Mmc1_0401"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    472287..472601
                     /locus_tag="Mmc1_0401"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(472305..472307,472317..472319,472326..472328,
                     472398..472400,472404..472406,472410..472412,
                     472416..472421,472497..472508,472554..472556,
                     472560..472562,472578..472583,472587..472589)
                     /locus_tag="Mmc1_0401"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    472317..472319
                     /locus_tag="Mmc1_0401"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(472410..472412,472416..472418,472497..472499,
                     472503..472505)
                     /locus_tag="Mmc1_0401"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(472662..475031)
                     /locus_tag="Mmc1_0402"
                     /db_xref="GeneID:4482146"
     CDS             complement(472662..475031)
                     /locus_tag="Mmc1_0402"
                     /note="KEGG: dde:Dde_3113 PAS/PAC sensor signal
                     transduction histidine kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region, ATPase domain protein domain
                     protein; hypothetical protein; PAS fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_864334.1"
                     /db_xref="GI:117923717"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4482146"
                     /translation="MSIRTQIVTLLLLFALLVAGLYGWVLNRHNNDALLFAADQKLGA
                     AAALVAQILPVEYHDHIEGADSVSQKKYQSIVQNYNRLCQELKLDGMWSVLWLDKQPY
                     LTSSTSRSLVLQQGDYPPFFAPHPHPELFSENTTTPDYRTITQKGVPLRMIQLPQLDK
                     RGRLYIIGATLPLLPLQEALLETVSPALTLVLVFFTLLLLFGFLGSAWISQPLQQLVR
                     LAPQQTARAALVMLERTGSPEVETLLASLNALSKDFTDQCALNRTYQHLSYAMDTSPI
                     ATAILDNRGRLLYANARFRAAAGGQELTQPGAHMDQFQLGFPAALDRSWRKHVSLSQP
                     WAAEVETNVSGAASGYERVTITPFRNSNHAEHAILFTLQNVARRKKLEQELRHEINFQ
                     RVLMNTLPIPVFFKDTQGVFLGCNAAYCTLLGMAEWEIVGRTIFQILPNEAASFYHKK
                     DNLVLQGGGLLDYEGYLRNSTGQERLLHLFTAPFHNADRSLAGLVAAIVDITDRVLFE
                     SKIMQMNADLELRVVERTRDLEESMESVQRLQRLLVETETMATLGTMVAGVAHEVNSP
                     LGVGVMASSELQQEVAKFRKTYETEGISEEEFEGFIHRSEDLLGLTVTNLRRAGELLQ
                     NFKRVAVDQSDEAQHVFQLDEQIEAVLHALSYLFRKRAIQMRLECPKGLTIKSLPGAV
                     SQIVTNLISNAIKHGFDVGMRGTITLTVKRHDQQIILDFYDDGKGMDQETQEKIFERF
                     FTTQRGSGGSGLGMHIVQSLVVQKLRGSIHCESELGKGTRFVVTFPVEA"
     misc_feature    complement(<474132..>474356)
                     /locus_tag="Mmc1_0402"
                     /note="Lyase class I_like superfamily: contains the lyase
                     class I family, histidine ammonia-lyase and phenylalanine
                     ammonia-lyase, which catalyze similar beta-elimination
                     reactions; Region: Lyase_I_like; cl00013"
                     /db_xref="CDD:260138"
     misc_feature    complement(473508..474203)
                     /locus_tag="Mmc1_0402"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(472668..473855)
                     /locus_tag="Mmc1_0402"
                     /note="Signal transduction histidine kinase, nitrogen
                     specific [Signal transduction mechanisms]; Region: NtrB;
                     COG3852"
                     /db_xref="CDD:226370"
     misc_feature    complement(473529..473837)
                     /locus_tag="Mmc1_0402"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(473616..473618,473631..473633,
                     473709..473720,473757..473759,473775..473777,
                     473787..473789))
                     /locus_tag="Mmc1_0402"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(473589..473591,473595..473597,
                     473679..473684,473691..473693,473715..473717,
                     473727..473729))
                     /locus_tag="Mmc1_0402"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(472677..472982)
                     /locus_tag="Mmc1_0402"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(472689..472691,472695..472700,
                     472713..472715,472719..472721,472770..472781,
                     472848..472853,472857..472859,472863..472865,
                     472869..472871,472947..472949,472956..472958,
                     472968..472970))
                     /locus_tag="Mmc1_0402"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(472956..472958)
                     /locus_tag="Mmc1_0402"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(472773..472775,472779..472781,
                     472851..472853,472857..472859))
                     /locus_tag="Mmc1_0402"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(475137..477728)
                     /locus_tag="Mmc1_0403"
                     /db_xref="GeneID:4480887"
     CDS             complement(475137..477728)
                     /locus_tag="Mmc1_0403"
                     /note="TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; EAL domain protein;
                     histidine kinase, HAMP region domain protein;
                     KEGG: tdn:Tmden_0909 diguanylate cyclase/phosphodiesterase
                     (GGDEF & EAL domains)"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_864335.1"
                     /db_xref="GI:117923718"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="GeneID:4480887"
                     /translation="MASPLFLYNPLKSIKGFILSIAVGATLLMSLSLYWVISDIYERS
                     VRNDARKVATLMAEQTFQSMYQVMRKGWVRRDVEDFIGALRRSVEGGDYRLEVLRAPL
                     VEELFGPIHQPALDEAVGEVVGTAERKLIDQPTSLRLIYPLLAREECLKCHTNANVGN
                     VLGVIDVQQNLVPILRRTRAEFINTLLWIAPIPLLAAFFVALWIHGRLVGALNYLRDR
                     MTRINKVSDLTQLNEGTPPPTFCEVSEILEQINDFSRRLQSFAVDKELLEFEIRLLER
                     FVITSDVVKDWQNYVKQLLLEINQVMSTYALFSIFKVEEEQFDLEIFWRDPPSADTRM
                     GIESIICTELQKNNSFHVDSSVTRINHHVARPDASEMVVNPEVFRLQIKSLVVELPKI
                     GGIVGIGVHVDLTRDPTRILVMESTLSTLLNVVGSVKAISKYTRDLEFYATRDPLTGL
                     YNHRILWELLRTEVERAHRHNHQFALLLVDLDNFKTINDSHGHAVGDDLLIAFADQIG
                     ATLRQGDILGRHGGDEFVIMLPEVEEGVPFAAAERILSATDKIRVQTHDGQSIGISAS
                     IGVAIFPDHANSAKDLFLFADNMMFKAKAEGKHRFTIPSEEDVVDAFKEIGEKSALVM
                     RAIEEKWVQPFYQPIFDGHTGEVVAHEVLSRIQVPDARLYSANEFIEIAERLGVVHKL
                     DYVGMEKAFNQAGREGYEGLLFINMSPKAMVLSEFFPTVKKMIEAAGLQKQNIVFEIT
                     ERDTVRNLKNLEIFIRNLHGEGYKFAIDDFGSGFSSFHYLKRFPIDYLKIEGEFIAHM
                     LDDVKDLAFVRSMAMLARDLGIATVGEFVESAAIAQECRTSGVSLLQGYHLGRPSAHF
                     ITNKVKV"
     misc_feature    complement(476952..477173)
                     /locus_tag="Mmc1_0403"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(475926..476402)
                     /locus_tag="Mmc1_0403"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(476160..476162,476289..476291))
                     /locus_tag="Mmc1_0403"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(476157..476168,476172..476174,
                     476238..476240,476250..476252,476262..476267,
                     476274..476276))
                     /locus_tag="Mmc1_0403"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(476100..476102,476184..476186))
                     /locus_tag="Mmc1_0403"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(475173..475856)
                     /locus_tag="Mmc1_0403"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            478142..478981
                     /locus_tag="Mmc1_0404"
                     /db_xref="GeneID:4480888"
     CDS             478142..478981
                     /locus_tag="Mmc1_0404"
                     /note="TIGRFAM: thymidylate synthase, flavin-dependent;
                     PFAM: thymidylate synthase complementing protein ThyX;
                     KEGG: nse:NSE_0163 thymidylate synthase, flavin-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase, flavin-dependent"
                     /protein_id="YP_864336.1"
                     /db_xref="GI:117923719"
                     /db_xref="InterPro:IPR003669"
                     /db_xref="GeneID:4480888"
                     /translation="MEASTGTAFQSEPTLEMAAEIETRLQLNPDYTKRIGNFGFLELE
                     ESWGDEATIINTARISTTNKRVNSLDAFTDKERTLLHYLLAHNHGTPFETVHFRFRVV
                     APIFVLRQWMRHRICSFNEFSQRYRMPITAFYVPDQEARTVDGFEVLSQESVERYCEL
                     VESMHRFYHDEYQQVCTRIEAAEQAGLVEKTAGSRNPYRARARELLRNAMPVSTYSDL
                     YWTINFRALMNFFELRRKANAQYEIRAYADAAYEMFCKKMPLLGETMNRVLEERAKMG
                     EQA"
     misc_feature    478268..478924
                     /locus_tag="Mmc1_0404"
                     /note="Thymidylate synthase complementing protein; Region:
                     Thy1; pfam02511"
                     /db_xref="CDD:251342"
     gene            478978..479739
                     /locus_tag="Mmc1_0405"
                     /db_xref="GeneID:4480889"
     CDS             478978..479739
                     /locus_tag="Mmc1_0405"
                     /EC_number="2.1.1.33"
                     /note="KEGG: eba:c1A43 tRNA
                     (guanine-N(7)-)-methyltransferase;
                     TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
                     PFAM:  methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="YP_864337.1"
                     /db_xref="GI:117923720"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR004395"
                     /db_xref="GeneID:4480889"
                     /translation="MSQTPMPQPDQAPPVDVGQPVDEAEAKRRRFKTHGRKKGKVNDT
                     RLARIEAGLLALSLPPGSADRGALIDQLGGNGQSQRVILEIGFGNGETLAALAARHPE
                     DCFIGIDVFLEGFGTLLNRLTRGDISNVRLVCQNALQVLLERIPDASLDGVIINFPDP
                     WRKKRHFKRRIVQTEFLDALAPKMRSGADLTLATDWANYAEWMVAHLEPHTAFVNQAE
                     PGPFAAPPPWWIETNFERKGVAAGRIIRHLHYKKR"
     misc_feature    479077..479691
                     /locus_tag="Mmc1_0405"
                     /note="tRNA (guanine-N(7)-)-methyltransferase; Reviewed;
                     Region: trmB; PRK00121"
                     /db_xref="CDD:234649"
     misc_feature    479221..479523
                     /locus_tag="Mmc1_0405"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(479230..479247,479251..479253,479302..479307,
                     479380..479388,479443..479445)
                     /locus_tag="Mmc1_0405"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            479859..480380
                     /locus_tag="Mmc1_0406"
                     /db_xref="GeneID:4480890"
     CDS             479859..480380
                     /locus_tag="Mmc1_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864338.1"
                     /db_xref="GI:117923721"
                     /db_xref="GeneID:4480890"
                     /translation="MILKQVGMTALLMMGMGSHGAMAADCAQLPNKMAKVRQHAQVFT
                     QMNAETQALCWTKHPYFQELDGETCPRYQDNFAMGVARMDAVLGGIKYATTQLTAMGA
                     YGAELTRCSAPYMVQKSHLVGQTSQLLKALQTLGVKADECREAHERLGIWCDKQVALK
                     TMQEIQPAVPVKE"
     gene            complement(480413..481564)
                     /locus_tag="Mmc1_0407"
                     /db_xref="GeneID:4480891"
     CDS             complement(480413..481564)
                     /locus_tag="Mmc1_0407"
                     /note="PFAM: aldo/keto reductase;
                     KEGG: gvi:gll3752 probable oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="YP_864339.1"
                     /db_xref="GI:117923722"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="GeneID:4480891"
                     /translation="MEYRRFGQTEKQISVFTMGGMRFLHVWDKPHDQLPADSEEHCYQ
                     MLQTALDGGINLIETAKGYGKSERLIGRALPRLRQSRDQYHLMTKASPTETAGQMRRH
                     VEDALRHMGVDHIDFFALHGINTRPLLRLSLRSGGPMSALEALQREGKIGHIGFATHA
                     PLPVILDTIQSGRFAFINLHYYFFRQGNRTAIEAAAARDMGIFIISPQDKGGLLYTPP
                     PRLAEQSAPLPIANFNERWILSHPAIHTMTVGMSEPSHLDLHLHSLALGKPYWGAAER
                     AVEIRLKQAAATTELDRCGHCTACLPCPERIEIPDLLRLEHLARAHDMVAFAQYRYGL
                     MEPNCHWVPGAHGDRCSDCGDCLPRCPQGLDIPLLVRQAHTRMHKASGS"
     misc_feature    complement(480419..481564)
                     /locus_tag="Mmc1_0407"
                     /note="Predicted oxidoreductases of the aldo/keto
                     reductase family [General function prediction only];
                     Region: COG1453"
                     /db_xref="CDD:224370"
     misc_feature    complement(480791..481558)
                     /locus_tag="Mmc1_0407"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(480797..480799,480812..480823,
                     480935..480952,481031..481033,481091..481096,
                     481199..481204,481298..481300,481376..481378,
                     481391..481393,481502..481510))
                     /locus_tag="Mmc1_0407"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(481202..481204,481298..481300,
                     481376..481378,481391..481393))
                     /locus_tag="Mmc1_0407"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     misc_feature    complement(480470..480688)
                     /locus_tag="Mmc1_0407"
                     /note="4Fe-4S dicluster domain; Region: Fer4_17;
                     pfam13534"
                     /db_xref="CDD:257853"
     gene            complement(482389..484818)
                     /locus_tag="Mmc1_0408"
                     /db_xref="GeneID:4480892"
     CDS             complement(482389..484818)
                     /locus_tag="Mmc1_0408"
                     /note="KEGG: noc:Noc_2021 PAS sensor diguanylate
                     cyclase/phophodiesterase;
                     TIGRFAM: PAS sensor protein; diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; EAL domain protein;
                     PAS fold-4 domain protein; PAS fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_864340.1"
                     /db_xref="GI:117923723"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:4480892"
                     /translation="MIIGGWNFHALRFFRPSHMGGKPKRGEDPRGDIRMAVRRSKVMV
                     PLLGGFVVLLTVMVGMWGYNYKTSEALIGTLQGSMTTVHKMHIISELMEVIRARTRIA
                     AVMLDENDVFENDRRKMELDGLANRFITLRSELLKLPLDQVEKRILHDLSTNVIPTTV
                     KSLQEVIEVALWVEDSALRDAARRKLFNTVQPGQGQVIDHFMQFQTHLETQITQATAV
                     TISSYRTNLHSQLLVLLLVLLVVLLTSYITMRRVMGIESTLHYEKERAQITLISIADG
                     VITTDTEGYIQDANKVVGALLGHKPASLIGKQLEQVFPTRARDEESPPLHEDLKTLLS
                     SATPQSMNTMVVLESDGDDLLLDATLSPVQSSEGVVLGAIITVKDVTEQQRMSEKIRY
                     QARHDHLTGLYNRHAFADLCRESMEAMKADEVHCLCVIDLDRFKAINDTCGHKAGDMA
                     LKQISTMIQGCVRKYDYAARIGGDEFTIFLADCSQADGVKVMEKLLEQVQDYRFLWEG
                     QQFNLGFSIGICEIHFQVPFEKSFQAADAAVFQAKDDGRMCIRTRTVESNLLETPTKE
                     ETNWVGRLHRVLGVEPLALVAQRMVPSPSMQDHPPLYEIFMRLPDGEKHHPPNAFLPT
                     AERHGLTGDLDYKVLKMALDNLLLHSDGRIYSINLSAKTLEDKASSAALLALLAAHPK
                     RAKQICFEIDENTLINNMEVCSQFLFEVKQHGAVTALDNYGGSLGNCLYLEQLGLDIL
                     KVDGQLVQQAKNKLSTRTVVSSIHNISHSMNILTVAKHVEDAELAAQLLTIGFDFQQG
                     FYYAKPEPLMV"
     misc_feature    complement(<484141..>484497)
                     /locus_tag="Mmc1_0408"
                     /note="metal ion transporter CorA-like divalent cation
                     transporter superfamily; Region: MIT_CorA-like; cl00459"
                     /db_xref="CDD:260436"
     misc_feature    complement(483679..484002)
                     /locus_tag="Mmc1_0408"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(483673..483996)
                     /locus_tag="Mmc1_0408"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(order(483766..483768,483781..483783,
                     483874..483885,483922..483924,483940..483942,
                     483952..483954))
                     /locus_tag="Mmc1_0408"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(483739..483741,483745..483747,
                     483832..483837,483856..483858,483880..483882,
                     483892..483894))
                     /locus_tag="Mmc1_0408"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(483166..483636)
                     /locus_tag="Mmc1_0408"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(483397..483399,483526..483528))
                     /locus_tag="Mmc1_0408"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(483394..483405,483409..483411,
                     483475..483477,483487..483489,483499..483504,
                     483511..483513))
                     /locus_tag="Mmc1_0408"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(483337..483339,483421..483423))
                     /locus_tag="Mmc1_0408"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(482398..483105)
                     /locus_tag="Mmc1_0408"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(485153..486040)
                     /locus_tag="Mmc1_0409"
                     /db_xref="GeneID:4480893"
     CDS             complement(485153..486040)
                     /locus_tag="Mmc1_0409"
                     /note="KEGG: reu:Reut_B4998 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864341.1"
                     /db_xref="GI:117923724"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="GeneID:4480893"
                     /translation="MTMFYPRALTIRRHVATLLLGGLLLSGCQSNPYTSRLHKMARQA
                     MLSYHLLPGVTFDLASWQRTETPGAVLHLYVESSGFVQQGGGQLSQDPTPHHPMAFYL
                     AAVDPHPNVAYLARPCQYVLENPQQRRNCAPRYWSSHALDDVVMADLLRATDWLQHAA
                     GATQIHLIGVGSGASAAAWLSAKRPAVTRFLSVDGIFTPQAAPPLELPPPSELPPSLS
                     TMEAFNLLAQQLASVPQRHYITGLDHTLSSNHIQPFIITMGRHACAHVALHRYADLNQ
                     LLKHWPSLLTEPLHCADRS"
     gene            486406..488379
                     /locus_tag="Mmc1_0410"
                     /db_xref="GeneID:4480894"
     CDS             486406..488379
                     /locus_tag="Mmc1_0410"
                     /note="KEGG: gme:Gmet_0069 diguanylate cyclase (GGDEF
                     domain);
                     TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; HDOD;
                     SMART: GAF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_864342.1"
                     /db_xref="GI:117923725"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR013976"
                     /db_xref="GeneID:4480894"
                     /translation="MASVLTQGDIASLGLPNTLLELLQSTRLERTNAADVVAIVERSP
                     DLAQAVLDCTGESERGLHGAVVQMGFNALRATALERLIFKHFITVQPAKESSFDRMTL
                     WRHNLWVACACRHIANQVGYGDCEEAYMTGLLHDLGKLLIDALGAMDYAALQEISMRT
                     DWDGVTYERSLLGVGHDGVGAHTLHKWGMNTSVVLAVALHHSRYQAKEIGQQAAQLTA
                     IVQLADFLAWIQGLGSTVRGQHPVLPPEVSLYLPLNRAAYATIVEQVNGEIKRIAAHD
                     GIDFPDSLTFNRNLLDAGISLARVNTELKYDNRLKYQPKLAAVPLPSPVQETLLAPHK
                     SLIKKEILHNTLESVCAAFQVKRGVVFHVDPVKRCLVNEAIYSTDSDLLMPLKHLQEI
                     PLNDEPSAFLECLRQRKQFLLSGQTPLEKQVRNQIGARQMALTPIVGPQRAYGIIALD
                     NGRDGADLNLAGLASLTQVAHELGMALEHAQQLQIANQMAHRDALTKLYNRGRIDEIV
                     QEAFQQVQQQGGELSVAMLDVDFFKKFNDTFGHQMGDNVLKLVAAVLKKLTRGNGSVG
                     RYGGEEFIVVLRDTDYREAARYCERIRLAICQVGEAMARRYAGRPLSISIGVTCYDAS
                     LVSKDEMVRLADRALYMAKDGGRNQVIGLKPGG"
     misc_feature    486706..487086
                     /locus_tag="Mmc1_0410"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(486718..486720,486808..486813,487075..487077)
                     /locus_tag="Mmc1_0410"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    486811..486813
                     /locus_tag="Mmc1_0410"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    487420..487857
                     /locus_tag="Mmc1_0410"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    487876..488358
                     /locus_tag="Mmc1_0410"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(487987..487989,488116..488118)
                     /locus_tag="Mmc1_0410"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(488002..488004,488011..488016,488026..488028,
                     488038..488040,488104..488106,488110..488121)
                     /locus_tag="Mmc1_0410"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(488092..488094,488176..488178)
                     /locus_tag="Mmc1_0410"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(488380..488745)
                     /locus_tag="Mmc1_0411"
                     /db_xref="GeneID:4480895"
     CDS             complement(488380..488745)
                     /locus_tag="Mmc1_0411"
                     /note="KEGG: psb:Psyr_3452 sulfate
                     transporter/antisigma-factor antagonist STAS"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864343.1"
                     /db_xref="GI:117923726"
                     /db_xref="InterPro:IPR003658"
                     /db_xref="GeneID:4480895"
                     /translation="MLECIARIENDRLTICLPRDFSNRHYPSFRASYKDHPNHWHYII
                     DCLQVTHLDSGALGMFLLLAQHIGTGDGHIRCINCKPLLAKQLQAAGFAQLLTIETLY
                     QGGGSNLHDGINPLASYAW"
     misc_feature    complement(488452..>488625)
                     /locus_tag="Mmc1_0411"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist) domain of anti-anti-sigma factors, key
                     regulators of anti-sigma factors by phosphorylation;
                     Region: STAS_anti-anti-sigma_factors; cd07043"
                     /db_xref="CDD:132914"
     misc_feature    complement(order(488470..488472,488476..488481,
                     488491..488493,488557..488562,488569..488577,
                     488581..488589,488593..488595))
                     /locus_tag="Mmc1_0411"
                     /note="anti sigma factor interaction site; other site"
                     /db_xref="CDD:132914"
     misc_feature    complement(488584..488586)
                     /locus_tag="Mmc1_0411"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:132914"
     gene            complement(488880..489359)
                     /locus_tag="Mmc1_0412"
                     /db_xref="GeneID:4480896"
     CDS             complement(488880..489359)
                     /locus_tag="Mmc1_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_864344.1"
                     /db_xref="GI:117923727"
                     /db_xref="GeneID:4480896"
                     /translation="MAKKKKKGAKEKLLSAAKRLKQEERARKKLMQATKQLKDQKKAS
                     AREDAPSGRGAIRVAQHLLTTPQPEPPRQPPPPVQASVPTLKEITPEILDLDRLHILG
                     QILDYAIAHNFLDEETVLRWGKRCVNDPMLAKLNLTVHDEKLPPTKPIRLKPNLYGG"
     gene            complement(489526..490686)
                     /locus_tag="Mmc1_0413"
                     /db_xref="GeneID:4480897"
     CDS             complement(489526..490686)
                     /locus_tag="Mmc1_0413"
                     /note="PFAM: glycosyl transferase, group 1;
                     KEGG: bha:BH2688 alpha-D-mannose-alpha(1-6)phosphatidyl
                     myo-inositol monomannoside transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_864345.1"
                     /db_xref="GI:117923728"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:4480897"
                     /translation="MATLMLTCRQIDLVLLLSERVPLQSWAQKGMLERELALYRAMQP
                     HLRSITLLSDGNRHELDFRPQVPGMHILCNRWGLRPWHYQRWLKMPWRGWQRGHVLFK
                     SNQLSSALLGLSLANHFKQKSITRCGYLLSEFAALHHGAASLARVRAFSREHRAFHGA
                     HRAVVTTPHMHSLLQQRYGIDPQKIFVQPNYVDCDLFQPAPRVQQNATTQRLLLVGRL
                     HPEKNILALLQAMIGLPKLHLDLIGQGEQLETLQQFVAQQALSVTFHGALPHRALVDF
                     YQQCDLFVLPSLQEGHPKALLEAMACGAPVLASDAPGNRDVVMHGNNGWLCQTDSASI
                     RHALQQLLPNQAQRQSLGQQARHYALQEVSLPVIAAREMALYEAIFNDSQRP"
     misc_feature    complement(489538..490647)
                     /locus_tag="Mmc1_0413"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(489556..490587)
                     /locus_tag="Mmc1_0413"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     gene            complement(490805..491749)
                     /locus_tag="Mmc1_0414"
                     /db_xref="GeneID:4480898"
     CDS             complement(490805..491749)
                     /locus_tag="Mmc1_0414"
                     /EC_number="1.8.1.9"
                     /note="KEGG: mag:amb0663 thioredoxin reductase;
                     TIGRFAM: thioredoxin reductase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="YP_864346.1"
                     /db_xref="GI:117923729"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:4480898"
                     /translation="MSEAKHHKLIILGSGPAGFTAAIYAARANLSPVVIQGLQPGGQL
                     TITTDVDNYPGFADGIQGPELMQRMQAQAERFNTEVIFDTVMHADLSKRPFTLNCDSG
                     DVYTCDALIISTGASARWLGMESEKKLNGFGVSACATCDGFFFKNQDVCVVGGGDTAV
                     EEALYLSNICNKVYLIHRRDALRAEKIMQDHMFAKENIIPVWDSVPDEMLGDPNKGGL
                     TGVRIKNVKTGALSELTVTGCFIAIGHRPNTEIFGDQLDKDANGYLVTKPGSTAMNIE
                     GVFAAGDVQDTVFRQAITAAGTGCMAAIEAERWLAAHA"
     misc_feature    complement(490820..491728)
                     /locus_tag="Mmc1_0414"
                     /note="thioredoxin-disulfide reductase; Region:
                     TRX_reduct; TIGR01292"
                     /db_xref="CDD:233345"
     misc_feature    complement(491201..491722)
                     /locus_tag="Mmc1_0414"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            491956..493428
                     /locus_tag="Mmc1_0415"
                     /db_xref="GeneID:4480899"
     CDS             491956..493428
                     /locus_tag="Mmc1_0415"
                     /EC_number="6.1.1.16"
                     /note="KEGG: mca:MCA0509 cysteinyl-tRNA synthetase;
                     TIGRFAM: cysteinyl-tRNA synthetase;
                     PFAM: cysteinyl-tRNA synthetase, class Ia"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="YP_864347.1"
                     /db_xref="GI:117923730"
                     /db_xref="InterPro:IPR002308"
                     /db_xref="GeneID:4480899"
                     /translation="MINKENSVGITIYNTLGRKKEPFVPMIPGKVGMYVCGVTVYDYS
                     HIGHARVMVVFDVIARHLRVTGFDLTYVRNFTDIDDKIIKRANERGESIQTLTQRYID
                     AFHQDMAALGVQPADIEPKATEHLPEMMQMIGTLMDKGVAYASGGDVYYAVERFANYG
                     QLSGKVLDEQEAGARVEVDSNKQNPMDFVLWKGAKPEEPQWDSPWGAGRPGWHIECSA
                     MGTKYLGASFDIHGGGRDLIFPHHENEIAQTEGCTGQHAVNYWIHNGFVNVVNEEGES
                     EKMSKSLGNFHTIRDLLALYPGEVLRFFILNSHYRSPLDFSFSLLEAAKAGLDRIYTA
                     LRSAQALLGKLPGTPIGEPADVPAGAPQDLVENYLKAMDDDFNTPQAIAFLFEAAKML
                     NTAISEQKDPAVIATWARLIRGLGHHLGLAGQDPELWFRSGIGAEQGLQAEAIEALIA
                     ERSAARAAKNWAESDRIRDTLAQQGIVLEDGQHGTQWSRK"
     misc_feature    491983..493425
                     /locus_tag="Mmc1_0415"
                     /note="cysteinyl-tRNA synthetase; Validated; Region: cysS;
                     PRK00260"
                     /db_xref="CDD:234705"
     misc_feature    491986..492906
                     /locus_tag="Mmc1_0415"
                     /note="catalytic core domain of cysteinyl tRNA synthetase;
                     Region: CysRS_core; cd00672"
                     /db_xref="CDD:173899"
     misc_feature    order(492061..492072,492088..492090,492094..492099,
                     492106..492111,492175..492177,492181..492183,
                     492589..492591,492601..492603,492652..492657,
                     492661..492666,492676..492678,492748..492756)
                     /locus_tag="Mmc1_0415"
                     /note="active site"
                     /db_xref="CDD:173899"
     misc_feature    492088..492099
                     /locus_tag="Mmc1_0415"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173899"
     misc_feature    492787..492801
                     /locus_tag="Mmc1_0415"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173899"
     misc_feature    492916..493422
                     /locus_tag="Mmc1_0415"
                     /note="Anticodon-binding domain of cysteinyl tRNA
                     synthetases; Region: Anticodon_Ia_Cys; cd07963"
                     /db_xref="CDD:153417"
     misc_feature    order(492922..492924,492934..492936,492943..492945,
                     492952..492954,492961..492963,493084..493086,
                     493090..493095,493102..493104,493111..493116,
                     493123..493125,493132..493134,493309..493311,
                     493321..493323,493336..493338,493348..493350,
                     493357..493359,493384..493395,493417..493419)
                     /locus_tag="Mmc1_0415"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153417"
     misc_feature    order(493309..493311,493321..493323,493336..493338,
                     493348..493350,493357..493359,493387..493395)
                     /locus_tag="Mmc1_0415"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153417"
     gene            493425..494165
                     /locus_tag="Mmc1_0416"
                     /db_xref="GeneID:4480900"
     CDS             493425..494165
                     /locus_tag="Mmc1_0416"
                     /note="TIGRFAM: RNA methyltransferase, TrmH family, group
                     3;
                     PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
                     methyltransferase, substrate binding;
                     KEGG: sdy:SDY_4409 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="YP_864348.1"
                     /db_xref="GI:117923731"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="GeneID:4480900"
                     /translation="MSDETKIHGVNPVQALLESGRPVSSLWVLKGRHGKRVEEMIEGF
                     RARGVPIQFCERTAMDRMADGGAHQGVIARCAPREAMSWDDLLDVVEKAKQPLLVILD
                     GVEDPHNLGAIMRSAEAFGALAVILPKDRTAPLNAGAIKASAGAAERLDLIRVTNLAR
                     AIEQLQQRNVWVIGLAGEAGAPLIGTLDCKGPLALVMGNEGSGLRRLTRERCDQLAAI
                     PMGGGVGSLNVSVATGVALYEVLRQRAG"
     misc_feature    493443..494162
                     /locus_tag="Mmc1_0416"
                     /note="23S rRNA (guanosine-2'-O-)-methyltransferase;
                     Provisional; Region: PRK11181"
                     /db_xref="CDD:183021"
     misc_feature    493443..493661
                     /locus_tag="Mmc1_0416"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; pfam08032"
                     /db_xref="CDD:254595"
     misc_feature    493710..494138
                     /locus_tag="Mmc1_0416"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            complement(494360..496465)
                     /locus_tag="Mmc1_0417"
                     /db_xref="GeneID:4480901"
     CDS             complement(494360..496465)
                     /locus_tag="Mmc1_0417"
                     /note="PFAM: peptidase M50;
                     KEGG: mag:amb3272 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M50"
                     /protein_id="YP_864349.1"
                     /db_xref="GI:117923732"
                     /db_xref="InterPro:IPR008915"
                     /db_xref="GeneID:4480901"
                     /translation="MDAAASPLPGLRDELSLHPGPALWDGSPTWTIRDPVRNRYFRIG
                     WAAFEALSRWEGTAGEVAAAVRAETTIDMSDAEVMEVARFLSGNQLTQASSHADTVRL
                     TAQATAENHSVFNRLLHHYLFFRIPLLRPDRFLGKVLPLVAWLGSPWFRWASLGALLL
                     GLTLVARQWELFAATLVETFSISGMVSYGLALSLVKIIHELAHGLTAKRFGCRVPTMG
                     VAFLVMWPVLYTDVNETWTLASRRQRLLVGAAGIMAELSVAAWATLLWAFLPDGSLRQ
                     GAFILAAFTWVSSLAINLLPFMRFDGYFLVMDALELPNLHPRAFAMARWWLRESLFAL
                     GEPPPEPMKPGRQRAMVAFAFAVWIYRLMLFLGIAALVYHFFIKIVGILLFAVEIGWF
                     VLLPIWSEVKAWVKRRERIFCGTRWMRPLFGLSLVLWVAIFPWRTRIEAPATVAAEIV
                     APLFLPAAARLEAVLVKRGQPVHAGMPLLLFTAPDILARQATIAAKLAGKRAEVEAVK
                     LDLFGRERLSALTEELARLDSEKAGLDAEAERLTVTAPHSGLFLDPLPDLQVGAWLSP
                     RQQLALIRADGATIATAYVAEDDLERIHEGDAVRFIPYSLDQASMVGTIHTMDRNPVK
                     VLTDPALATLYGGEIPVRVSGQNLVPQGGFFRIIIHLEGLPPPIKLVGHVQISGQAQS
                     LVGRVLRSALVVLVREWGA"
     misc_feature    complement(495533..>495898)
                     /locus_tag="Mmc1_0417"
                     /note="Site-2 protease (S2P) class of zinc
                     metalloproteases (MEROPS family M50) cleaves transmembrane
                     domains of substrate proteins, regulating intramembrane
                     proteolysis (RIP) of diverse signal transduction
                     mechanisms. Members of this family use proteolytic...;
                     Region: S2P-M50; cl10020"
                     /db_xref="CDD:245232"
     misc_feature    complement(495536..495898)
                     /locus_tag="Mmc1_0417"
                     /note="Peptidase family M50; Region: Peptidase_M50;
                     pfam02163"
                     /db_xref="CDD:251129"
     misc_feature    complement(order(495563..495565,495587..495589,
                     495857..495859,495866..495871))
                     /locus_tag="Mmc1_0417"
                     /note="active site"
                     /db_xref="CDD:100078"
     misc_feature    complement(495578..495589)
                     /locus_tag="Mmc1_0417"
                     /note="putative substrate binding region [chemical
                     binding]; other site"
                     /db_xref="CDD:100078"
     misc_feature    complement(<494609..495187)
                     /locus_tag="Mmc1_0417"
                     /note="Membrane-fusion protein [Cell envelope biogenesis,
                     outer membrane]; Region: AcrA; COG0845"
                     /db_xref="CDD:223914"
     misc_feature    complement(494972..495100)
                     /locus_tag="Mmc1_0417"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     gene            complement(496468..497778)
                     /locus_tag="Mmc1_0418"
                     /db_xref="GeneID:4480902"
     CDS             complement(496468..497778)
                     /locus_tag="Mmc1_0418"
                     /note="KEGG: mag:amb3273 membrane-fusion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-fusion protein"
                     /protein_id="YP_864350.1"
                     /db_xref="GI:117923733"
                     /db_xref="GeneID:4480902"
                     /translation="MSDNPLVALLGLEELARKAVDSAALGFVMVNDSRRLALYRQAAL
                     YIDGEGLKAVSGVTGIEKGAPFTLWLQRLLKRFAAEDVRQLGPHDMEGSDRQEWSEWL
                     PSHALLLPLAERDGKRLGVLLLAREEAWSEQEVALLTRAADFYGHAWSVLHRPSRWVT
                     WKSGLMAIPKWPLKLAVVMVVALCIPVRLSVLAPAEVVPHNPAVIRSPMDGVIQRVHV
                     RPNQSVAEGDLLFELERTMLASKLEVAKKALDTARAELDQASQQAIFDPKAKGTLAVI
                     RARVEERSAEVAQLEELLARAQVQAPRGGVAVLDDPTEWQGRPVVVGEKVLAVASPHD
                     VEVEAWLAPADVIQLEEGGPVSLFLNADPLSPVSGKLRYITYEAIPQADGTLGHRVRA
                     ELNKGEAGPRLGLKGTVRLDGRRVPLIYWLGRRPLAIIRTFVGL"
     misc_feature    complement(497029..497178)
                     /locus_tag="Mmc1_0418"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(496567..496887)
                     /locus_tag="Mmc1_0418"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(498020..498748)
                     /locus_tag="Mmc1_0419"
                     /db_xref="GeneID:4480903"
     CDS             complement(498020..498748)
                     /locus_tag="Mmc1_0419"
                     /note="KEGG: mag:amb3274 membrane-fusion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-fusion protein"
                     /protein_id="YP_864351.1"
                     /db_xref="GI:117923734"
                     /db_xref="GeneID:4480903"
                     /translation="MIRGITLAACLCCCGLATAAQDLTIPVQLVAVQFTTLSAELPGK
                     IDRITVKEGERFKGGRVLVGFDCTIQQAQVQEASAVLAAAEKSKAVHKRLLELHATGT
                     LEAEKSVWDAEVAQAKLNSARAAASKCIIVAPFSGRVAEQKARAFQYVQVGQPILDIL
                     DDSAFNAEFIVPSSALSTLKAGSQLQIVVHETGKLYPAKVARIGAKIDAVSHSMKVVA
                     EIRGDYPELVAGMTGRLQFTPIPP"
     misc_feature    complement(498032..498643)
                     /locus_tag="Mmc1_0419"
                     /note="HlyD family secretion protein; Region: HlyD;
                     pfam00529"
                     /db_xref="CDD:249933"
     misc_feature    complement(498059..498361)
                     /locus_tag="Mmc1_0419"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(498745..500403)
                     /locus_tag="Mmc1_0420"
                     /db_xref="GeneID:4480904"
     CDS             complement(498745..500403)
                     /locus_tag="Mmc1_0420"
                     /note="PFAM: outer membrane efflux protein;
                     KEGG: mag:amb3276 outer membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="YP_864352.1"
                     /db_xref="GI:117923735"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="GeneID:4480904"
                     /translation="MTTITNRRSTRLLAALSALALLSACSVKPTPFTQAEFAAQAKAD
                     RTAMFQGQQAVTTPLTLNEAVARVLKYNLDKRSKMMDEALALGQTYLDRYDLLPKLEI
                     NAGHTERSEINATRSRDLVTQTTTANPTYSEDRSSTTADLGLTWNILDFGVSYFTAHQ
                     NADRALIAQEKRRKTINNLVQEVRFTFWRAAAAQNLKTRVSQVIATAESALQDSERVE
                     GERLRNPIESLRVQKTMLESIRQLEAIDQELNAAKAELAALINLPPGSDFQLDVPSND
                     GMAIPEWPLSVEEMEEAAMVNNPDLREQGYQSRIALDDTRKEILKLLPGITLSFSRQY
                     DSNSFMVDNRWNDAGAKVTWNLLNLLSGPDRIAHSESVEKLAEVKRLALRMAVLAQVH
                     VVSHQFASASKQFERAHKLWTIERRLAEAAGNQSRGGTVNEIERISTETSAIAAELRR
                     YQTYAQVQLSYGKLQATIGADPVPERLASHALDGIAGAIVLDPVGGTQHVLAEDDLFR
                     QQDPTHTVRDENAEPLADADAHTGAALSWLEDSTSKAIKTEGHE"
     misc_feature    complement(498997..500331)
                     /locus_tag="Mmc1_0420"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    complement(499621..500223)
                     /locus_tag="Mmc1_0420"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(498997..499542)
                     /locus_tag="Mmc1_0420"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            complement(500425..504396)
                     /locus_tag="Mmc1_0421"
                     /db_xref="GeneID:4483908"
     CDS             complement(500425..504396)
                     /locus_tag="Mmc1_0421"
                     /note="PFAM: cadherin;
                     SMART: Dystroglycan-type cadherin domain protein;
                     KEGG: mag:amb3277 RTX toxins and related Ca2+-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cadherin"
                     /protein_id="YP_864353.1"
                     /db_xref="GI:117923736"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002126"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="GeneID:4483908"